>>3CII:HELIX    2   2 GLY A   56  TYR A   85  1                                  30    
GSEYWDRETRSARDTAQIFRVNLRTLRGYY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 2 2 GLY A 56 TYR A 85 1 30 ATOM 442 N GLY A 56 -120.422 166.672-133.871 1.00111.19 N ATOM 443 CA GLY A 56 -119.979 167.785-134.719 1.00111.21 C ATOM 444 C GLY A 56 -120.845 168.081-135.937 1.00111.22 C ATOM 445 O GLY A 56 -121.936 167.535-136.092 1.00111.17 O ATOM 446 N SER A 57 -120.333 168.955-136.803 1.00111.25 N ATOM 447 CA SER A 57 -121.032 169.386-138.021 1.00111.21 C ATOM 448 C SER A 57 -121.252 168.217-138.981 1.00111.16 C ATOM 449 O SER A 57 -122.381 167.936-139.377 1.00111.05 O ATOM 450 CB SER A 57 -120.229 170.487-138.740 1.00111.26 C ATOM 451 OG SER A 57 -119.877 171.546-137.863 1.00111.29 O ATOM 452 N GLU A 58 -120.153 167.550-139.342 1.00111.23 N ATOM 453 CA GLU A 58 -120.148 166.384-140.238 1.00111.21 C ATOM 454 C GLU A 58 -121.455 165.604-140.171 1.00111.15 C ATOM 455 O GLU A 58 -122.083 165.359-141.195 1.00111.11 O ATOM 456 CB GLU A 58 -118.957 165.463-139.889 1.00111.30 C ATOM 457 CG GLU A 58 -118.835 164.153-140.704 1.00111.30 C ATOM 458 CD GLU A 58 -118.106 164.331-142.030 1.00111.32 C ATOM 459 OE1 GLU A 58 -118.772 164.232-143.088 1.00111.36 O ATOM 460 OE2 GLU A 58 -116.874 164.566-142.011 1.00111.16 O ATOM 461 N TYR A 59 -121.856 165.233-138.957 1.00111.16 N ATOM 462 CA TYR A 59 -123.061 164.425-138.734 1.00111.20 C ATOM 463 C TYR A 59 -124.365 165.173-139.029 1.00111.18 C ATOM 464 O TYR A 59 -125.242 164.654-139.729 1.00111.10 O ATOM 465 CB TYR A 59 -123.089 163.909-137.287 1.00111.23 C ATOM 466 CG TYR A 59 -124.424 163.322-136.868 1.00111.21 C ATOM 467 CD1 TYR A 59 -124.710 161.978-137.081 1.00111.25 C ATOM 468 CD2 TYR A 59 -125.399 164.113-136.261 1.00111.13 C ATOM 469 CE1 TYR A 59 -125.930 161.432-136.699 1.00111.25 C ATOM 470 CE2 TYR A 59 -126.618 163.578-135.882 1.00111.15 C ATOM 471 CZ TYR A 59 -126.879 162.238-136.100 1.00111.21 C ATOM 472 OH TYR A 59 -128.092 161.703-135.723 1.00111.19 O ATOM 473 N TRP A 60 -124.490 166.376-138.471 1.00111.21 N ATOM 474 CA TRP A 60 -125.735 167.151-138.552 1.00111.21 C ATOM 475 C TRP A 60 -126.071 167.568-139.991 1.00111.18 C ATOM 476 O TRP A 60 -127.201 167.394-140.451 1.00111.15 O ATOM 477 CB TRP A 60 -125.671 168.403-137.658 1.00111.23 C ATOM 478 CG TRP A 60 -125.685 168.140-136.181 1.00111.17 C ATOM 479 CD1 TRP A 60 -124.749 168.532-135.272 1.00111.25 C ATOM 480 CD2 TRP A 60 -126.690 167.444-135.445 1.00111.01 C ATOM 481 NE1 TRP A 60 -125.105 168.117-134.016 1.00111.25 N ATOM 482 CE2 TRP A 60 -126.295 