>>3H1J:HELIX  172 172 GLU Q  197  SER Q  232  1                                  36    
EHDQRKRMGLKMLLISALLTSLLYYMKRHKWSVLKS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 172 172 GLU Q 197 SER Q 232 1 36 ATOM 27058 N GLU Q 197 30.137 149.824 110.069 1.00 66.80 N ATOM 27059 CA GLU Q 197 30.239 148.462 110.556 1.00 69.47 C ATOM 27060 C GLU Q 197 31.259 148.388 111.686 1.00 71.03 C ATOM 27061 O GLU Q 197 31.190 147.488 112.526 1.00 72.95 O ATOM 27062 CB GLU Q 197 30.683 147.508 109.443 1.00 70.75 C ATOM 27063 CG GLU Q 197 32.143 147.648 109.033 1.00 73.67 C ATOM 27064 CD GLU Q 197 32.329 148.587 107.861 1.00 76.48 C ATOM 27065 OE1 GLU Q 197 31.511 149.523 107.720 1.00 78.21 O ATOM 27066 OE2 GLU Q 197 33.297 148.397 107.089 1.00 76.96 O ATOM 27067 N HIS Q 198 32.204 149.333 111.695 1.00 71.36 N ATOM 27068 CA HIS Q 198 33.274 149.387 112.693 1.00 69.75 C ATOM 27069 C HIS Q 198 32.992 148.641 113.998 1.00 69.55 C ATOM 27070 O HIS Q 198 33.703 147.702 114.340 1.00 67.81 O ATOM 27071 CB HIS Q 198 33.631 150.839 113.004 1.00 69.10 C ATOM 27072 CG HIS Q 198 34.631 150.988 114.109 1.00 68.78 C ATOM 27073 ND1 HIS Q 198 34.298 150.845 115.442 1.00 67.44 N ATOM 27074 CD2 HIS Q 198 35.965 151.221 114.076 1.00 67.67 C ATOM 27075 CE1 HIS Q 198 35.384 150.983 116.179 1.00 66.87 C ATOM 27076 NE2 HIS Q 198 36.410 151.210 115.376 1.00 67.18 N ATOM 27077 N ASP Q 199 31.955 149.057 114.718 1.00 69.64 N ATOM 27078 CA ASP Q 199 31.595 148.420 115.980 1.00 70.78 C ATOM 27079 C ASP Q 199 31.224 146.951 115.862 1.00 72.14 C ATOM 27080 O ASP Q 199 31.757 146.119 116.588 1.00 72.41 O ATOM 27081 CB ASP Q 199 30.434 149.161 116.628 1.00 70.83 C ATOM 27082 CG ASP Q 199 30.874 150.405 117.357 1.00 71.23 C ATOM 27083 OD1 ASP Q 199 31.993 150.912 117.073 1.00 70.55 O ATOM 27084 OD2 ASP Q 199 30.083 150.873 118.209 1.00 70.68 O ATOM 27085 N GLN Q 200 30.293 146.632 114.969 1.00 74.25 N ATOM 27086 CA GLN Q 200 29.878 145.245 114.783 1.00 75.53 C ATOM 27087 C GLN Q 200 31.047 144.420 114.272 1.00 75.15 C ATOM 27088 O GLN Q 200 31.220 143.265 114.656 1.00 75.70 O ATOM 27089 CB GLN Q 200 28.728 145.152 113.796 1.00 77.18 C ATOM 27090 CG GLN Q 200 28.292 143.734 113.532 1.00 80.95 C ATOM 27091 CD GLN Q 200 27.113 143.654 112.586 1.00 84.42 C ATOM 27092 OE1 GLN Q 200 27.110 144.274 111.509 1.00 87.53 O ATOM 27093 NE2 GLN Q 200 26.098 142.883 112.975 1.00 85.27 N ATOM 27094 N ARG Q 201 31.844 145.024 113.399 1.00 74.26 N ATOM 27095 CA ARG Q 201 33.024 144.374 112.845 1.00 73.90 C ATOM 27096 C ARG Q 201 33.889 143.832 113.961 1.00 73.79 C ATOM 27097 O ARG Q 201 34.410 142.724 113.887 1.00 73.96 O ATOM 27098 CB ARG Q 201 33.845 