>>3BNF:HELIX   23  23 SER A  333  GLY A  373  1                                  41    
SEQKLKDIVKQKFERKEFLQDIAFDNIGKAHLETGKAMELG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 23 23 SER A 333 GLY A 373 1 41 ATOM 2389 N SER A 333 -0.731 47.642 37.797 1.00 48.16 N ATOM 2390 CA SER A 333 0.156 46.555 37.419 1.00 46.22 C ATOM 2391 C SER A 333 1.314 46.927 36.513 1.00 45.20 C ATOM 2392 O SER A 333 1.236 47.845 35.683 1.00 43.82 O ATOM 2393 CB SER A 333 -0.613 45.362 36.816 1.00 46.27 C ATOM 2394 OG SER A 333 -1.389 45.733 35.706 1.00 45.52 O ATOM 2395 N GLU A 334 2.390 46.169 36.704 1.00 44.47 N ATOM 2396 CA GLU A 334 3.494 46.152 35.789 1.00 43.53 C ATOM 2397 C GLU A 334 2.987 45.736 34.427 1.00 43.41 C ATOM 2398 O GLU A 334 3.298 46.382 33.414 1.00 42.65 O ATOM 2399 CB GLU A 334 4.530 45.155 36.269 1.00 43.85 C ATOM 2400 CG GLU A 334 5.285 45.592 37.541 1.00 44.62 C ATOM 2401 CD GLU A 334 6.530 44.734 37.773 1.00 43.56 C ATOM 2402 OE1 GLU A 334 6.791 43.859 36.921 1.00 44.79 O ATOM 2403 OE2 GLU A 334 7.236 44.930 38.785 1.00 43.76 O ATOM 2404 N GLN A 335 2.173 44.677 34.435 1.00 42.51 N ATOM 2405 CA GLN A 335 1.719 44.021 33.224 1.00 42.42 C ATOM 2406 C GLN A 335 0.887 44.932 32.334 1.00 41.23 C ATOM 2407 O GLN A 335 1.166 45.053 31.126 1.00 41.80 O ATOM 2408 CB GLN A 335 0.986 42.710 33.541 1.00 42.81 C ATOM 2409 CG GLN A 335 0.945 41.730 32.354 1.00 45.15 C ATOM 2410 CD GLN A 335 2.189 41.809 31.507 1.00 47.46 C ATOM 2411 OE1 GLN A 335 3.235 41.308 31.893 1.00 50.66 O ATOM 2412 NE2 GLN A 335 2.091 42.479 30.358 1.00 48.54 N ATOM 2413 N LYS A 336 -0.103 45.602 32.911 1.00 39.53 N ATOM 2414 CA LYS A 336 -0.887 46.553 32.143 1.00 38.70 C ATOM 2415 C LYS A 336 0.033 47.604 31.529 1.00 38.35 C ATOM 2416 O LYS A 336 -0.081 47.927 30.348 1.00 37.77 O ATOM 2417 CB LYS A 336 -1.959 47.214 33.006 1.00 38.96 C ATOM 2418 CG LYS A 336 -2.593 45.865 33.337 0.00 35.22 C ATOM 2419 CD LYS A 336 -3.638 46.450 34.272 0.00 34.59 C ATOM 2420 CE LYS A 336 -4.734 45.444 34.568 0.00 34.14 C ATOM 2421 NZ LYS A 336 -4.201 44.213 35.209 0.00 33.68 N ATOM 2422 N LEU A 337 0.957 48.126 32.329 1.00 37.74 N ATOM 2423 CA LEU A 337 1.923 49.115 31.839 1.00 37.14 C ATOM 2424 C LEU A 337 2.885 48.608 30.731 1.00 37.28 C ATOM 2425 O LEU A 337 3.165 49.335 29.750 1.00 36.54 O ATOM 2426 CB LEU A 337 2.684 49.685 33.030 1.00 37.67 C ATOM 2427 CG LEU A 337 3.112 51.149 33.017 1.00 38.59 C ATOM 2428 CD1 LEU A 337 