>>3H0G:HELIX  201 201 LEU N  394  GLU N  423  1                                  30    
LAGPLLASLFRMLFRKMTRDVYKYMQKCVE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 201 201 LEU N 394 GLU N 423 1 30 ATOM 45944 N LEU N 394 106.696 33.651 -57.317 1.00155.16 N ANISOU45944 N LEU N 394 16420 19492 23041 -8464 -4349 -945 N ATOM 45945 CA LEU N 394 106.734 32.184 -57.248 1.00186.13 C ANISOU45945 CA LEU N 394 19855 23364 27502 -8522 -4731 -920 C ATOM 45946 C LEU N 394 107.174 31.662 -55.878 1.00212.29 C ANISOU45946 C LEU N 394 23019 26680 30962 -8567 -4790 -758 C ATOM 45947 O LEU N 394 107.108 32.388 -54.883 1.00224.92 O ANISOU45947 O LEU N 394 24860 28330 32268 -8489 -4538 -551 O ATOM 45948 CB LEU N 394 107.641 31.593 -58.337 1.00183.20 C ANISOU45948 CB LEU N 394 19340 22952 27317 -8710 -4964 -1404 C ATOM 45949 CG LEU N 394 107.126 31.476 -59.772 1.00193.32 C ANISOU45949 CG LEU N 394 20543 24228 28684 -8662 -5082 -1550 C ATOM 45950 CD1 LEU N 394 108.074 30.589 -60.576 1.00206.57 C ANISOU45950 CD1 LEU N 394 21970 25872 30645 -8849 -5382 -1995 C ATOM 45951 CD2 LEU N 394 105.727 30.911 -59.797 1.00212.54 C ANISOU45951 CD2 LEU N 394 22692 26638 31425 -8464 -5233 -1145 C ATOM 45952 N ALA N 395 107.595 30.399 -55.830 1.00156.58 N ANISOU45952 N ALA N 395 15552 19573 24367 -8684 -5130 -847 N ATOM 45953 CA ALA N 395 107.970 29.758 -54.569 1.00162.79 C ANISOU45953 CA ALA N 395 16136 20362 25355 -8731 -5226 -676 C ATOM 45954 C ALA N 395 109.273 30.313 -53.982 1.00168.43 C ANISOU45954 C ALA N 395 17145 21081 25771 -8890 -5055 -964 C ATOM 45955 O ALA N 395 109.680 29.935 -52.881 1.00177.00 O ANISOU45955 O ALA N 395 18125 22174 26952 -8931 -5093 -847 O ATOM 45956 CB ALA N 395 108.052 28.235 -54.739 1.00163.03 C ANISOU45956 CB ALA N 395 15620 20330 25995 -8821 -5655 -699 C ATOM 45957 N GLY N 396 109.911 31.209 -54.729 1.00235.88 N ANISOU45957 N GLY N 396 26047 29615 33961 -8972 -4870 -1333 N ATOM 45958 CA GLY N 396 111.157 31.834 -54.312 1.00235.48 C ANISOU45958 CA GLY N 396 26303 29548 33621 -9115 -4698 -1637 C ATOM 45959 C GLY N 396 110.898 33.001 -53.388 1.00238.75 C ANISOU45959 C GLY N 396 27088 30026 33599 -8968 -4345 -1407 C ATOM 45960 O GLY N 396 110.836 32.808 -52.183 1.00239.09 O ANISOU45960 O GLY N 396 27063 30102 33678 -8911 -4327 -1151 O ATOM 45961 N PRO N 397 110.724 34.205 -53.954 1.00306.85 N ANISOU45961 N PRO N 397 36090 38677 41821 -8899 -4069 -1493 N ATOM 45962 CA PRO N 397 110.471 35.431 -53.185 1.00311.44 C ANISOU45962 CA PRO N 397 37042 39320 41970 -8754 -3726 -1309 C ATOM 45963 C PRO N 397 109.433 35.233 -52.079 1.00324.34 C ANISOU45963 C PRO N 397 38540 41030 43665 -8555 -3703 -792 C ATOM 45964 O PRO N 397 109.311 36.097 -51.206 1.00329.26 O ANISOU45964 O PRO N 397 39423 41716 43967 -8435 -3451 -630 O ATOM 45965 CB PRO N 397 109.931 36.400 -54.241 1.00293.93 C ANISOU45965 CB PRO N 397 35084 37124 39473 -8677 -3535 -1365 C ATOM 45966 CG PRO N 397 110.539 35.947 -55.515 1.00286.65 C ANISOU45966 CG PRO N 397 34058 36143 38712 -8846 -3713 -1759 C ATOM 45967 CD PRO N 397 110.724 34.450 -55.407 1.00291.91 C ANISOU45967 CD PRO N 397 34271 36765 39876 -8948 -4082 -1768 C ATOM 45968 N LEU N 398 108.705 34.122 -52.121 1.00262.52 N ANISOU45968 N LEU N 398 30302 33196 36246 -8513 -3964 -541 N ATOM 45969 CA LEU N 398 107.689 33.833 -51.116 1.00274.63 C ANISOU45969 CA LEU N 398 31663 34801 37883 -8320 -3962 -27 C ATOM 45970 C LEU N 398 108.306 33.192 -49.877 1.00293.84 C ANISOU45970 C LEU N 398 33921 37253 40470 -8372 -4061 57 C ATOM 45971 O LEU N 398 107.977 33.557 -48.749 1.00307.10 O ANISOU45971 O LEU N 398 35687 39021 41974 -8225 -3902 361 O ATOM 45972 CB LEU N 398 106.607 32.920 -51.696 1.00264.86 C ANISOU45972 CB LEU N 398 30047 33538 37049 -8237 -4204 229 C