145.377 112.049 1.00 73.64 C ATOM 27099 CG ARG Q 201 35.161 144.831 111.573 1.00 73.51 C ATOM 27100 CD ARG Q 201 35.716 145.686 110.457 1.00 76.40 C ATOM 27101 NE ARG Q 201 36.114 147.015 110.904 1.00 78.05 N ATOM 27102 CZ ARG Q 201 37.144 147.247 111.708 1.00 78.50 C ATOM 27103 NH1 ARG Q 201 37.869 146.234 112.152 1.00 79.01 N ATOM 27104 NH2 ARG Q 201 37.463 148.487 112.051 1.00 78.94 N ATOM 27105 N LYS Q 202 34.049 144.644 114.995 1.00 74.57 N ATOM 27106 CA LYS Q 202 34.853 144.269 116.138 1.00 74.55 C ATOM 27107 C LYS Q 202 34.136 143.301 117.059 1.00 75.15 C ATOM 27108 O LYS Q 202 34.756 142.367 117.560 1.00 76.22 O ATOM 27109 CB LYS Q 202 35.293 145.518 116.908 1.00 74.32 C ATOM 27110 CG LYS Q 202 36.346 146.313 116.156 1.00 74.07 C ATOM 27111 CD LYS Q 202 36.909 147.460 116.972 1.00 75.96 C ATOM 27112 CE LYS Q 202 38.006 148.194 116.195 1.00 76.46 C ATOM 27113 NZ LYS Q 202 38.491 149.407 116.911 1.00 77.58 N ATOM 27114 N ARG Q 203 32.842 143.499 117.290 1.00 75.25 N ATOM 27115 CA ARG Q 203 32.134 142.574 118.165 1.00 76.48 C ATOM 27116 C ARG Q 203 32.244 141.166 117.579 1.00 77.71 C ATOM 27117 O ARG Q 203 32.385 140.178 118.308 1.00 78.27 O ATOM 27118 CB ARG Q 203 30.665 142.960 118.310 1.00 75.89 C ATOM 27119 CG ARG Q 203 29.973 142.207 119.440 1.00 77.26 C ATOM 27120 CD ARG Q 203 28.485 142.514 119.508 1.00 79.51 C ATOM 27121 NE ARG Q 203 28.250 143.947 119.660 1.00 80.99 N ATOM 27122 CZ ARG Q 203 27.619 144.499 120.688 1.00 80.82 C ATOM 27123 NH1 ARG Q 203 27.149 143.736 121.665 1.00 81.17 N ATOM 27124 NH2 ARG Q 203 27.461 145.816 120.738 1.00 79.85 N ATOM 27125 N MET Q 204 32.183 141.077 116.254 1.00 78.54 N ATOM 27126 CA MET Q 204 32.297 139.790 115.582 1.00 78.48 C ATOM 27127 C MET Q 204 33.686 139.219 115.830 1.00 77.62 C ATOM 27128 O MET Q 204 33.826 138.057 116.204 1.00 77.80 O ATOM 27129 CB MET Q 204 32.064 139.940 114.074 1.00 80.65 C ATOM 27130 CG MET Q 204 30.610 140.131 113.656 1.00 81.75 C ATOM 27131 SD MET Q 204 30.410 139.911 111.863 1.00 84.71 S ATOM 27132 CE MET Q 204 28.733 140.341 111.682 1.00 83.65 C ATOM 27133 N GLY Q 205 34.709 140.043 115.616 1.00 76.87 N ATOM 27134 CA GLY Q 205 36.073 139.604 115.838 1.00 76.09 C ATOM 27135 C GLY Q 205 36.209 138.894 117.171 1.00 76.21 C ATOM 27136 O GLY Q 205 36.849 137.845 117.254 1.00 75.84 O ATOM 27137 N LEU Q 206 35.602 139.465 118.213 1.00 76.47 N ATOM 27138 CA LEU Q 206 35.637 138.885 119.555 1.00 75.91 C ATOM 27139 C LEU Q 206 35.066 137.478 119.511 1.00 76.47 C ATOM 27140 O LEU Q 206 35.741 136.521 119.881 1.00 76.94 O ATOM 27141 CB LEU Q 206 34.820 139.728 120.546 1.00 75.02 C ATOM 27142 CG LEU Q 206 34.748 139.200 