1.954 52.113 32.841 1.00 41.24 C ATOM 2429 CD2 LEU A 337 3.921 51.487 34.277 1.00 36.98 C ATOM 2430 N LYS A 338 3.392 47.383 30.864 1.00 36.43 N ATOM 2431 CA LYS A 338 4.156 46.766 29.781 1.00 36.77 C ATOM 2432 C LYS A 338 3.302 46.621 28.512 1.00 37.00 C ATOM 2433 O LYS A 338 3.778 46.891 27.401 1.00 38.02 O ATOM 2434 CB LYS A 338 4.642 45.396 30.192 1.00 37.39 C ATOM 2435 CG LYS A 338 6.103 45.314 30.619 1.00 39.21 C ATOM 2436 CD LYS A 338 6.382 44.002 31.314 1.00 41.71 C ATOM 2437 CE LYS A 338 7.876 43.633 31.195 1.00 44.30 C ATOM 2438 NZ LYS A 338 8.130 42.389 31.996 1.00 45.78 N ATOM 2439 N ASP A 339 2.050 46.196 28.671 1.00 36.26 N ATOM 2440 CA ASP A 339 1.116 46.059 27.522 1.00 35.67 C ATOM 2441 C ASP A 339 0.822 47.401 26.824 1.00 35.11 C ATOM 2442 O ASP A 339 0.666 47.447 25.607 1.00 33.00 O ATOM 2443 CB ASP A 339 -0.208 45.398 27.964 1.00 36.43 C ATOM 2444 CG ASP A 339 -0.046 43.947 28.401 1.00 37.90 C ATOM 2445 OD1 ASP A 339 0.939 43.270 28.039 1.00 39.66 O ATOM 2446 OD2 ASP A 339 -0.946 43.462 29.119 1.00 43.38 O ATOM 2447 N ILE A 340 0.720 48.482 27.592 1.00 34.64 N ATOM 2448 CA ILE A 340 0.498 49.823 27.044 1.00 35.59 C ATOM 2449 C ILE A 340 1.705 50.272 26.170 1.00 34.44 C ATOM 2450 O ILE A 340 1.548 50.948 25.151 1.00 34.11 O ATOM 2451 CB ILE A 340 0.163 50.848 28.175 1.00 35.79 C ATOM 2452 CG1 ILE A 340 -1.250 50.581 28.733 1.00 36.69 C ATOM 2453 CG2 ILE A 340 0.186 52.287 27.651 1.00 36.20 C ATOM 2454 CD1 ILE A 340 -1.479 51.011 30.237 1.00 37.30 C ATOM 2455 N VAL A 341 2.900 49.853 26.548 1.00 33.40 N ATOM 2456 CA VAL A 341 4.107 50.219 25.808 1.00 32.55 C ATOM 2457 C VAL A 341 4.222 49.411 24.526 1.00 32.58 C ATOM 2458 O VAL A 341 4.607 49.950 23.457 1.00 30.72 O ATOM 2459 CB VAL A 341 5.390 50.159 26.697 1.00 32.47 C ATOM 2460 CG1 VAL A 341 6.661 50.462 25.864 1.00 33.67 C ATOM 2461 CG2 VAL A 341 5.224 51.145 27.904 1.00 33.44 C ATOM 2462 N LYS A 342 3.860 48.124 24.623 1.00 32.42 N ATOM 2463 CA LYS A 342 3.792 47.269 23.482 1.00 32.90 C ATOM 2464 C LYS A 342 2.858 47.871 22.437 1.00 32.10 C ATOM 2465 O LYS A 342 3.143 47.831 21.234 1.00 31.85 O ATOM 2466 CB LYS A 342 3.298 45.868 23.902 1.00 33.33 C ATOM 2467 CG LYS A 342 3.032 44.914 22.716 1.00 34.27 C ATOM 2468 CD LYS A 342 2.504 43.568 23.197 1.00 34.31 C ATOM 2469 CE LYS A 342 2.908 42.681 22.001 0.00 39.58 C ATOM 2470 NZ LYS A 342 2.035 43.125 20.878 0.00 40.78 N ATOM 2471 N GLN A 343 1.730 48.406 22.895 