ATOM 45973 CG LEU N 398 105.486 33.608 -52.477 1.00249.05 C ANISOU45973 CG LEU N 398 28203 31546 34878 -8079 -4060 384 C ATOM 45974 CD1 LEU N 398 104.452 32.594 -52.941 1.00251.49 C ANISOU45974 CD1 LEU N 398 28102 31811 35640 -7989 -4330 647 C ATOM 45975 CD2 LEU N 398 104.835 34.696 -51.636 1.00253.35 C ANISOU45975 CD2 LEU N 398 29055 32182 35025 -7888 -3731 701 C ATOM 45976 N LEU N 399 109.203 32.237 -50.096 1.00179.66 N ANISOU45976 N LEU N 399 19210 22717 26336 -8579 -4326 -219 N ATOM 45977 CA LEU N 399 109.869 31.546 -48.999 1.00180.50 C ANISOU45977 CA LEU N 399 19126 22830 26627 -8658 -4447 -172 C ATOM 45978 C LEU N 399 110.917 32.438 -48.341 1.00180.17 C ANISOU45978 C LEU N 399 19469 22794 26192 -8718 -4211 -415 C ATOM 45979 O LEU N 399 111.406 32.138 -47.252 1.00183.95 O ANISOU45979 O LEU N 399 19881 23299 26714 -8739 -4235 -340 O ATOM 45980 CB LEU N 399 110.517 30.252 -49.494 1.00177.93 C ANISOU45980 CB LEU N 399 18407 22408 26789 -8876 -4816 -414 C ATOM 45981 CG LEU N 399 109.578 29.065 -49.717 1.00179.87 C ANISOU45981 CG LEU N 399 18151 22646 27545 -8811 -5120 -109 C ATOM 45982 CD1 LEU N 399 110.368 27.810 -50.054 1.00177.53 C ANISOU45982 CD1 LEU N 399 17464 22260 27731 -9040 -5488 -375 C ATOM 45983 CD2 LEU N 399 108.699 28.838 -48.496 1.00181.79 C ANISOU45983 CD2 LEU N 399 18225 22985 27862 -8609 -5084 447 C ATOM 45984 N ALA N 400 111.254 33.536 -49.009 1.00408.22 N ANISOU45984 N ALA N 400 48748 51652 54706 -8739 -3988 -702 N ATOM 45985 CA ALA N 400 112.243 34.474 -48.491 1.00409.04 C ANISOU45985 CA ALA N 400 49231 51742 54441 -8784 -3759 -954 C ATOM 45986 C ALA N 400 111.652 35.340 -47.383 1.00420.14 C ANISOU45986 C ALA N 400 50858 53266 55509 -8550 -3492 -618 C ATOM 45987 O ALA N 400 112.162 35.365 -46.263 1.00436.70 O ANISOU45987 O ALA N 400 52999 55396 57532 -8532 -3446 -577 O ATOM 45988 CB ALA N 400 112.787 35.344 -49.614 1.00389.76 C ANISOU45988 CB ALA N 400 47110 49233 51749 -8878 -3619 -1359 C ATOM 45989 N SER N 401 110.574 36.048 -47.703 1.00302.56 N ANISOU45989 N SER N 401 36103 38441 40414 -8369 -3321 -383 N ATOM 45990 CA SER N 401 109.911 36.915 -46.736 1.00302.68 C ANISOU45990 CA SER N 401 36326 38577 40101 -8135 -3066 -60 C ATOM 45991 C SER N 401 109.598 36.162 -45.447 1.00325.07 C ANISOU45991 C SER N 401 38894 41506 43113 -8031 -3164 314 C ATOM 45992 O SER N 401 109.552 36.752 -44.367 1.00326.59 O ANISOU45992 O SER N 401 39253 41799 43040 -7882 -2982 478 O ATOM 45993 CB SER N 401 108.629 37.498 -47.329 1.00196.67 C ANISOU45993 CB SER N 401 22985 25200 26540 -7967 -2933 193 C ATOM 45994 OG SER N 401 107.762 36.472 -47.779 1.00202.10 O ANISOU45994 OG SER N 401 23299 25876 27612 -7946 -3164 441 O ATOM 45995 N LEU N 402 109.383 34.856 -45.568 1.00322.60 N ANISOU45995 N LEU N 402 38151 41164 43256 -8103 -3458 449 N ATOM 45996 CA LEU N 402 109.075 34.021 -44.414 1.00346.00 C ANISOU45996 CA LEU N 402 40803 44215 46445 -8015 -3580 824 C ATOM 45997 C LEU N 402 110.342 33.640 -43.656 1.00362.31 C ANISOU45997 C LEU N 402 42842 46253 48568 -8166 -3661 592 C ATOM 45998 O LEU N 402 110.430 33.828 -42.443 1.00367.36 O ANISOU45998 O LEU N 402 43534 46996 49052 -8050 -3557 779 O ATOM 45999 CB LEU N 402 108.324 32.760 -44.851 1.00258.86 C ANISOU45999 CB LEU N 402 29290 33150 35915 -8026 -3878 1073 C ATOM 46000 CG LEU N 402 107.588 32.839 -46.190 1.00238.86 C ANISOU46000 CG LEU N 402 26743 30549 33464 -8018 -3918 1035 C ATOM 46001 CD1 LEU N 402 107.295 31.445 -46.725 1.00230.26 C ANISOU46001 CD1 LEU N 402 25157 29388 32944 -8101 -4281 1115 C ATOM 46002 CD2 LEU N 402 106.307 33.645 -46.052 1.00234.68 C ANISOU46002 CD2 LEU N 402 26381 30111 32677 -7762 -3688 1413 C ATOM 46003 N PHE N 403 111.320 33.104 -44.379 1.00255.78 N ANISOU46003 N PHE N 403 29267 