167.446-134.095 1.00111.08 C ATOM 483 CE3 TRP A 60 -127.883 166.813-135.796 1.00111.11 C ATOM 484 CZ2 TRP A 60 -127.050 166.842-133.095 1.00111.11 C ATOM 485 CZ3 TRP A 60 -128.637 166.216-134.800 1.00111.18 C ATOM 486 CH2 TRP A 60 -128.216 166.231-133.466 1.00111.12 C ATOM 487 N ASP A 61 -125.089 168.126-140.692 1.00111.18 N ATOM 488 CA ASP A 61 -125.264 168.482-142.097 1.00111.20 C ATOM 489 C ASP A 61 -125.805 167.268-142.880 1.00111.20 C ATOM 490 O ASP A 61 -126.744 167.404-143.659 1.00111.24 O ATOM 491 CB ASP A 61 -123.937 168.975-142.717 1.00111.26 C ATOM 492 CG ASP A 61 -123.493 170.355-142.201 1.00111.23 C ATOM 493 OD1 ASP A 61 -124.171 170.938-141.329 1.00111.12 O ATOM 494 OD2 ASP A 61 -122.445 170.856-142.680 1.00111.15 O ATOM 495 N ARG A 62 -125.224 166.088-142.644 1.00111.20 N ATOM 496 CA ARG A 62 -125.594 164.859-143.370 1.00111.20 C ATOM 497 C ARG A 62 -126.977 164.332-143.010 1.00111.13 C ATOM 498 O ARG A 62 -127.557 163.565-143.772 1.00111.12 O ATOM 499 CB ARG A 62 -124.576 163.733-143.127 1.00111.27 C ATOM 500 CG ARG A 62 -123.327 163.753-144.033 1.00111.35 C ATOM 501 CD ARG A 62 -122.689 162.346-144.193 1.00111.35 C ATOM 502 NE ARG A 62 -122.075 161.811-142.962 1.00111.52 N ATOM 503 CZ ARG A 62 -122.678 161.030-142.049 1.00111.55 C ATOM 504 NH1 ARG A 62 -123.961 160.655-142.169 1.00111.40 N ATOM 505 NH2 ARG A 62 -121.987 160.617-140.982 1.00111.49 N ATOM 506 N GLU A 63 -127.488 164.712-141.844 1.00111.12 N ATOM 507 CA GLU A 63 -128.842 164.318-141.441 1.00111.18 C ATOM 508 C GLU A 63 -129.878 165.362-141.834 1.00111.10 C ATOM 509 O GLU A 63 -131.007 165.019-142.176 1.00111.04 O ATOM 510 CB GLU A 63 -128.910 164.037-139.938 1.00111.26 C ATOM 511 CG GLU A 63 -128.562 162.593-139.581 1.00111.42 C ATOM 512 CD GLU A 63 -129.685 161.616-139.906 1.00111.48 C ATOM 513 OE1 GLU A 63 -129.569 160.865-140.911 1.00111.37 O ATOM 514 OE2 GLU A 63 -130.680 161.595-139.144 1.00111.35 O ATOM 515 N THR A 64 -129.496 166.633-141.773 1.00111.11 N ATOM 516 CA THR A 64 -130.345 167.704-142.281 1.00111.14 C ATOM 517 C THR A 64 -130.540 167.513-143.781 1.00111.10 C ATOM 518 O THR A 64 -131.626 167.741-144.312 1.00111.07 O ATOM 519 CB THR A 64 -129.731 169.097-142.024 1.00111.15 C ATOM 520 OG1 THR A 64 -129.443 169.257-140.628 1.00111.13 O ATOM 521 CG2 THR A 64 -130.693 170.194-142.474 1.00111.13 C ATOM 522 N ARG A 65 -129.470 167.091-144.448 1.00111.13 N ATOM 523 CA ARG A 65 -129.498 166.757-145.874 1.00111.18 C ATOM 524 C ARG A 65 -130.645 165.829-146.227 1.00111.10 C ATOM 525 O ARG A 65 -131.290 165.995-147.249 1.00111.08 O ATOM 526 CB ARG A 65 -128.180 166.094-146.305 1.00111.32 C ATOM 527 CG ARG A 65 -127.291 166.935-147.234 1.00111.31 C ATOM 528 CD ARG A 65 -125.976 166.210-147.511 1.00111.16 C ATOM 529 NE ARG A 65 -125.375 166.599-148.781 1.00111.17 N ATOM 530 CZ ARG A 65 -124.789 167.771-149.019 1.00111.36 C ATOM 531 NH1 ARG A 65 -124.735 168.712-148.078 1.00111.37 N ATOM 532 NH2 ARG A 65 -124.253 168.008-150.216 1.00111.40 N ATOM 533 N SER A 66 -130.881 164.838-145.386 1.00111.13 N ATOM 534 CA SER A 66 -131.988 163.916-145.608 1.00111.25 C ATOM 535 C SER A 66 -133.339 164.542-145.226 1.00111.24 C ATOM 536 O SER A 66 -134.271 164.557-146.035 1.00111.25 O ATOM 537 CB SER A 66 -131.756 162.613-144.839 1.00111.40 C ATOM 538 OG SER A 66 -130.761 161.826-145.484 1.00111.59 O ATOM 539 N ALA A 67 -133.437 165.060-144.003 1.00111.15 N ATOM 540 CA ALA A 67 -134.665 165.701-143.533 1.00111.09 C ATOM 541 C ALA A 67 -135.209 166.658-144.581 1.00111.06 C ATOM 542 O ALA A 67 -136.296 166.449-145.103 1.00111.04 O ATOM 543 CB ALA A 67 -134.414 166.442-142.252 1.00111.13 C ATOM 544 N ARG A 68 -134.433 167.690-144.902 1.00111.11 N ATOM 545 CA ARG A 68 -134.826 168.677-145.912 1.00111.12 C ATOM 546 C ARG A 68 -135.311 167.989-147.186 1.00111.04 C ATOM 547 O ARG A 68 -136.401 168.262-147.669 1.00110.97 O ATOM 548 CB ARG A 68 -133.653 169.607-146.256 1.00111.19 C ATOM 549 CG ARG A 68 -133.326 170.703-145.229 1.00111.17 C ATOM 550 CD ARG A 68 -132.258 171.652-145.808 1.00111.22 C ATOM 551 NE ARG A 68 -131.601 172.519-144.814 1.00111.43 N ATOM 552 CZ ARG A 68 -130.473 173.220-145.026 1.00111.50 C ATOM 553 NH1 ARG A 68 -129.840 173.168-146.202 1.00111.45 N ATOM 554 NH2 ARG A 68 -129.958 173.981-144.055 1.00111.42 N ATOM 555 N ASP A 69 -134.491 167.088-147.715 1.00111.06 N ATOM 556 CA ASP A 69 -134.813 166.376-148.949 1.00111.10 C ATOM 557 C ASP A 69 -136.069 165.558-148.774 1.00111.05 C ATOM 558 O ASP A 69 -136.891 165.483-149.673 1.00111.05 O ATOM 559 CB ASP A 69 -133.668 165.445-149.381 1.00111.19 C ATOM 560 CG ASP A 69 -132.549 166.176-150.135 1.00111.33 C ATOM 561 OD1 ASP A 69 -132.805 167.204-150.819 1.00111.26 O ATOM 562 OD2 ASP A 69 -131.397 165.693-150.048 1.00111.45 O ATOM 563 N THR A 70 -136.216 164.940-147.615 1.00111.05 N ATOM 564 CA THR A 70 -137.388 164.132-147.357 1.00111.13 C ATOM 565 C THR A 70 -138.658 164.974-147.457 1.00111.18 C ATOM 566 O THR A 70 -139.656 164.505-147.984 1.00111.27 O ATOM 567 CB THR A 70 -137.324 163.467-145.987 1.00111.18 C ATOM 568 OG1 THR A 70 -136.004 162.952-145.761 1.00111.16 O ATOM 569 CG2 THR A 70 -138.336 162.338-145.917 1.00111.26 C ATOM 570 N ALA A 71 -138.606 166.218-146.975 1.00111.22 N ATOM 571 CA ALA A 71 -139.770 167.136-147.004 1.00111.19 C ATOM 572 C ALA A 71 -140.201 167.486-148.419 1.00111.12 C ATOM 573 O ALA A 71 -141.400 167.561-148.717 1.00110.93 O ATOM 574 CB ALA A 71 -139.461 168.420-146.242 1.00111.24 C ATOM 575 N GLN A 72 -139.201 167.723-149.267 1.00111.16 N ATOM 576 CA GLN A 72 -139.412 168.038-150.678 1.00111.18 C ATOM 577 C GLN A 72 -140.034 166.841-151.410 1.00111.20 C ATOM 578 O GLN A 72 -140.983 167.011-152.177 1.00111.28 O ATOM 579 CB GLN A 72 -138.090 168.471-151.355 1.00111.24 C ATOM 580 CG GLN A 72 -137.543 169.841-150.897 1.00111.19 C ATOM 581 CD GLN A 72 -136.226 170.248-151.576 1.00111.12 C ATOM 582 OE1 GLN A 72 -135.477 169.410-152.090 1.00111.03 O ATOM 583 NE2 GLN A 72 -135.940 171.546-151.562 1.00110.95 N ATOM 584 N ILE A 73 -139.515 165.637-151.165 1.00111.12 N ATOM 585 CA ILE A 73 -140.073 164.431-151.782 1.00111.09 C ATOM 586 C ILE A 73 -141.491 164.203-151.287 1.00111.09 C ATOM 587 O ILE A 73 -142.351 163.762-152.036 1.00111.12 O ATOM 588 CB ILE A 73 -139.270 163.165-151.468 1.00111.03 C ATOM 589 CG1 ILE A 73 -137.806 163.315-151.873 1.00111.01 C ATOM 590 CG2 ILE A 73 -139.868 161.987-152.207 1.00111.01 C ATOM 591 CD1 ILE A 73 -137.610 163.557-153.331 1.00111.00 C ATOM 592 N PHE A 74 -141.723 164.501-150.016 1.00111.14 N ATOM 593 CA PHE A 74 -143.049 164.358-149.429 1.00111.16 C ATOM 594 C PHE A 74 -143.996 165.462-149.881 1.00111.16 C ATOM 595 O PHE A 74 -145.183 165.217-150.075 1.00111.27 O ATOM 596 CB PHE A 74 -142.973 164.328-147.904 1.00111.28 C ATOM 597 CG PHE A 74 -142.802 162.950-147.332 1.00111.09 C ATOM 598 CD1 PHE A 74 -141.593 162.284-147.454 1.00111.05 C ATOM 599 CD2 PHE A 74 -143.845 162.333-146.662 1.00110.85 C ATOM 600 CE1 PHE A 74 -141.425 161.044-146.933 1.00111.10 C ATOM 601 CE2 PHE A 74 -143.681 161.093-146.137 1.00110.96 C ATOM 602 CZ PHE A 74 -142.461 160.445-146.275 1.00111.18 C ATOM 603 N ARG A 75 -143.495 166.677-150.051 1.00111.08 N ATOM 604 CA ARG A 75 -144.329 167.706-150.648 1.00111.09 C ATOM 605 C ARG A 75 -144.991 167.131-151.891 1.00111.00 C ATOM 606 O ARG A 75 -146.207 167.181-152.026 1.00110.91 O ATOM 607 CB ARG A 75 -143.513 168.940-151.019 1.00111.21 C ATOM 608 CG ARG A 75 -144.311 170.018-151.760 1.00111.18 C ATOM 609 CD ARG A 75 -143.535 171.323-151.885 1.00111.09 C ATOM 610 NE ARG A 75 -144.289 172.327-152.630 1.00110.98 N ATOM 611 CZ ARG A 75 -143.968 173.614-152.701 1.00111.05 C ATOM 612 NH1 ARG A 75 -142.891 174.085-152.074 1.00111.03 N ATOM 613 NH2 ARG A 75 -144.737 174.437-153.401 1.00111.09 N ATOM 614 N