1.00 30.30 N ATOM 2472 CA GLN A 343 0.737 48.969 21.969 1.00 29.67 C ATOM 2473 C GLN A 343 1.316 50.190 21.258 1.00 26.61 C ATOM 2474 O GLN A 343 1.146 50.356 20.045 1.00 24.78 O ATOM 2475 CB GLN A 343 -0.549 49.326 22.717 1.00 29.45 C ATOM 2476 CG GLN A 343 -1.331 48.100 23.200 1.00 32.08 C ATOM 2477 CD GLN A 343 -2.509 48.449 24.135 1.00 33.81 C ATOM 2478 OE1 GLN A 343 -3.470 49.112 23.731 1.00 40.20 O ATOM 2479 NE2 GLN A 343 -2.416 48.008 25.395 1.00 39.80 N ATOM 2480 N LYS A 344 2.013 51.042 22.004 1.00 25.59 N ATOM 2481 CA LYS A 344 2.729 52.176 21.396 1.00 23.92 C ATOM 2482 C LYS A 344 3.729 51.700 20.356 1.00 23.45 C ATOM 2483 O LYS A 344 3.825 52.280 19.264 1.00 24.01 O ATOM 2484 CB LYS A 344 3.459 53.014 22.457 1.00 23.33 C ATOM 2485 CG LYS A 344 2.535 53.524 23.562 1.00 21.65 C ATOM 2486 CD LYS A 344 3.374 54.499 24.433 1.00 21.80 C ATOM 2487 CE LYS A 344 2.549 55.120 25.565 1.00 21.55 C ATOM 2488 NZ LYS A 344 1.319 55.894 25.145 1.00 24.50 N ATOM 2489 N PHE A 345 4.490 50.660 20.697 1.00 22.39 N ATOM 2490 CA PHE A 345 5.470 50.150 19.766 1.00 22.92 C ATOM 2491 C PHE A 345 4.785 49.720 18.457 1.00 23.61 C ATOM 2492 O PHE A 345 5.259 50.051 17.333 1.00 22.86 O ATOM 2493 CB PHE A 345 6.266 48.979 20.360 1.00 23.99 C ATOM 2494 CG PHE A 345 7.394 48.554 19.461 1.00 23.72 C ATOM 2495 CD1 PHE A 345 8.582 49.301 19.414 1.00 26.43 C ATOM 2496 CD2 PHE A 345 7.258 47.474 18.625 1.00 26.93 C ATOM 2497 CE1 PHE A 345 9.636 48.939 18.564 1.00 26.44 C ATOM 2498 CE2 PHE A 345 8.344 47.080 17.795 1.00 22.60 C ATOM 2499 CZ PHE A 345 9.487 47.842 17.726 1.00 25.00 C ATOM 2500 N AGLU A 346 3.681 49.003 18.575 0.50 23.09 N ATOM 2501 N BGLU A 346 3.685 48.977 18.606 0.50 23.22 N ATOM 2502 CA AGLU A 346 3.006 48.506 17.380 0.50 24.65 C ATOM 2503 CA BGLU A 346 2.861 48.483 17.482 0.50 25.09 C ATOM 2504 C AGLU A 346 2.365 49.625 16.540 0.50 24.48 C ATOM 2505 C BGLU A 346 2.413 49.633 16.578 0.50 24.63 C ATOM 2506 O AGLU A 346 2.381 49.544 15.332 0.50 25.22 O ATOM 2507 O BGLU A 346 2.593 49.577 15.382 0.50 25.22 O ATOM 2508 CB AGLU A 346 2.058 47.352 17.710 0.50 24.40 C ATOM 2509 CB BGLU A 346 1.638 47.681 17.979 0.50 24.32 C ATOM 2510 CG AGLU A 346 2.815 46.101 18.284 0.50 26.26 C ATOM 2511 CG BGLU A 346 1.977 46.293 18.580 0.50 26.51 C ATOM 2512 CD AGLU A 346 3.825 45.497 17.287 0.50 29.69 C ATOM 2513 CD BGLU A 346 0.802 45.599 19.289 0.50 26.92 C ATOM 2514 OE1AGLU A 346 3.441 45.248 16.125 