32622 35297 -8423 -3849 181 N ATOM 46004 CA PHE N 403 112.583 32.698 -43.776 1.00249.42 C ANISOU46004 CA PHE N 403 28432 31759 34578 -8598 -3946 -80 C ATOM 46005 C PHE N 403 113.152 33.803 -42.891 1.00252.10 C ANISOU46005 C PHE N 403 29177 32144 34464 -8509 -3665 -177 C ATOM 46006 O PHE N 403 113.714 33.534 -41.830 1.00251.12 O ANISOU46006 O PHE N 403 29006 32053 34357 -8517 -3690 -143 O ATOM 46007 CB PHE N 403 113.595 32.317 -44.858 1.00245.16 C ANISOU46007 CB PHE N 403 27867 31053 34229 -8881 -4118 -582 C ATOM 46008 CG PHE N 403 114.860 31.712 -44.319 1.00243.00 C ANISOU46008 CG PHE N 403 27504 30698 34128 -9089 -4265 -845 C ATOM 46009 CD1 PHE N 403 114.980 30.341 -44.170 1.00239.40 C ANISOU46009 CD1 PHE N 403 26588 30212 34161 -9221 -4588 -768 C ATOM 46010 CD2 PHE N 403 115.930 32.516 -43.961 1.00240.68 C ANISOU46010 CD2 PHE N 403 27576 30346 33524 -9152 -4088 -1170 C ATOM 46011 CE1 PHE N 403 116.143 29.782 -43.675 1.00244.67 C ANISOU46011 CE1 PHE N 403 27171 30797 34995 -9423 -4727 -1012 C ATOM 46012 CE2 PHE N 403 117.095 31.963 -43.464 1.00245.67 C ANISOU46012 CE2 PHE N 403 28135 30887 34321 -9346 -4224 -1416 C ATOM 46013 CZ PHE N 403 117.202 30.594 -43.322 1.00242.93 C ANISOU46013 CZ PHE N 403 27335 30514 34452 -9487 -4542 -1337 C ATOM 46014 N ARG N 404 113.002 35.046 -43.337 1.00523.68 N ANISOU46014 N ARG N 404 63963 66544 68469 -8421 -3405 -300 N ATOM 46015 CA ARG N 404 113.499 36.193 -42.588 1.00521.58 C ANISOU46015 CA ARG N 404 64090 66314 67774 -8318 -3137 -411 C ATOM 46016 C ARG N 404 112.542 36.573 -41.463 1.00527.33 C ANISOU46016 C ARG N 404 64838 67230 68295 -8029 -2978 53 C ATOM 46017 O ARG N 404 112.944 37.182 -40.472 1.00530.44 O ANISOU46017 O ARG N 404 65439 67686 68418 -7922 -2823 41 O ATOM 46018 CB ARG N 404 113.717 37.389 -43.519 1.00410.50 C ANISOU46018 CB ARG N 404 50408 52172 53389 -8336 -2928 -721 C ATOM 46019 CG ARG N 404 112.474 38.233 -43.745 1.00400.85 C ANISOU46019 CG ARG N 404 49332 51057 51914 -8113 -2723 -432 C ATOM 46020 CD ARG N 404 112.834 39.687 -44.005 1.00372.87 C ANISOU46020 CD ARG N 404 46235 47485 47952 -8065 -2445 -686 C ATOM 46021 NE ARG N 404 111.653 40.546 -44.036 1.00364.50 N ANISOU46021 NE ARG N 404 45321 46538 46634 -7842 -2238 -392 N ATOM 46022 CZ ARG N 404 110.644 40.398 -44.888 1.00353.98 C ANISOU46022 CZ ARG N 404 43878 45222 45398 -7809 -2270 -207 C ATOM 46023 NH1 ARG N 404 110.669 39.422 -45.785 1.00352.00 N ANISOU46023 NH1 ARG N 404 43361 44888 45494 -7973 -2505 -290 N ATOM 46024 NH2 ARG N 404 109.610 41.227 -44.844 1.00344.41 N ANISOU46024 NH2 ARG N 404 42817 44103 43939 -7610 -2072 55 N ATOM 46025 N MET N 405 111.274 36.209 -41.624 1.00390.90 N ANISOU46025 N MET N 405 47337 50038 51148 -7895 -3022 460 N ATOM 46026 CA MET N 405 110.258 36.509 -40.623 1.00399.52 C ANISOU46026 CA MET N 405 48419 51316 52067 -7613 -2880 934 C ATOM 46027 C MET N 405 110.273 35.482 -39.496 1.00414.37 C ANISOU46027 C MET N 405 49957 53288 54195 -7575 -3043 1227 C ATOM 46028 O MET N 405 109.315 35.371 -38.731 1.00418.62 O ANISOU46028 O MET N 405 50358 53986 54712 -7353 -2995 1691 O ATOM 46029 CB MET N 405 108.870 36.563 -41.267 1.00285.32 C ANISOU46029 CB MET N 405 33864 36894 37651 -7480 -2854 1260 C ATOM 46030 CG MET N 405 108.600 37.835 -42.054 1.00256.88 C ANISOU46030 CG MET N 405 30643 33262 33697 -7430 -2616 1094 C ATOM 46031 SD MET N 405 109.375 39.287 -41.318 1.00250.47 S ANISOU46031 SD MET N 405 30310 32494 32360 -7342 -2314 845 S ATOM 46032 CE MET N 405 108.389 39.481 -39.835 1.00261.09 C ANISOU46032 CE MET N 405 31607 34074 33522 -7017 -2180 1383 C ATOM 46033 N LEU N 406 111.311 34.735 -39.245 1.00285.56 N ANISOU46033 N LEU N 406 31918 42324 34259 -492 2568 -1249 N ATOM 46034 CA LEU N 406 111.450 33.719 -38.209 