121.985 1.00 73.08 C ATOM 27143 CD1 LEU Q 206 36.127 139.192 122.566 1.00 71.79 C ATOM 27144 CD2 LEU Q 206 33.842 140.061 122.833 1.00 73.23 C ATOM 27145 N LYS Q 207 33.818 137.354 119.065 1.00 76.78 N ATOM 27146 CA LYS Q 207 33.189 136.045 118.974 1.00 76.77 C ATOM 27147 C LYS Q 207 34.079 135.110 118.158 1.00 75.93 C ATOM 27148 O LYS Q 207 34.313 133.957 118.543 1.00 75.68 O ATOM 27149 CB LYS Q 207 31.818 136.160 118.315 1.00 77.76 C ATOM 27150 CG LYS Q 207 30.787 136.857 119.159 1.00 80.11 C ATOM 27151 CD LYS Q 207 29.432 136.816 118.479 1.00 83.96 C ATOM 27152 CE LYS Q 207 28.339 137.421 119.354 1.00 87.66 C ATOM 27153 NZ LYS Q 207 27.067 137.673 118.601 1.00 90.18 N ATOM 27154 N MET Q 208 34.580 135.625 117.038 1.00 74.47 N ATOM 27155 CA MET Q 208 35.440 134.863 116.153 1.00 73.58 C ATOM 27156 C MET Q 208 36.608 134.246 116.904 1.00 73.10 C ATOM 27157 O MET Q 208 36.794 133.028 116.880 1.00 72.96 O ATOM 27158 CB MET Q 208 35.946 135.760 115.034 1.00 74.42 C ATOM 27159 CG MET Q 208 36.794 135.050 114.015 1.00 76.83 C ATOM 27160 SD MET Q 208 38.472 134.892 114.572 1.00 80.83 S ATOM 27161 CE MET Q 208 39.070 136.578 114.215 1.00 80.04 C ATOM 27162 N LEU Q 209 37.396 135.079 117.575 1.00 72.68 N ATOM 27163 CA LEU Q 209 38.537 134.573 118.339 1.00 71.93 C ATOM 27164 C LEU Q 209 38.134 133.485 119.329 1.00 71.75 C ATOM 27165 O LEU Q 209 38.777 132.443 119.413 1.00 71.15 O ATOM 27166 CB LEU Q 209 39.218 135.696 119.108 1.00 70.53 C ATOM 27167 CG LEU Q 209 39.965 136.681 118.231 1.00 70.49 C ATOM 27168 CD1 LEU Q 209 40.683 137.686 119.107 1.00 71.65 C ATOM 27169 CD2 LEU Q 209 40.941 135.931 117.358 1.00 68.70 C ATOM 27170 N LEU Q 210 37.079 133.728 120.094 1.00 71.55 N ATOM 27171 CA LEU Q 210 36.641 132.732 121.053 1.00 71.36 C ATOM 27172 C LEU Q 210 36.379 131.406 120.363 1.00 71.27 C ATOM 27173 O LEU Q 210 36.999 130.388 120.698 1.00 72.09 O ATOM 27174 CB LEU Q 210 35.389 133.204 121.787 1.00 70.59 C ATOM 27175 CG LEU Q 210 35.727 134.292 122.805 1.00 70.42 C ATOM 27176 CD1 LEU Q 210 34.485 134.730 123.553 1.00 69.99 C ATOM 27177 CD2 LEU Q 210 36.754 133.740 123.772 1.00 70.44 C ATOM 27178 N ILE Q 211 35.474 131.411 119.389 1.00 69.65 N ATOM 27179 CA ILE Q 211 35.167 130.175 118.688 1.00 68.04 C ATOM 27180 C ILE Q 211 36.435 129.579 118.077 1.00 67.23 C ATOM 27181 O ILE Q 211 36.733 128.397 118.275 1.00 66.83 O ATOM 27182 CB ILE Q 211 34.089 130.407 117.606 1.00 67.06 C ATOM 27183 CG1 ILE Q 211 32.768 130.791 118.277 1.00 65.61 C ATOM 27184 CG2 ILE Q 211 33.887 129.150 116.768 1.00 66.76 C ATOM 27185 CD1 ILE Q 211 32.143 129.691 119.113 1.00 61.65 C ATOM 27186 N SER Q 212 37.197 130.399 117.361 