0.50 34.87 O ATOM 2515 OE1BGLU A 346 -0.361 46.072 19.210 0.50 30.58 O ATOM 2516 OE2AGLU A 346 5.013 45.299 17.651 0.50 31.36 O ATOM 2517 OE2BGLU A 346 1.059 44.564 19.942 0.50 29.23 O ATOM 2518 N ARG A 347 1.868 50.688 17.165 1.00 25.62 N ATOM 2519 CA ARG A 347 1.403 51.860 16.393 1.00 26.55 C ATOM 2520 C ARG A 347 2.560 52.498 15.639 1.00 25.00 C ATOM 2521 O ARG A 347 2.436 52.852 14.455 1.00 26.20 O ATOM 2522 CB ARG A 347 0.722 52.889 17.289 1.00 27.99 C ATOM 2523 CG ARG A 347 -0.645 52.403 17.850 1.00 27.01 C ATOM 2524 CD ARG A 347 -1.463 53.551 18.516 1.00 30.40 C ATOM 2525 NE ARG A 347 -0.836 53.946 19.757 1.00 38.82 N ATOM 2526 CZ ARG A 347 -1.205 53.546 20.965 1.00 36.15 C ATOM 2527 NH1 ARG A 347 -2.241 52.741 21.149 1.00 37.74 N ATOM 2528 NH2 ARG A 347 -0.515 53.967 21.999 1.00 38.52 N ATOM 2529 N LYS A 348 3.708 52.624 16.303 1.00 24.16 N ATOM 2530 CA LYS A 348 4.881 53.156 15.655 1.00 22.88 C ATOM 2531 C LYS A 348 5.325 52.288 14.461 1.00 23.13 C ATOM 2532 O LYS A 348 5.603 52.832 13.410 1.00 21.27 O ATOM 2533 CB LYS A 348 6.017 53.319 16.652 1.00 23.04 C ATOM 2534 CG LYS A 348 7.251 54.005 16.066 1.00 26.98 C ATOM 2535 CD LYS A 348 8.116 52.991 15.334 1.00 28.70 C ATOM 2536 CE LYS A 348 8.968 52.237 16.324 1.00 28.78 C ATOM 2537 NZ LYS A 348 9.776 51.196 15.639 1.00 27.74 N ATOM 2538 N GLU A 349 5.398 50.961 14.635 1.00 23.66 N ATOM 2539 CA GLU A 349 5.715 50.065 13.537 1.00 24.36 C ATOM 2540 C GLU A 349 4.811 50.247 12.342 1.00 25.07 C ATOM 2541 O GLU A 349 5.274 50.361 11.228 1.00 25.39 O ATOM 2542 CB GLU A 349 5.669 48.616 14.008 1.00 24.89 C ATOM 2543 CG GLU A 349 6.759 48.284 14.951 1.00 26.14 C ATOM 2544 CD GLU A 349 8.050 47.945 14.274 1.00 26.68 C ATOM 2545 OE1 GLU A 349 8.143 46.840 13.720 1.00 29.93 O ATOM 2546 OE2 GLU A 349 8.993 48.748 14.315 1.00 28.81 O ATOM 2547 N PHE A 350 3.506 50.288 12.600 1.00 24.71 N ATOM 2548 CA PHE A 350 2.496 50.462 11.583 1.00 24.84 C ATOM 2549 C PHE A 350 2.779 51.691 10.700 1.00 22.24 C ATOM 2550 O PHE A 350 2.894 51.556 9.488 1.00 22.69 O ATOM 2551 CB PHE A 350 1.119 50.579 12.262 1.00 24.95 C ATOM 2552 CG PHE A 350 0.003 50.838 11.313 1.00 25.62 C ATOM 2553 CD1 PHE A 350 -0.432 49.847 10.438 1.00 25.37 C ATOM 2554 CD2 PHE A 350 -0.622 52.097 11.290 1.00 25.74 C ATOM 2555 CE1 PHE A 350 -1.499 50.119 9.564 1.00 27.03 C ATOM 2556 CE2 PHE A 350 -1.642 52.367 10.426 1.00 28.32 C ATOM 2557 CZ PHE A 350 -2.094 51.371 9.558 1.00 