1.00286.47 C ANISOU46034 CA LEU N 406 31969 42378 34497 -472 2451 -1177 C ATOM 46035 C LEU N 406 112.831 33.773 -37.566 1.00291.03 C ANISOU46035 C LEU N 406 32453 43035 35090 -482 2451 -1179 C ATOM 46036 O LEU N 406 113.007 33.373 -36.415 1.00293.53 O ANISOU46036 O LEU N 406 32729 43331 35468 -507 2376 -1089 O ATOM 46037 CB LEU N 406 111.193 32.326 -38.787 1.00287.38 C ANISOU46037 CB LEU N 406 32056 42387 34748 -368 2351 -1228 C ATOM 46038 CG LEU N 406 109.750 31.820 -38.722 1.00288.36 C ANISOU46038 CG LEU N 406 32253 42400 34910 -364 2287 -1166 C ATOM 46039 CD1 LEU N 406 109.716 30.303 -38.618 1.00290.65 C ANISOU46039 CD1 LEU N 406 32488 42584 35360 -281 2152 -1167 C ATOM 46040 CD2 LEU N 406 109.009 32.459 -37.557 1.00287.76 C ANISOU46040 CD2 LEU N 406 32231 42329 34776 -465 2289 -1034 C ATOM 46041 N PHE N 407 113.810 34.269 -38.317 1.00243.76 N ANISOU46041 N PHE N 407 26432 37139 29047 -468 2535 -1283 N ATOM 46042 CA PHE N 407 115.177 34.377 -37.821 1.00274.05 C ANISOU46042 CA PHE N 407 30176 41059 32891 -476 2545 -1300 C ATOM 46043 C PHE N 407 115.325 35.558 -36.868 1.00267.63 C ANISOU46043 C PHE N 407 29389 40331 31965 -585 2614 -1210 C ATOM 46044 O PHE N 407 115.895 35.425 -35.785 1.00278.19 O ANISOU46044 O PHE N 407 30670 41690 33338 -615 2571 -1141 O ATOM 46045 CB PHE N 407 116.159 34.514 -38.986 1.00269.51 C ANISOU46045 CB PHE N 407 29555 40560 32289 -428 2616 -1450 C ATOM 46046 CG PHE N 407 117.584 34.214 -38.616 1.00278.45 C ANISOU46046 CG PHE N 407 30570 41754 33473 -403 2597 -1492 C ATOM 46047 CD1 PHE N 407 117.968 32.928 -38.274 1.00299.43 C ANISOU46047 CD1 PHE N 407 33141 44339 36290 -326 2475 -1498 C ATOM 46048 CD2 PHE N 407 118.538 35.217 -38.610 1.00292.88 C ANISOU46048 CD2 PHE N 407 32377 43712 35194 -457 2698 -1527 C ATOM 46049 CE1 PHE N 407 119.278 32.649 -37.933 1.00334.63 C ANISOU46049 CE1 PHE N 407 37489 48851 40804 -300 2452 -1539 C ATOM 46050 CE2 PHE N 407 119.849 34.943 -38.270 1.00327.03 C ANISOU46050 CE2 PHE N 407 36592 48096 39568 -434 2681 -1568 C ATOM 46051 CZ PHE N 407 120.219 33.658 -37.931 1.00348.09 C ANISOU46051 CZ PHE N 407 39171 50690 42399 -354 2558 -1576 C ATOM 46052 N ARG N 408 114.810 36.712 -37.278 1.00419.71 N ANISOU46052 N ARG N 408 48737 59640 51093 -647 2717 -1212 N ATOM 46053 CA ARG N 408 114.883 37.918 -36.461 1.00415.87 C ANISOU46053 CA ARG N 408 48283 59234 50494 -752 2790 -1134 C ATOM 46054 C ARG N 408 114.469 37.633 -35.022 1.00401.56 C ANISOU46054 C ARG N 408 46462 57380 48732 -802 2713 -999 C ATOM 46055 O ARG N 408 114.957 38.271 -34.088 1.00401.05 O ANISOU46055 O ARG N 408 46378 57387 48617 -876 2743 -936 O ATOM 46056 CB ARG N 408 114.004 39.021 -37.053 1.00339.97 C ANISOU46056 CB ARG N 408 38780 49637 40755 -805 2882 -1138 C ATOM 46057 CG ARG N 408 114.765 40.046 -37.877 1.00358.19 C ANISOU46057 CG ARG N 408 41099 52054 42942 -831 3000 -1226 C ATOM 46058 CD ARG N 408 113.822 40.887 -38.721 1.00343.67 C ANISOU46058 CD ARG N 408 39370 50205 41003 -861 3068 -1246 C ATOM 46059 NE ARG N 408 114.467 41.385 -39.933 1.00359.15 N ANISOU46059 NE ARG N 408 41338 52238 42884 -852 3151 -1362 N ATOM 46060 CZ ARG N 408 113.942 42.304 -40.735 1.00350.58 C ANISOU46060 CZ ARG N 408 40343 51170 41690 -890 3225 -1389 C ATOM 46061 NH1 ARG N 408 112.758 42.832 -40.457 1.00327.33 N ANISOU46061 NH1 ARG N 408 37487 48174 38710 -935 3226 -1314 N ATOM 46062 NH2 ARG N 408 114.601 42.698 -41.817 1.00366.88 N ANISOU46062 NH2 ARG N 408 42409 53306 43682 -888 3295 -1495 N ATOM 46063 N LYS N 409 113.569 36.672 -34.849 1.00399.83 N ANISOU46063 N LYS N 409 46259 57048 48610 -765 2613 -956 N ATOM 46064 CA LYS N 409 113.089 36.300 -33.524 1.00391.06 C ANISOU46064 CA LYS N 409 45143 55891 47550 -816 2530 -828 C ATOM 46065 C LYS N 409 114.149 