1.00 66.15 N ATOM 27187 CA SER Q 212 38.428 129.921 116.739 1.00 65.73 C ATOM 27188 C SER Q 212 39.347 129.202 117.727 1.00 65.67 C ATOM 27189 O SER Q 212 40.024 128.246 117.366 1.00 65.54 O ATOM 27190 CB SER Q 212 39.184 131.080 116.098 1.00 66.12 C ATOM 27191 OG SER Q 212 40.372 130.613 115.484 1.00 66.51 O ATOM 27192 N ALA Q 213 39.380 129.670 118.971 1.00 66.70 N ATOM 27193 CA ALA Q 213 40.207 129.048 120.006 1.00 65.84 C ATOM 27194 C ALA Q 213 39.585 127.707 120.367 1.00 65.36 C ATOM 27195 O ALA Q 213 40.206 126.651 120.191 1.00 65.98 O ATOM 27196 CB ALA Q 213 40.263 129.934 121.237 1.00 65.69 C ATOM 27197 N LEU Q 214 38.352 127.759 120.867 1.00 63.48 N ATOM 27198 CA LEU Q 214 37.646 126.548 121.242 1.00 62.20 C ATOM 27199 C LEU Q 214 37.750 125.499 120.149 1.00 62.91 C ATOM 27200 O LEU Q 214 38.156 124.368 120.409 1.00 64.63 O ATOM 27201 CB LEU Q 214 36.176 126.847 121.523 1.00 58.46 C ATOM 27202 CG LEU Q 214 35.300 125.599 121.664 1.00 55.16 C ATOM 27203 CD1 LEU Q 214 35.912 124.667 122.658 1.00 52.98 C ATOM 27204 CD2 LEU Q 214 33.898 125.983 122.089 1.00 54.58 C ATOM 27205 N LEU Q 215 37.413 125.885 118.924 1.00 62.51 N ATOM 27206 CA LEU Q 215 37.446 124.963 117.798 1.00 63.62 C ATOM 27207 C LEU Q 215 38.834 124.479 117.336 1.00 63.81 C ATOM 27208 O LEU Q 215 39.002 123.294 117.033 1.00 62.79 O ATOM 27209 CB LEU Q 215 36.686 125.577 116.618 1.00 65.11 C ATOM 27210 CG LEU Q 215 36.268 124.634 115.482 1.00 65.91 C ATOM 27211 CD1 LEU Q 215 35.461 123.485 116.059 1.00 64.97 C ATOM 27212 CD2 LEU Q 215 35.449 125.388 114.444 1.00 66.06 C ATOM 27213 N THR Q 216 39.825 125.365 117.268 1.00 64.15 N ATOM 27214 CA THR Q 216 41.145 124.922 116.832 1.00 65.85 C ATOM 27215 C THR Q 216 41.642 123.899 117.825 1.00 67.85 C ATOM 27216 O THR Q 216 42.336 122.954 117.462 1.00 69.67 O ATOM 27217 CB THR Q 216 42.189 126.052 116.787 1.00 65.06 C ATOM 27218 OG1 THR Q 216 41.791 127.047 115.839 1.00 67.32 O ATOM 27219 CG2 THR Q 216 43.540 125.494 116.365 1.00 62.53 C ATOM 27220 N SER Q 217 41.285 124.093 119.089 1.00 69.05 N ATOM 27221 CA SER Q 217 41.708 123.180 120.140 1.00 69.61 C ATOM 27222 C SER Q 217 41.087 121.804 119.949 1.00 69.91 C ATOM 27223 O SER Q 217 41.801 120.814 119.761 1.00 68.36 O ATOM 27224 CB SER Q 217 41.325 123.757 121.498 1.00 69.92 C ATOM 27225 OG SER Q 217 41.990 124.994 121.704 1.00 71.42 O ATOM 27226 N LEU Q 218 39.756 121.751 119.988 1.00 71.14 N ATOM 27227 CA LEU Q 218 39.023 120.500 119.810 1.00 72.23 C ATOM 27228 C LEU Q 218 39.498 119.754 118.559 1.00 74.19 C ATOM 27229 O LEU Q 218 39.567 118.529 118.550 1.00 74.86 O ATOM 27230 CB LEU Q 218 37.524 120.784 119.725 1.00 70.00 