28.15 C ATOM 2558 N LEU A 351 2.965 52.860 11.290 1.00 21.69 N ATOM 2559 CA LEU A 351 3.176 54.078 10.506 1.00 22.10 C ATOM 2560 C LEU A 351 4.596 54.104 9.885 1.00 21.63 C ATOM 2561 O LEU A 351 4.834 54.706 8.826 1.00 22.58 O ATOM 2562 CB LEU A 351 2.958 55.279 11.415 1.00 22.68 C ATOM 2563 CG LEU A 351 1.485 55.482 11.825 1.00 23.15 C ATOM 2564 CD1 LEU A 351 1.359 56.881 12.421 1.00 26.30 C ATOM 2565 CD2 LEU A 351 0.463 55.303 10.600 1.00 25.11 C ATOM 2566 N GLN A 352 5.527 53.458 10.572 1.00 20.67 N ATOM 2567 CA GLN A 352 6.919 53.378 10.125 1.00 20.88 C ATOM 2568 C GLN A 352 7.028 52.631 8.808 1.00 21.43 C ATOM 2569 O GLN A 352 7.729 53.079 7.873 1.00 22.08 O ATOM 2570 CB GLN A 352 7.794 52.702 11.149 1.00 20.04 C ATOM 2571 CG GLN A 352 9.189 52.338 10.570 1.00 21.17 C ATOM 2572 CD GLN A 352 10.216 51.882 11.607 1.00 22.87 C ATOM 2573 OE1 GLN A 352 11.319 51.425 11.262 1.00 24.29 O ATOM 2574 NE2 GLN A 352 9.857 52.020 12.878 1.00 21.83 N ATOM 2575 N ASP A 353 6.348 51.489 8.756 1.00 21.51 N ATOM 2576 CA ASP A 353 6.387 50.629 7.621 1.00 21.57 C ATOM 2577 C ASP A 353 5.727 51.284 6.443 1.00 22.43 C ATOM 2578 O ASP A 353 6.262 51.246 5.310 1.00 24.18 O ATOM 2579 CB ASP A 353 5.761 49.283 8.024 1.00 20.93 C ATOM 2580 CG ASP A 353 6.721 48.435 8.870 1.00 22.37 C ATOM 2581 OD1 ASP A 353 7.926 48.743 8.933 1.00 25.64 O ATOM 2582 OD2 ASP A 353 6.279 47.446 9.463 1.00 27.09 O ATOM 2583 N ILE A 354 4.589 51.930 6.677 1.00 22.27 N ATOM 2584 CA ILE A 354 3.969 52.751 5.617 1.00 23.33 C ATOM 2585 C ILE A 354 4.895 53.817 5.099 1.00 21.09 C ATOM 2586 O ILE A 354 5.146 53.859 3.883 1.00 22.76 O ATOM 2587 CB ILE A 354 2.612 53.385 6.066 1.00 22.05 C ATOM 2588 CG1 ILE A 354 1.586 52.273 6.314 1.00 25.33 C ATOM 2589 CG2 ILE A 354 2.107 54.358 5.015 1.00 24.92 C ATOM 2590 CD1 ILE A 354 0.303 52.743 7.110 1.00 25.40 C ATOM 2591 N ALA A 355 5.451 54.672 6.000 1.00 20.24 N ATOM 2592 CA ALA A 355 6.292 55.768 5.546 1.00 19.92 C ATOM 2593 C ALA A 355 7.491 55.281 4.748 1.00 19.35 C ATOM 2594 O ALA A 355 7.794 55.859 3.705 1.00 21.06 O ATOM 2595 CB ALA A 355 6.785 56.672 6.715 1.00 20.32 C ATOM 2596 N PHE A 356 8.211 54.292 5.273 1.00 19.70 N ATOM 2597 CA PHE A 356 9.400 53.847 4.573 1.00 20.04 C ATOM 2598 C PHE A 356 9.122 53.073 3.314 1.00 19.56 C ATOM 2599 O PHE A 356 9.957 53.063 2.391 1.00 21.69 O ATOM 2600 CB PHE A 356 10.388 53.194 5.507 1.00 21.77 C ATOM 2601 CG PHE A 356 11.162 54.190 6.303 