35.522 -32.752 1.00418.04 C ANISOU46065 C LYS N 409 48457 59315 51063 -795 2448 -803 C ATOM 46066 O LYS N 409 114.209 35.585 -31.524 1.00419.08 O ANISOU46066 O LYS N 409 48571 59461 51201 -864 2411 -699 O ATOM 46067 CB LYS N 409 111.805 35.474 -33.630 1.00304.46 C ANISOU46067 CB LYS N 409 34225 44800 36655 -784 2446 -795 C ATOM 46068 CG LYS N 409 110.531 36.303 -33.606 1.00294.04 C ANISOU46068 CG LYS N 409 33007 43469 35244 -851 2500 -749 C ATOM 46069 CD LYS N 409 109.298 35.418 -33.515 1.00276.80 C ANISOU46069 CD LYS N 409 30864 41168 33139 -828 2406 -704 C ATOM 46070 CE LYS N 409 108.029 36.211 -33.777 1.00290.84 C ANISOU46070 CE LYS N 409 32742 42931 34832 -875 2465 -689 C ATOM 46071 NZ LYS N 409 106.828 35.333 -33.838 1.00294.46 N ANISOU46071 NZ LYS N 409 33240 43277 35364 -845 2379 -660 N ATOM 46072 N MET N 410 114.985 34.789 -33.481 1.00226.92 N ANISOU46072 N MET N 410 24182 35101 26935 -700 2418 -902 N ATOM 46073 CA MET N 410 116.047 33.999 -32.867 1.00258.66 C ANISOU46073 CA MET N 410 28098 39122 31060 -667 2333 -894 C ATOM 46074 C MET N 410 117.049 34.892 -32.144 1.00270.17 C ANISOU46074 C MET N 410 29514 40698 32438 -740 2400 -865 C ATOM 46075 O MET N 410 117.425 34.623 -31.003 1.00273.44 O ANISOU46075 O MET N 410 29882 41115 32897 -779 2334 -777 O ATOM 46076 CB MET N 410 116.761 33.151 -33.921 1.00217.57 C ANISOU46076 CB MET N 410 22825 33894 25947 -549 2303 -1027 C ATOM 46077 CG MET N 410 116.232 31.730 -34.037 1.00224.62 C ANISOU46077 CG MET N 410 23702 34652 26991 -467 2166 -1023 C ATOM 46078 SD MET N 410 116.403 30.797 -32.504 1.00223.37 S ANISOU46078 SD MET N 410 23487 34429 26956 -490 2011 -890 S ATOM 46079 CE MET N 410 118.149 31.011 -32.170 1.00263.83 C ANISOU46079 CE MET N 410 28495 39658 32090 -484 2031 -936 C ATOM 46080 N THR N 411 117.478 35.956 -32.815 1.00327.60 N ANISOU46080 N THR N 411 36809 48072 39593 -762 2529 -939 N ATOM 46081 CA THR N 411 118.436 36.891 -32.238 1.00342.45 C ANISOU46081 CA THR N 411 38656 50073 41385 -832 2606 -921 C ATOM 46082 C THR N 411 117.853 37.590 -31.014 1.00323.10 C ANISOU46082 C THR N 411 36253 47641 38869 -947 2619 -785 C ATOM 46083 O THR N 411 118.589 38.113 -30.177 1.00334.20 O ANISOU46083 O THR N 411 37621 49128 40233 -1011 2647 -738 O ATOM 46084 CB THR N 411 118.876 37.952 -33.263 1.00351.28 C ANISOU46084 CB THR N 411 39803 51292 42378 -842 2745 -1025 C ATOM 46085 OG1 THR N 411 117.791 38.852 -33.521 1.00328.79 O ANISOU46085 OG1 THR N 411 37064 48440 39422 -901 2817 -995 O ATOM 46086 CG2 THR N 411 119.302 37.292 -34.565 1.00367.41 C ANISOU46086 CG2 THR N 411 41807 53317 44476 -737 2739 -1167 C ATOM 46087 N ARG N 412 116.527 37.593 -30.917 1.00411.35 N ANISOU46087 N ARG N 412 47511 58745 50036 -973 2600 -726 N ATOM 46088 CA ARG N 412 115.843 38.217 -29.792 1.00394.36 C ANISOU46088 CA ARG N 412 45407 56607 47826 -1083 2610 -605 C ATOM 46089 C ARG N 412 115.746 37.255 -28.613 1.00391.01 C ANISOU46089 C ARG N 412 44937 56121 47507 -1101 2481 -500 C ATOM 46090 O ARG N 412 116.075 37.609 -27.481 1.00386.29 O ANISOU46090 O ARG N 412 44314 55575 46882 -1185 2479 -414 O ATOM 46091 CB ARG N 412 114.446 38.682 -30.206 1.00290.25 C ANISOU46091 CB ARG N 412 32325 43374 34582 -1108 2648 -594 C ATOM 46092 CG ARG N 412 114.435 39.639 -31.387 1.00294.51 C ANISOU46092 CG ARG N 412 32919 43965 35015 -1096 2767 -690 C ATOM 46093 CD ARG N 412 113.448 40.774 -31.170 1.00269.07 C ANISOU46093 CD ARG N 412 29789 40760 31684 -1184 2842 -642 C ATOM 46094 NE ARG N 412 113.677 41.883 -32.091 1.00275.51 N ANISOU46094 NE ARG N 412 30650 41647 32383 -1196 2961 -719 N ATOM 46095 CZ ARG N 412 112.711 42.558 -32.703 1.00259.43 C ANISOU46095 CZ ARG N 412 28705 39588 30279 -1213 3013 -736 C ATOM 46096 NH1 ARG N 412 111.442 42.239 -32.494 1.00235.28 N ANISOU46096 NH1 ARG N 412 25697 36441 27256 -1219 2961 -686 N ATOM 46097 NH2 ARG N 412 113.013 43.554 -33.525 1.00269.15 N ANISOU46097 NH2 ARG N 412 29975 40884 31404 -1228 3114 -804 N ATOM 46098 N ASP N 413 115.294 36.035 -28.886 1.00561.46 N ANISOU46098 N ASP N 413 66517 77598 69216 -1025 2370 -507 N ATOM 46099 CA ASP N 413 115.166 35.016 -27.852 1.00561.03 C ANISOU46099 CA ASP N 413 66424 77473 69269 -1038 2233 -410 C ATOM 46100 C ASP N 413 116.518 34.716 -27.214 1.00569.20 C ANISOU46100 C ASP N 413 67359 78556 70356 -1035 2190 -397 C ATOM 46101 O ASP N 413 116.622 34.563 -25.997 1.00567.92 O ANISOU46101 O ASP N 413 67171 78398 70214 -1107 2129 -289 O ATOM 46102 CB ASP N 413 114.561 33.736 -28.431 1.00523.38 C ANISOU46102 CB ASP N 413 61661 72577 64625 -944 2124 -438 C ATOM 46103 CG ASP N 413 113.310 33.999 -29.244 1.00497.45 C ANISOU46103 CG ASP N 413 58469 69245 61292 -932 2171 -470 C ATOM 46104 OD1 ASP N 413 112.698 35.073 -29.066 1.00478.37 O ANISOU46104 OD1 ASP N 413 56120 66880 58761 -1013 2262 -438 O ATOM 46105 OD2 ASP N 413 112.936 33.131 -30.061 1.00497.55 O ANISOU46105 OD2 ASP N 413 58488 69171 61386 -842 2114 -527 O ATOM 46106 N VAL N 414 117.552 34.636 -28.045 1.00278.08 N ANISOU46106 N VAL N 414 30429 41722 33505 -954 2222 -510 N ATOM 46107 CA VAL N 414 118.902 34.367 -27.565 1.00312.00 C ANISOU46107 CA VAL N 414 34625 46068 37853 -940 2185 -516 C ATOM 46108 C VAL N 414 119.475 35.583 -26.846 1.00314.53 C ANISOU46108 C VAL N 414 34941 46515 38050 -1043 2286 -471 C ATOM 46109 O VAL N 414 120.149 35.452 -25.824 1.00330.37 O ANISOU46109 O VAL N 414 36889 48552 40084 -1088 2237 -400 O ATOM 46110 CB VAL N 414 119.844 33.972 -28.718 1.00256.53 C ANISOU46110 CB VAL N 414 27534 39055 30880 -824 2199 -664 C ATOM 46111 CG1 VAL N 414 121.294 34.030 -28.262 1.00290.08 C ANISOU46111 CG1 VAL N 414 31684 43386 35149 -824 2197 -682 C ATOM 46112 CG2 VAL N 414 119.495 32.585 -29.235 1.00263.52 C ANISOU46112 CG2 VAL N 414 28399 39812 31915 -718 2075 -702 C ATOM 46113 N TYR N 415 119.202 36.766 -27.386 1.00447.03 N ANISOU46113 N TYR N 415 51787 63368 54696 -1083 2423 -511 N ATOM 46114 CA TYR N 415 119.681 38.008 -26.791 1.00449.41 C ANISOU46114 CA TYR N 415 52093 63790 54871 -1182 2528 -475 C ATOM 46115 C TYR N 415 119.232 38.123 -25.339 1.00434.22 C ANISOU46115 C TYR N 415 50181 61864 52937 -1291 2484 -329 C ATOM 46116 O TYR N 415 119.981 38.595 -24.483 1.00444.57 O ANISOU46116 O TYR N 415 51451 63256 54209 -1360 2507 -279 O ATOM 46117 CB TYR N 415 119.183 39.212 -27.593 1.00344.48 C ANISOU46117 CB TYR N 415 38888 50554 41443 -1212 2667 -529 C ATOM 46118 CG TYR N 415 119.511 40.546 -26.961 1.00343.75 C ANISOU46118 CG TYR N 415 38815 50578 41218 -1321 2776 -486 C ATOM 46119 CD1 TYR N 415 120.538 41.337 -27.456 1.00365.91 C ANISOU46119 CD1 TYR N 415 41596 53492 43941 -1322 2878 -564 C ATOM 46120 CD2 TYR N 415 118.791 41.014 -25.869 1.00322.08 C ANISOU46120 CD2 TYR N 415 36110 47836 38428 -1427 2777 -370 C ATOM 46121 CE1 TYR N 415 120.842 42.557 -26.882 1.00367.34 C ANISOU46121 CE1 TYR N 415 41794 53777 44000 -1423 2976 -525 C ATOM 46122 CE2 TYR N 415 119.087 42.233 -25.289 1.00323.30 C ANISOU46122 CE2 TYR N 415 36279 48096 38463 -1527 2876 -334 C ATOM 46123 CZ TYR N 415 120.113 43.001 -25.799 1.00346.26 C ANISOU46123 CZ TYR N 415 39165 51106 41293 -1523 2975 -409 C ATOM 46124 OH TYR N 415 120.411 44.214 -25.224 1.00349.72 O ANISOU46124 OH TYR N 415 39618 51647 41612 -1623 3073 -373 O ATOM 46125 N LYS N 416 118.005 37.690 -25.068 1.00559.28 N ANISOU46125 N LYS N 416 66077 77613 68810 -1311 2421 -264 N ATOM 46126 CA LYS N 416 117.458 37.732 -23.717 1.00545.62 C ANISOU46126 CA LYS N 416 64362 75877 67072 -1420 2374 -129 C ATOM 46127 C LYS N 416 