C ATOM 27231 CG LEU Q 218 36.950 121.457 120.975 1.00 70.19 C ATOM 27232 CD1 LEU Q 218 35.521 121.902 120.727 1.00 68.93 C ATOM 27233 CD2 LEU Q 218 37.020 120.494 122.149 1.00 70.04 C ATOM 27234 N LEU Q 219 39.837 120.481 117.501 1.00 75.78 N ATOM 27235 CA LEU Q 219 40.317 119.818 116.296 1.00 77.49 C ATOM 27236 C LEU Q 219 41.774 119.366 116.422 1.00 78.27 C ATOM 27237 O LEU Q 219 42.212 118.467 115.703 1.00 78.55 O ATOM 27238 CB LEU Q 219 40.154 120.722 115.069 1.00 78.59 C ATOM 27239 CG LEU Q 219 38.718 120.944 114.590 1.00 78.91 C ATOM 27240 CD1 LEU Q 219 38.764 121.724 113.293 1.00 79.05 C ATOM 27241 CD2 LEU Q 219 38.006 119.614 114.380 1.00 77.49 C ATOM 27242 N TYR Q 220 42.540 119.981 117.320 1.00 79.09 N ATOM 27243 CA TYR Q 220 43.924 119.545 117.476 1.00 79.55 C ATOM 27244 C TYR Q 220 43.879 118.220 118.209 1.00 78.97 C ATOM 27245 O TYR Q 220 44.674 117.315 117.950 1.00 78.10 O ATOM 27246 CB TYR Q 220 44.770 120.523 118.290 1.00 79.06 C ATOM 27247 CG TYR Q 220 46.229 120.110 118.297 1.00 79.33 C ATOM 27248 CD1 TYR Q 220 46.850 119.629 119.453 1.00 79.50 C ATOM 27249 CD2 TYR Q 220 46.979 120.174 117.129 1.00 79.93 C ATOM 27250 CE1 TYR Q 220 48.200 119.222 119.440 1.00 80.83 C ATOM 27251 CE2 TYR Q 220 48.314 119.770 117.099 1.00 81.89 C ATOM 27252 CZ TYR Q 220 48.929 119.294 118.250 1.00 82.17 C ATOM 27253 OH TYR Q 220 50.263 118.898 118.172 1.00 81.94 O ATOM 27254 N TYR Q 221 42.940 118.117 119.140 1.00 78.29 N ATOM 27255 CA TYR Q 221 42.788 116.893 119.892 1.00 77.86 C ATOM 27256 C TYR Q 221 42.334 115.800 118.939 1.00 77.87 C ATOM 27257 O TYR Q 221 42.844 114.676 118.973 1.00 78.39 O ATOM 27258 CB TYR Q 221 41.736 117.036 120.986 1.00 77.04 C ATOM 27259 CG TYR Q 221 41.480 115.720 121.680 1.00 76.44 C ATOM 27260 CD1 TYR Q 221 42.344 115.256 122.667 1.00 75.83 C ATOM 27261 CD2 TYR Q 221 40.423 114.897 121.290 1.00 76.05 C ATOM 27262 CE1 TYR Q 221 42.168 114.005 123.249 1.00 76.48 C ATOM 27263 CE2 TYR Q 221 40.238 113.638 121.865 1.00 76.46 C ATOM 27264 CZ TYR Q 221 41.118 113.197 122.845 1.00 76.49 C ATOM 27265 OH TYR Q 221 40.969 111.945 123.405 1.00 75.23 O ATOM 27266 N MET Q 222 41.361 116.132 118.097 1.00 76.76 N ATOM 27267 CA MET Q 222 40.838 115.169 117.148 1.00 75.68 C ATOM 27268 C MET Q 222 41.899 114.700 116.159 1.00 74.32 C ATOM 27269 O MET Q 222 42.015 113.507 115.904 1.00 73.54 O ATOM 27270 CB MET Q 222 39.637 115.753 116.401 1.00 77.30 C ATOM 27271 CG MET Q 222 38.360 115.850 117.236 1.00 79.86 C ATOM 27272 SD MET Q 222 36.904 116.520 116.353 1.00 82.56 S ATOM 27273 CE MET Q 222 36.450 115.116 115.337 1.00 81.56 C ATOM 27274 N LYS Q 223 42.681 115.621 115.608 1.00 