1.00 21.92 C ATOM 2602 CD1 PHE A 356 12.335 54.709 5.781 1.00 22.79 C ATOM 2603 CD2 PHE A 356 10.713 54.629 7.572 1.00 22.76 C ATOM 2604 CE1 PHE A 356 13.097 55.655 6.503 1.00 24.72 C ATOM 2605 CE2 PHE A 356 11.480 55.520 8.334 1.00 24.42 C ATOM 2606 CZ PHE A 356 12.678 56.067 7.790 1.00 22.66 C ATOM 2607 N ASP A 357 7.952 52.476 3.228 1.00 19.75 N ATOM 2608 CA ASP A 357 7.551 51.893 1.941 1.00 21.44 C ATOM 2609 C ASP A 357 7.373 52.981 0.845 1.00 21.71 C ATOM 2610 O ASP A 357 7.929 52.872 -0.252 1.00 23.28 O ATOM 2611 CB ASP A 357 6.290 51.006 2.112 1.00 21.67 C ATOM 2612 CG ASP A 357 6.056 50.076 0.936 1.00 25.40 C ATOM 2613 OD1 ASP A 357 6.991 49.316 0.511 1.00 27.56 O ATOM 2614 OD2 ASP A 357 4.908 50.101 0.435 1.00 30.27 O ATOM 2615 N ASN A 358 6.619 54.044 1.138 1.00 24.00 N ATOM 2616 CA ASN A 358 6.460 55.136 0.161 1.00 23.38 C ATOM 2617 C ASN A 358 7.739 55.928 -0.094 1.00 22.67 C ATOM 2618 O ASN A 358 8.005 56.252 -1.236 1.00 22.96 O ATOM 2619 CB ASN A 358 5.281 56.006 0.525 1.00 24.83 C ATOM 2620 CG ASN A 358 4.003 55.247 0.480 1.00 25.23 C ATOM 2621 OD1 ASN A 358 3.723 54.518 -0.498 1.00 26.97 O ATOM 2622 ND2 ASN A 358 3.183 55.394 1.534 1.00 27.94 N ATOM 2623 N ILE A 359 8.541 56.191 0.942 1.00 20.80 N ATOM 2624 CA ILE A 359 9.916 56.731 0.768 1.00 19.66 C ATOM 2625 C ILE A 359 10.762 55.885 -0.213 1.00 20.96 C ATOM 2626 O ILE A 359 11.334 56.419 -1.172 1.00 20.03 O ATOM 2627 CB ILE A 359 10.646 56.910 2.124 1.00 18.62 C ATOM 2628 CG1 ILE A 359 9.865 57.958 2.948 1.00 20.84 C ATOM 2629 CG2 ILE A 359 12.097 57.339 1.848 1.00 18.25 C ATOM 2630 CD1 ILE A 359 10.310 58.130 4.448 1.00 16.04 C ATOM 2631 N GLY A 360 10.806 54.560 0.031 1.00 20.38 N ATOM 2632 CA GLY A 360 11.561 53.632 -0.826 1.00 19.58 C ATOM 2633 C GLY A 360 11.066 53.720 -2.244 1.00 20.27 C ATOM 2634 O GLY A 360 11.867 53.831 -3.215 1.00 21.88 O ATOM 2635 N LYS A 361 9.747 53.623 -2.393 1.00 20.70 N ATOM 2636 CA LYS A 361 9.133 53.680 -3.749 1.00 19.70 C ATOM 2637 C LYS A 361 9.505 54.998 -4.397 1.00 19.91 C ATOM 2638 O LYS A 361 9.812 55.053 -5.571 1.00 21.36 O ATOM 2639 CB LYS A 361 7.621 53.558 -3.664 1.00 20.97 C ATOM 2640 CG LYS A 361 7.153 52.112 -3.417 1.00 20.21 C ATOM 2641 CD LYS A 361 5.633 52.092 -3.180 1.00 20.27 C ATOM 2642 CE LYS A 361 5.243 50.636 -2.983 1.00 23.89 C ATOM 2643 NZ LYS A 361 3.791 50.419 -2.775 1.00 26.10 N ATOM 2644 N ALA A 362 9.473 56.058 -3.623 1.00 19.51 N ATOM 2645 CA ALA A 