VAL A 76 -144.179 166.548-152.769 1.00110.98 N ATOM 615 CA VAL A 76 -144.653 166.041-154.058 1.00111.03 C ATOM 616 C VAL A 76 -145.661 164.903-153.931 1.00111.10 C ATOM 617 O VAL A 76 -146.601 164.821-154.712 1.00111.18 O ATOM 618 CB VAL A 76 -143.498 165.555-154.934 1.00110.97 C ATOM 619 CG1 VAL A 76 -144.014 165.171-156.305 1.00110.97 C ATOM 620 CG2 VAL A 76 -142.448 166.632-155.053 1.00111.00 C ATOM 621 N ASN A 77 -145.456 164.011-152.968 1.00111.21 N ATOM 622 CA ASN A 77 -146.409 162.918-152.720 1.00111.14 C ATOM 623 C ASN A 77 -147.762 163.466-152.266 1.00111.01 C ATOM 624 O ASN A 77 -148.804 163.057-152.764 1.00110.85 O ATOM 625 CB ASN A 77 -145.860 161.922-151.681 1.00111.18 C ATOM 626 CG ASN A 77 -144.697 161.078-152.212 1.00111.03 C ATOM 627 OD1 ASN A 77 -144.561 160.838-153.422 1.00110.76 O ATOM 628 ND2 ASN A 77 -143.861 160.613-151.296 1.00111.05 N ATOM 629 N LEU A 78 -147.724 164.414-151.335 1.00110.98 N ATOM 630 CA LEU A 78 -148.930 165.087-150.853 1.00111.07 C ATOM 631 C LEU A 78 -149.745 165.745-151.970 1.00111.22 C ATOM 632 O LEU A 78 -150.915 166.099-151.773 1.00111.37 O ATOM 633 CB LEU A 78 -148.564 166.140-149.809 1.00111.00 C ATOM 634 CG LEU A 78 -148.746 165.669-148.375 1.00110.90 C ATOM 635 CD1 LEU A 78 -148.145 166.656-147.405 1.00111.02 C ATOM 636 CD2 LEU A 78 -150.212 165.476-148.094 1.00110.94 C ATOM 637 N ARG A 79 -149.108 165.924-153.125 1.00111.27 N ATOM 638 CA ARG A 79 -149.747 166.457-154.335 1.00111.21 C ATOM 639 C ARG A 79 -150.089 165.288-155.277 1.00111.17 C ATOM 640 O ARG A 79 -151.177 165.260-155.863 1.00111.00 O ATOM 641 CB ARG A 79 -148.791 167.460-155.017 1.00111.30 C ATOM 642 CG ARG A 79 -149.430 168.719-155.613 1.00111.27 C ATOM 643 CD ARG A 79 -148.449 169.938-155.681 1.00111.27 C ATOM 644 NE ARG A 79 -148.459 170.762-154.456 1.00111.22 N ATOM 645 CZ ARG A 79 -148.017 172.020-154.360 1.00110.98 C ATOM 646 NH1 ARG A 79 -148.086 172.655-153.197 1.00110.81 N ATOM 647 NH2 ARG A 79 -147.514 172.652-155.411 1.00110.92 N ATOM 648 N THR A 80 -149.155 164.330-155.402 1.00111.15 N ATOM 649 CA THR A 80 -149.338 163.130-156.233 1.00111.11 C ATOM 650 C THR A 80 -150.484 162.289-155.694 1.00111.11 C ATOM 651 O THR A 80 -151.311 161.792-156.460 1.00111.09 O ATOM 652 CB THR A 80 -148.076 162.214-156.277 1.00111.03 C ATOM 653 OG1 THR A 80 -146.882 162.999-156.341 1.00110.92 O ATOM 654 CG2 THR A 80 -148.128 161.292-157.481 1.00110.99 C ATOM 655 N LEU A 81 -150.514 162.133-154.371 1.00111.12 N ATOM 656 CA LEU A 81 -151.575 161.384-153.687 1.00111.16 C ATOM 657 C LEU A 81 -152.936 162.048-153.854 1.00111.23 C ATOM 658 