72.66 N ATOM 27275 CA LYS Q 223 43.704 115.220 114.653 1.00 73.27 C ATOM 27276 C LYS Q 223 44.681 114.255 115.318 1.00 75.27 C ATOM 27277 O LYS Q 223 45.007 113.198 114.761 1.00 76.04 O ATOM 27278 CB LYS Q 223 44.443 116.447 114.113 1.00 70.97 C ATOM 27279 CG LYS Q 223 45.446 116.150 113.008 1.00 69.23 C ATOM 27280 CD LYS Q 223 46.746 115.550 113.549 1.00 70.62 C ATOM 27281 CE LYS Q 223 47.823 115.445 112.468 1.00 70.97 C ATOM 27282 NZ LYS Q 223 49.130 114.927 112.978 1.00 72.15 N ATOM 27283 N ARG Q 224 45.136 114.624 116.516 1.00 77.26 N ATOM 27284 CA ARG Q 224 46.079 113.816 117.291 1.00 78.02 C ATOM 27285 C ARG Q 224 45.515 112.428 117.558 1.00 77.11 C ATOM 27286 O ARG Q 224 46.131 111.422 117.216 1.00 77.96 O ATOM 27287 CB ARG Q 224 46.384 114.510 118.615 1.00 80.51 C ATOM 27288 CG ARG Q 224 47.085 115.834 118.443 1.00 84.52 C ATOM 27289 CD ARG Q 224 48.548 115.636 118.099 1.00 88.45 C ATOM 27290 NE ARG Q 224 49.336 115.266 119.273 1.00 91.31 N ATOM 27291 CZ ARG Q 224 50.657 115.129 119.263 1.00 93.25 C ATOM 27292 NH1 ARG Q 224 51.334 115.330 118.138 1.00 94.30 N ATOM 27293 NH2 ARG Q 224 51.302 114.804 120.376 1.00 94.64 N ATOM 27294 N HIS Q 225 44.339 112.386 118.174 1.00 75.33 N ATOM 27295 CA HIS Q 225 43.667 111.131 118.485 1.00 73.19 C ATOM 27296 C HIS Q 225 43.837 110.110 117.365 1.00 72.47 C ATOM 27297 O HIS Q 225 44.472 109.081 117.535 1.00 72.35 O ATOM 27298 CB HIS Q 225 42.183 111.396 118.701 1.00 71.65 C ATOM 27299 CG HIS Q 225 41.409 110.193 119.128 1.00 69.99 C ATOM 27300 ND1 HIS Q 225 41.587 109.595 120.355 1.00 70.15 N ATOM 27301 CD2 HIS Q 225 40.426 109.498 118.509 1.00 70.31 C ATOM 27302 CE1 HIS Q 225 40.741 108.588 120.475 1.00 71.03 C ATOM 27303 NE2 HIS Q 225 40.025 108.507 119.369 1.00 69.40 N ATOM 27304 N LYS Q 226 43.263 110.413 116.213 1.00 72.96 N ATOM 27305 CA LYS Q 226 43.332 109.528 115.067 1.00 73.37 C ATOM 27306 C LYS Q 226 44.762 109.181 114.700 1.00 72.03 C ATOM 27307 O LYS Q 226 45.076 108.032 114.383 1.00 71.87 O ATOM 27308 CB LYS Q 226 42.643 110.186 113.875 1.00 76.23 C ATOM 27309 CG LYS Q 226 41.138 110.335 114.032 1.00 79.08 C ATOM 27310 CD LYS Q 226 40.440 108.996 113.922 1.00 82.01 C ATOM 27311 CE LYS Q 226 38.932 109.169 113.931 1.00 84.94 C ATOM 27312 NZ LYS Q 226 38.248 108.022 113.255 1.00 88.61 N ATOM 27313 N TRP Q 227 45.633 110.174 114.731 1.00 69.41 N ATOM 27314 CA TRP Q 227 47.016 109.924 114.385 1.00 68.11 C ATOM 27315 C TRP Q 227 47.827 109.108 115.402 1.00 67.36 C ATOM 27316 O TRP Q 227 48.866 108.539 115.059 1.00 67.66 O ATOM 27317 CB TRP Q 227 47.710 111.248 114.095 1.00 67.78 C ATOM 27318 CG TRP Q 227 47.453 111.697 112.720 1.00 67.81 