362 9.770 57.372 -4.224 1.00 19.43 C ATOM 2646 C ALA A 362 11.201 57.488 -4.702 1.00 18.98 C ATOM 2647 O ALA A 362 11.479 58.017 -5.797 1.00 18.03 O ATOM 2648 CB ALA A 362 9.426 58.525 -3.246 1.00 21.14 C ATOM 2649 N HIS A 363 12.149 57.015 -3.905 1.00 18.93 N ATOM 2650 CA HIS A 363 13.506 57.008 -4.411 1.00 19.62 C ATOM 2651 C HIS A 363 13.597 56.236 -5.731 1.00 21.31 C ATOM 2652 O HIS A 363 14.136 56.768 -6.699 1.00 21.36 O ATOM 2653 CB HIS A 363 14.478 56.402 -3.415 1.00 20.00 C ATOM 2654 CG HIS A 363 14.758 57.247 -2.206 1.00 20.05 C ATOM 2655 ND1 HIS A 363 15.482 58.433 -2.256 1.00 22.59 N ATOM 2656 CD2 HIS A 363 14.542 57.006 -0.892 1.00 19.12 C ATOM 2657 CE1 HIS A 363 15.628 58.903 -1.025 1.00 18.98 C ATOM 2658 NE2 HIS A 363 15.136 58.017 -0.183 1.00 18.93 N ATOM 2659 N LEU A 364 12.986 55.043 -5.771 1.00 20.32 N ATOM 2660 CA LEU A 364 13.113 54.103 -6.942 1.00 20.25 C ATOM 2661 C LEU A 364 12.460 54.680 -8.201 1.00 21.63 C ATOM 2662 O LEU A 364 13.059 54.713 -9.296 1.00 22.55 O ATOM 2663 CB LEU A 364 12.554 52.725 -6.578 1.00 20.19 C ATOM 2664 CG LEU A 364 13.367 51.933 -5.541 1.00 20.17 C ATOM 2665 CD1 LEU A 364 12.486 50.876 -4.848 1.00 20.33 C ATOM 2666 CD2 LEU A 364 14.640 51.287 -6.230 1.00 24.54 C ATOM 2667 N GLU A 365 11.288 55.248 -8.017 1.00 19.90 N ATOM 2668 CA GLU A 365 10.560 55.928 -9.096 1.00 21.49 C ATOM 2669 C GLU A 365 11.338 57.110 -9.631 1.00 20.22 C ATOM 2670 O GLU A 365 11.334 57.374 -10.822 1.00 21.36 O ATOM 2671 CB GLU A 365 9.188 56.341 -8.569 1.00 20.18 C ATOM 2672 CG GLU A 365 8.296 55.117 -8.350 1.00 20.51 C ATOM 2673 CD GLU A 365 7.065 55.322 -7.452 1.00 24.09 C ATOM 2674 OE1 GLU A 365 6.830 56.408 -6.880 1.00 26.12 O ATOM 2675 OE2 GLU A 365 6.311 54.317 -7.352 1.00 29.23 O ATOM 2676 N THR A 366 12.064 57.781 -8.746 1.00 21.14 N ATOM 2677 CA THR A 366 12.894 58.914 -9.126 1.00 21.97 C ATOM 2678 C THR A 366 14.115 58.432 -9.977 1.00 21.29 C ATOM 2679 O THR A 366 14.416 59.046 -11.037 1.00 23.25 O ATOM 2680 CB THR A 366 13.305 59.763 -7.880 1.00 22.72 C ATOM 2681 OG1 THR A 366 12.122 60.313 -7.222 1.00 22.72 O ATOM 2682 CG2 THR A 366 14.169 60.926 -8.345 1.00 22.95 C ATOM 2683 N GLY A 367 14.797 57.370 -9.527 1.00 22.45 N ATOM 2684 CA GLY A 367 15.924 56.739 -10.281 1.00 21.67 C ATOM 2685 C GLY A 367 15.415 56.340 -11.676 1.00 21.24 C ATOM 2686 O GLY A 367 16.110 56.601 -12.707 1.00 23.31 O ATOM 2687 N LYS A 368 14.208 55.771 -11.730 1.00 22.29 N