118.173 36.738 -22.809 1.00568.15 C ANISOU46127 C LYS N 416 67132 78702 70037 -1419 2244 -61 C ATOM 46128 O LYS N 416 118.353 36.987 -21.618 1.00566.43 O ANISOU46128 O LYS N 416 66896 78529 69793 -1519 2227 39 O ATOM 46129 CB LYS N 416 115.956 37.441 -23.738 1.00424.71 C ANISOU46129 CB LYS N 416 49128 60472 51772 -1437 2334 -87 C ATOM 46130 CG LYS N 416 115.196 38.181 -24.825 1.00403.52 C ANISOU46130 CG LYS N 416 46524 57788 49006 -1412 2438 -166 C ATOM 46131 CD LYS N 416 113.711 37.857 -24.779 1.00378.11 C ANISOU46131 CD LYS N 416 43379 54480 45807 -1430 2393 -123 C ATOM 46132 CE LYS N 416 112.961 38.540 -25.910 1.00360.26 C ANISOU46132 CE LYS N 416 41197 52213 43474 -1398 2486 -203 C ATOM 46133 NZ LYS N 416 111.561 38.047 -26.027 1.00337.45 N ANISOU46133 NZ LYS N 416 38371 49225 40621 -1393 2431 -177 N ATOM 46134 N TYR N 417 118.580 35.608 -23.381 1.00336.31 N ANISOU46134 N TYR N 417 37719 49264 40799 -1306 2148 -118 N ATOM 46135 CA TYR N 417 119.285 34.579 -22.628 1.00364.31 C ANISOU46135 CA TYR N 417 41185 52770 44468 -1290 2011 -63 C ATOM 46136 C TYR N 417 120.622 35.100 -22.113 1.00389.19 C ANISOU46136 C TYR N 417 44261 56029 47584 -1323 2053 -62 C ATOM 46137 O TYR N 417 121.042 34.771 -21.004 1.00399.27 O ANISOU46137 O TYR N 417 45491 57311 48901 -1380 1972 33 O ATOM 46138 CB TYR N 417 119.502 33.336 -23.494 1.00284.14 C ANISOU46138 CB TYR N 417 30989 42516 34457 -1151 1911 -146 C ATOM 46139 CG TYR N 417 120.529 32.374 -22.938 1.00317.40 C ANISOU46139 CG TYR N 417 35102 46699 38797 -1112 1782 -123 C ATOM 46140 CD1 TYR N 417 120.144 31.300 -22.147 1.00317.55 C ANISOU46140 CD1 TYR N 417 35110 46616 38927 -1126 1623 -24 C ATOM 46141 CD2 TYR N 417 121.881 32.542 -23.204 1.00350.84 C ANISOU46141 CD2 TYR N 417 39253 51007 43043 -1064 1816 -202 C ATOM 46142 CE1 TYR N 417 121.078 30.418 -21.637 1.00350.78 C ANISOU46142 CE1 TYR N 417 39230 50791 43259 -1091 1496 0 C ATOM 46143 CE2 TYR N 417 122.822 31.665 -22.698 1.00383.93 C ANISOU46143 CE2 TYR N 417 43350 55169 47358 -1026 1694 -185 C ATOM 46144 CZ TYR N 417 122.416 30.605 -21.916 1.00384.15 C ANISOU46144 CZ TYR N 417 43371 55089 47499 -1038 1531 -82 C ATOM 46145 OH TYR N 417 123.349 29.730 -21.410 1.00419.73 O ANISOU46145 OH TYR N 417 47786 59559 52135 -1000 1401 -62 O ATOM 46146 N MET N 418 121.287 35.915 -22.927 1.00288.85 N ANISOU46146 N MET N 418 31543 43410 34797 -1290 2177 -167 N ATOM 46147 CA MET N 418 122.571 36.491 -22.552 1.00313.40 C ANISOU46147 CA MET N 418 34584 46631 37862 -1319 2232 -180 C ATOM 46148 C MET N 418 122.432 37.373 -21.316 1.00299.92 C ANISOU46148 C MET N 418 32901 45000 36055 -1464 2278 -61 C ATOM 46149 O MET N 418 123.279 37.345 -20.422 1.00317.56 O ANISOU46149 O MET N 418 35071 47283 38303 -1509 2245 -4 O ATOM 46150 CB MET N 418 123.156 37.299 -23.712 1.00216.08 C ANISOU46150 CB MET N 418 22259 34390 25451 -1270 2368 -316 C ATOM 46151 CG MET N 418 123.295 36.514 -25.006 1.00232.50 C ANISOU46151 CG MET N 418 24316 36407 27618 -1134 2338 -445 C ATOM 46152 SD MET N 418 124.604 35.277 -24.933 1.00274.46 S ANISOU46152 SD MET N 418 29495 41689 33097 -1035 2210 -494 S ATOM 46153 CE MET N 418 125.992 36.283 -24.409 1.00302.67 C ANISOU46153 CE MET N 418 33005 45422 36576 -1099 2306 -501 C ATOM 46154 N GLN N 419 121.360 38.156 -21.272 1.00369.84 N ANISOU46154 N GLN N 419 41847 53866 44811 -1536 2355 -28 N ATOM 46155 CA GLN N 419 121.102 39.040 -20.142 1.00356.78 C ANISOU46155 CA GLN N 419 40219 52283 43057 -1677 2407 77 C ATOM 46156 C GLN N 419 120.979 38.246 -18.846 1.00356.71 C ANISOU46156 C GLN N 419 40178 52228 43126 -1742 2274 206 C ATOM 46157 O GLN N 419 121.512 38.642 -17.810 1.00362.51 O ANISOU46157 O GLN N 419 40879 53036 43821 -1835 2282 283 O ATOM 46158 CB GLN N 419 119.832 39.860 -20.380 1.00214.93 C ANISOU46158 CB GLN N 419 22355 34315 24993 -1731 2494 82 C ATOM 46159 CG GLN N 419 119.880 40.729 -21.626 1.00216.88 C ANISOU46159 CG GLN N 419 22645 34608 25154 -1681 2624 -35 C ATOM 46160 CD GLN N 419 118.637 41.582 -21.788 1.00188.23 C ANISOU46160 CD GLN N 419 19114 30974 21431 -1740 2704 -24 C ATOM 46161 OE1 GLN N 419 117.544 41.192 -21.379 1.00165.20 O ANISOU46161 OE1 GLN N 419 16239 27985 18546 -1772 2644 39 O ATOM 46162 NE2 GLN N 419 118.800 42.756 -22.388 1.00191.49 N ANISOU46162 NE2 GLN N 419 19565 31465 21728 -1755 2837 -88 N ATOM 46163 N LYS N 420 120.271 37.123 -18.913 1.00418.37 N ANISOU46163 N LYS N 420 48001 59917 51044 -1696 2150 232 N ATOM 46164 CA LYS N 420 120.085 36.264 -17.748 1.00420.09 C ANISOU46164 CA LYS N 420 48195 60079 51343 -1757 2009 355 C ATOM 46165 C LYS N 420 121.387 35.565 -17.368 1.00456.48 C ANISOU46165 C LYS N 420 52704 64692 56048 -1718 1915 365 C ATOM 46166 O LYS N 420 121.618 35.259 -16.199 1.00462.97 O ANISOU46166 O LYS N 420 53493 65518 56898 -1800 1832 475 O ATOM 46167 CB LYS N 420 118.992 35.226 -18.014 1.00289.35 C ANISOU46167 CB LYS N 420 31679 43387 34875 -1713 1900 372 C ATOM 46168 CG LYS N 420 117.580 35.779 -17.929 1.00253.63 C ANISOU46168 CG LYS N 420 27248 38852 30267 -1788 1957 406 C ATOM 46169 CD LYS N 420 116.569 34.798 -18.504 1.00240.63 C ANISOU46169 CD LYS N 420 25645 37077 28707 -1719 1867 391 C ATOM 46170 CE LYS N 420 115.167 35.386 -18.497 1.00215.20 C ANISOU46170 CE LYS N 420 22515 33850 25402 -1787 1931 412 C ATOM 46171 NZ LYS N 420 114.150 34.403 -18.960 1.00255.82 N ANISOU46171 NZ LYS N 420 27702 38870 30630 -1730 1838 407 N ATOM 46172 N CYS N 421 122.233 35.321 -18.362 1.00479.92 N ANISOU46172 N CYS N 421 55622 67659 59066 -1594 1928 246 N ATOM 46173 CA CYS N 421 123.514 34.664 -18.134 1.00517.73 C ANISOU46173 CA CYS N 421 60310 72451 63954 -1541 1843 234 C ATOM 46174 C CYS N 421 124.511 35.617 -17.484 1.00531.08 C ANISOU46174 C CYS N 421 61957 74277 65553 -1619 1929 257 C ATOM 46175 O CYS N 421 125.112 35.298 -16.457 1.00549.57 O ANISOU46175 O CYS N 421 64243 76631 67937 -1673 1847 344 O ATOM 46176 CB CYS N 421 124.084 34.125 -19.449 1.00422.72 C ANISOU46176 CB CYS N 421 48232 60380 52001 -1385 1837 86 C ATOM 46177 SG CYS N 421 123.296 32.607 -20.035 1.00419.71 S ANISOU46177 SG CYS N 421 47863 59825 51781 -1276 1683 66 S ATOM 46178 N VAL N 422 124.683 36.788 -18.088 1.00352.58 N ANISOU46178 N VAL N 422 39377 51769 42819 -1628 2092 180 N ATOM 46179 CA VAL N 422 125.606 37.789 -17.568 1.00366.21 C ANISOU46179 CA VAL N 422 41068 53629 44444 -1701 2190 192 C ATOM 46180 C VAL N 422 125.265 38.163 -16.129 1.00358.22 C ANISOU46180 C VAL N 422 40075 52653 43378 -1853 2175 340 C ATOM 46181 O VAL N 422 126.127 38.610 -15.372 1.00372.85 O ANISOU46181 O VAL N 422 41879 54596 45191 -1919 2199 383 O ATOM 46182 CB VAL N 422 125.602 39.064 -18.434 1.00256.15 C ANISOU46182 CB VAL N 422 27178 39783 30364 -1703 2369 97 C ATOM 46183 CG1 VAL N 422 125.824 40.294 -17.568 1.00256.27 C ANISOU46183 CG1 VAL N 422 27208 39921 30243 -1836 2476 164 C ATOM 46184 CG2 VAL N 422 126.661 38.969 -19.522 1.00278.62 C ANISOU46184 CG2 VAL N 422 29964 42663 33236 -1588 2407 -46 C ATOM 46185 N GLU N 423 124.002 37.977 -15.758 1.00370.75 N ATOM 46186 CA GLU N 423 123.542 38.294 -14.412 1.00360.90 C ATOM 46187 C GLU N 423 123.326 37.028 -13.593 1.00373.63 C ATOM 46188 O GLU N 423 122.548 36.154 -13.976 1.00362.16 O ATOM 46189 CB GLU N 423 122.253 39.117 -14.464 1.00324.54 C ATOM 46190 CG GLU N 423 121.400 39.008 -13.212 1.00311.49 C ATOM 46191 CD GLU N 423 119.935 39.299 -13.479 1.00280.40 C ATOM 46192 OE1 GLU N 423 119.176 39.479 -12.502 1.00274.81 O ATOM 46193 OE2 GLU N 423 119.543 39.346 -14.662 1.00262.81 O