C ATOM 27319 CD1 TRP Q 227 46.337 112.316 112.257 1.00 67.94 C ATOM 27320 CD2 TRP Q 227 48.313 111.513 111.594 1.00 67.90 C ATOM 27321 NE1 TRP Q 227 46.445 112.533 110.903 1.00 67.85 N ATOM 27322 CE2 TRP Q 227 47.650 112.050 110.472 1.00 67.81 C ATOM 27323 CE3 TRP Q 227 49.580 110.943 111.425 1.00 67.29 C ATOM 27324 CZ2 TRP Q 227 48.210 112.038 109.196 1.00 68.95 C ATOM 27325 CZ3 TRP Q 227 50.140 110.927 110.153 1.00 68.76 C ATOM 27326 CH2 TRP Q 227 49.454 111.473 109.054 1.00 69.18 C ATOM 27327 N SER Q 228 47.360 109.030 116.645 1.00 65.82 N ATOM 27328 CA SER Q 228 48.090 108.279 117.661 1.00 64.02 C ATOM 27329 C SER Q 228 48.445 106.904 117.129 1.00 64.83 C ATOM 27330 O SER Q 228 49.585 106.450 117.254 1.00 65.77 O ATOM 27331 CB SER Q 228 47.258 108.144 118.926 1.00 60.40 C ATOM 27332 OG SER Q 228 46.095 107.406 118.667 1.00 56.85 O ATOM 27333 N VAL Q 229 47.461 106.250 116.528 1.00 65.44 N ATOM 27334 CA VAL Q 229 47.654 104.932 115.940 1.00 66.54 C ATOM 27335 C VAL Q 229 49.016 104.850 115.227 1.00 68.76 C ATOM 27336 O VAL Q 229 49.717 103.839 115.318 1.00 70.10 O ATOM 27337 CB VAL Q 229 46.539 104.638 114.919 1.00 64.27 C ATOM 27338 CG1 VAL Q 229 46.684 103.247 114.360 1.00 62.53 C ATOM 27339 CG2 VAL Q 229 45.201 104.805 115.575 1.00 62.57 C ATOM 27340 N LEU Q 230 49.388 105.926 114.542 1.00 69.39 N ATOM 27341 CA LEU Q 230 50.640 105.977 113.803 1.00 71.45 C ATOM 27342 C LEU Q 230 51.840 106.507 114.585 1.00 73.29 C ATOM 27343 O LEU Q 230 52.974 106.049 114.376 1.00 74.05 O ATOM 27344 CB LEU Q 230 50.448 106.823 112.548 1.00 71.56 C ATOM 27345 CG LEU Q 230 49.910 106.114 111.314 1.00 70.09 C ATOM 27346 CD1 LEU Q 230 49.287 107.109 110.353 1.00 69.98 C ATOM 27347 CD2 LEU Q 230 51.067 105.386 110.666 1.00 71.17 C ATOM 27348 N LYS Q 231 51.594 107.476 115.466 1.00 73.77 N ATOM 27349 CA LYS Q 231 52.662 108.077 116.259 1.00 74.56 C ATOM 27350 C LYS Q 231 53.372 107.077 117.154 1.00 73.86 C ATOM 27351 O LYS Q 231 54.600 107.066 117.229 1.00 73.34 O ATOM 27352 CB LYS Q 231 52.113 109.218 117.113 1.00 77.00 C ATOM 27353 CG LYS Q 231 51.822 110.502 116.337 1.00 81.78 C ATOM 27354 CD LYS Q 231 53.098 111.233 115.845 1.00 84.14 C ATOM 27355 CE LYS Q 231 52.730 112.557 115.143 1.00 85.11 C ATOM 27356 NZ LYS Q 231 53.890 113.453 114.857 1.00 86.60 N ATOM 27357 N SER Q 232 52.592 106.241 117.829 1.00 73.11 N ATOM 27358 CA SER Q 232 53.141 105.238 118.732 1.00 73.04 C ATOM 27359 C SER Q 232 53.439 103.910 118.043 1.00 73.82 C ATOM 27360 O SER Q 232 53.987 102.986 118.647 1.00 74.25 O ATOM 27361 CB SER Q 232 52.174 105.010 119.898 1.00 71.50 C ATOM 27362 OG SER Q 232 50.881 104.668 119.444 1.00 67.03 O