ATOM 2688 CA LYS A 368 13.583 55.334 -12.990 1.00 21.94 C ATOM 2689 C LYS A 368 13.395 56.578 -13.837 1.00 23.74 C ATOM 2690 O LYS A 368 13.782 56.562 -15.028 1.00 23.39 O ATOM 2691 CB LYS A 368 12.225 54.612 -12.796 1.00 23.07 C ATOM 2692 CG LYS A 368 11.521 54.111 -14.106 1.00 22.55 C ATOM 2693 CD LYS A 368 12.388 53.164 -14.956 1.00 24.12 C ATOM 2694 CE LYS A 368 11.572 52.714 -16.207 1.00 24.84 C ATOM 2695 NZ LYS A 368 12.250 51.646 -17.027 1.00 27.70 N ATOM 2696 N ALA A 369 12.772 57.634 -13.267 1.00 22.24 N ATOM 2697 CA ALA A 369 12.591 58.873 -14.074 1.00 24.18 C ATOM 2698 C ALA A 369 13.924 59.396 -14.609 1.00 24.39 C ATOM 2699 O ALA A 369 14.001 59.900 -15.734 1.00 23.21 O ATOM 2700 CB ALA A 369 11.817 59.957 -13.295 1.00 25.49 C ATOM 2701 N MET A 370 14.984 59.245 -13.802 1.00 24.21 N ATOM 2702 CA MET A 370 16.328 59.679 -14.223 1.00 24.84 C ATOM 2703 C MET A 370 16.786 58.863 -15.429 1.00 25.63 C ATOM 2704 O MET A 370 17.269 59.406 -16.449 1.00 25.93 O ATOM 2705 CB MET A 370 17.282 59.516 -13.084 1.00 23.71 C ATOM 2706 CG MET A 370 17.051 60.609 -11.998 1.00 25.44 C ATOM 2707 SD MET A 370 17.746 60.030 -10.466 1.00 26.72 S ATOM 2708 CE MET A 370 19.462 59.870 -10.998 1.00 28.93 C ATOM 2709 N GLU A 371 16.619 57.552 -15.334 1.00 27.44 N ATOM 2710 CA GLU A 371 17.024 56.698 -16.450 1.00 28.49 C ATOM 2711 C GLU A 371 16.301 57.098 -17.740 1.00 28.56 C ATOM 2712 O GLU A 371 16.846 56.974 -18.832 1.00 30.15 O ATOM 2713 CB GLU A 371 16.750 55.230 -16.136 1.00 30.24 C ATOM 2714 CG GLU A 371 17.671 54.710 -15.077 1.00 34.85 C ATOM 2715 CD GLU A 371 17.340 53.296 -14.625 1.00 43.98 C ATOM 2716 OE1 GLU A 371 16.476 52.628 -15.257 1.00 45.50 O ATOM 2717 OE2 GLU A 371 17.940 52.866 -13.607 1.00 46.35 O ATOM 2718 N LEU A 372 15.065 57.543 -17.619 1.00 27.38 N ATOM 2719 CA LEU A 372 14.268 57.827 -18.812 1.00 26.48 C ATOM 2720 C LEU A 372 14.662 59.191 -19.371 1.00 26.84 C ATOM 2721 O LEU A 372 14.287 59.528 -20.485 1.00 27.27 O ATOM 2722 CB LEU A 372 12.786 57.773 -18.496 1.00 26.60 C ATOM 2723 CG LEU A 372 12.263 56.389 -18.085 1.00 22.94 C ATOM 2724 CD1 LEU A 372 10.893 56.543 -17.477 1.00 25.38 C ATOM 2725 CD2 LEU A 372 12.269 55.488 -19.341 1.00 23.46 C ATOM 2726 N GLY A 373 15.392 59.961 -18.573 1.00 26.82 N ATOM 2727 CA GLY A 373 15.994 61.220 -19.040 1.00 27.74 C ATOM 2728 C GLY A 373 15.343 62.441 -18.398 1.00 28.60 C ATOM 2729 O GLY A 373 15.470 63.559 -18.890 1.00 28.11 O