O LEU A 81 -153.940 161.367-154.078 1.00111.30 O ATOM 659 CB LEU A 81 -151.272 161.221-152.193 1.00111.10 C ATOM 660 CG LEU A 81 -150.454 159.980-151.830 1.00111.01 C ATOM 661 CD1 LEU A 81 -149.619 160.217-150.601 1.00111.08 C ATOM 662 CD2 LEU A 81 -151.362 158.781-151.625 1.00110.95 C ATOM 663 N ARG A 82 -152.968 163.374-153.750 1.00111.24 N ATOM 664 CA ARG A 82 -154.220 164.113-153.905 1.00111.24 C ATOM 665 C ARG A 82 -154.829 163.890-155.296 1.00111.24 C ATOM 666 O ARG A 82 -156.051 163.969-155.473 1.00111.24 O ATOM 667 CB ARG A 82 -154.013 165.607-153.641 1.00111.25 C ATOM 668 CG ARG A 82 -155.314 166.318-153.295 1.00111.35 C ATOM 669 CD ARG A 82 -155.106 167.765-152.881 1.00111.39 C ATOM 670 NE ARG A 82 -154.837 168.631-154.028 1.00111.32 N ATOM 671 CZ ARG A 82 -153.664 169.202-154.295 1.00111.27 C ATOM 672 NH1 ARG A 82 -152.605 169.016-153.497 1.00111.10 N ATOM 673 NH2 ARG A 82 -153.553 169.972-155.377 1.00111.23 N ATOM 674 N GLY A 83 -153.968 163.605-156.273 1.00111.25 N ATOM 675 CA GLY A 83 -154.404 163.210-157.612 1.00111.24 C ATOM 676 C GLY A 83 -155.120 161.869-157.617 1.00111.18 C ATOM 677 O GLY A 83 -156.271 161.770-158.050 1.00111.11 O ATOM 678 N TYR A 84 -154.438 160.841-157.117 1.00111.16 N ATOM 679 CA TYR A 84 -155.002 159.497-157.048 1.00111.16 C ATOM 680 C TYR A 84 -156.407 159.538-156.466 1.00111.14 C ATOM 681 O TYR A 84 -157.343 158.985-157.042 1.00111.18 O ATOM 682 CB TYR A 84 -154.138 158.573-156.180 1.00111.18 C ATOM 683 CG TYR A 84 -152.745 158.262-156.704 1.00111.21 C ATOM 684 CD1 TYR A 84 -152.460 158.251-158.068 1.00111.13 C ATOM 685 CD2 TYR A 84 -151.719 157.931-155.822 1.00111.24 C ATOM 686 CE1 TYR A 84 -151.188 157.947-158.530 1.00111.16 C ATOM 687 CE2 TYR A 84 -150.449 157.623-156.277 1.00111.13 C ATOM 688 CZ TYR A 84 -150.188 157.632-157.632 1.00111.17 C ATOM 689 OH TYR A 84 -148.927 157.325-158.093 1.00111.25 O ATOM 690 N TYR A 85 -156.548 160.216-155.331 1.00111.14 N ATOM 691 CA TYR A 85 -157.814 160.256-154.600 1.00111.17 C ATOM 692 C TYR A 85 -158.818 161.279-155.166 1.00111.12 C ATOM 693 O TYR A 85 -159.910 161.440-154.617 1.00111.04 O ATOM 694 CB TYR A 85 -157.547 160.518-153.108 1.00111.17 C ATOM 695 CG TYR A 85 -156.981 159.322-152.347 1.00111.18 C ATOM 696 CD1 TYR A 85 -155.614 159.196-152.118 1.00111.11 C ATOM 697 CD2 TYR A 85 -157.819 158.328-151.842 1.00111.20 C ATOM 698 CE1 TYR A 85 -155.099 158.115-151.416 1.00111.08 C ATOM 699 CE2 TYR A 85 -157.311 157.243-151.139 1.00111.10 C ATOM 700 CZ TYR A 85 -155.951 157.145-150.931 1.00111.06 C ATOM 701 OH TYR A 85 -155.440 156.075-150.235 1.00111.11 O