>>3H1J:HELIX  175 175 SER R   25  SER R   61  1                                  37    
SQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 175 175 SER R 25 SER R 61 1 37 ATOM 27634 N SER R 25 40.043 96.060 130.895 1.00 83.53 N ATOM 27635 CA SER R 25 40.061 97.377 130.264 1.00 82.22 C ATOM 27636 C SER R 25 38.632 97.834 129.982 1.00 81.40 C ATOM 27637 O SER R 25 38.363 99.023 129.891 1.00 81.03 O ATOM 27638 CB SER R 25 40.858 97.334 128.959 1.00 81.82 C ATOM 27639 OG SER R 25 40.124 96.683 127.945 1.00 81.79 O ATOM 27640 N GLN R 26 37.722 96.873 129.870 1.00 81.01 N ATOM 27641 CA GLN R 26 36.313 97.137 129.597 1.00 81.71 C ATOM 27642 C GLN R 26 35.585 98.136 130.506 1.00 81.98 C ATOM 27643 O GLN R 26 34.797 98.956 130.028 1.00 83.71 O ATOM 27644 CB GLN R 26 35.529 95.826 129.612 1.00 82.74 C ATOM 27645 CG GLN R 26 35.977 94.789 128.592 1.00 83.74 C ATOM 27646 CD GLN R 26 35.976 95.304 127.159 1.00 85.03 C ATOM 27647 OE1 GLN R 26 35.268 96.260 126.809 1.00 84.15 O ATOM 27648 NE2 GLN R 26 36.764 94.652 126.314 1.00 86.52 N ATOM 27649 N THR R 27 35.812 98.063 131.811 1.00 81.64 N ATOM 27650 CA THR R 27 35.141 98.981 132.727 1.00 80.51 C ATOM 27651 C THR R 27 35.438 100.467 132.412 1.00 80.15 C ATOM 27652 O THR R 27 34.545 101.318 132.498 1.00 79.94 O ATOM 27653 CB THR R 27 35.517 98.635 134.181 1.00 79.94 C ATOM 27654 OG1 THR R 27 36.924 98.803 134.369 1.00 80.85 O ATOM 27655 CG2 THR R 27 35.169 97.184 134.470 1.00 78.92 C ATOM 27656 N SER R 28 36.676 100.770 132.019 1.00 79.32 N ATOM 27657 CA SER R 28 37.066 102.144 131.685 1.00 79.26 C ATOM 27658 C SER R 28 36.774 102.526 130.227 1.00 79.94 C ATOM 27659 O SER R 28 36.967 103.682 129.832 1.00 79.97 O ATOM 27660 CB SER R 28 38.563 102.352 131.945 1.00 78.92 C ATOM 27661 OG SER R 28 39.360 101.681 130.985 1.00 76.91 O ATOM 27662 N SER R 29 36.319 101.556 129.433 1.00 79.68 N ATOM 27663 CA SER R 29 36.025 101.781 128.019 1.00 78.07 C ATOM 27664 C SER R 29 35.012 102.909 127.782 1.00 79.10 C ATOM 27665 O SER R 29 35.309 103.875 127.067 1.00 80.03 O ATOM 27666 CB SER R 29 35.526 100.485 127.370 1.00 75.44 C ATOM 27667 OG SER R 29 34.225 100.147 127.805 1.00 73.81 O ATOM 27668 N GLU R 30 33.828 102.793 128.384 1.00 78.12 N ATOM 27669 CA GLU R 30 32.780 103.795 128.231 1.00 76.29 C ATOM 27670 C GLU R 30 33.261 105.229 128.454 1.00 76.00 C ATOM 27671 O GLU R 30 32.746 106.166 127.854 1.00 76.26 O ATOM 27672 CB GLU R 30 31.664 103.501 129.208 1.00 77.11 C ATOM 27673 CG GLU R 30 31.192 102.083 129.179 1.00 78.27 C ATOM 27674 CD GLU R 30 29.698 102.022 129.010 1.00 79.59 C ATOM 27675 OE1 GLU R 30 28.996 102.730 129.761 1.00 80.76 O ATOM 27676 OE2 GLU R 30 29.220 101.278 128.129 1.00 80.59 O ATOM 27677 N ASP R 31 34.239 105.403 129.332 1.00 75.67 N ATOM 27678 CA ASP R 31 34.761 106.731 129.618 1.00 75.08 C ATOM 27679 C ASP R 31 35.771 107.125 128.572 1.00 74.54 C ATOM 27680 O ASP R 31 35.740 108.238 128.063 1.00 74.61 O ATOM 27681 CB ASP R 31 35.420 106.749 130.991 1.00 76.47 C ATOM 27682 CG ASP R 31 34.490 106.265 132.075 1.00 78.55 C ATOM 27683 OD1 ASP R 31 33.891 107.113 132.780 1.00 77.56 O ATOM 27684 OD2 ASP R 31 34.342 105.024 132.201 1.00 80.75 O ATOM 27685 N ARG R 32 36.680 106.209 128.257 1.00 74.07 N ATOM 27686 CA ARG R 32 37.705 106.482 127.258 1.00 72.85 C ATOM 27687 C ARG R 32 37.024 106.885 125.962 1.00 71.62 C ATOM 27688 O ARG R 32 37.458 107.827 125.295 1.00 71.03 O ATOM 27689 CB ARG R 32 38.585 105.245 127.065 1.00 72.68 C ATOM 27690 CG ARG R 32 39.378 104.917 128.324 1.00 72.30 C ATOM 27691 CD ARG R 32 40.304 103.729 128.179 1.00 70.88 C ATOM 27692 NE ARG R 32 39.599 102.454 128.176 1.00 68.57 N ATOM 27693 CZ ARG R 32 39.450 101.691 127.099 1.00 68.29 C ATOM 27694 NH1 ARG R 32 39.953 102.073 125.931 1.00 66.15 N ATOM 27695 NH2 ARG R 32 38.813 100.534 127.193 1.00 68.74 N ATOM 27696 N LYS R 33 35.942 106.182 125.627 1.00 69.98 N ATOM 27697 CA LYS R 33 35.173 106.476 124.421 1.00 68.11 C ATOM 27698 C LYS R 33 34.259 107.679 124.655 1.00 67.57 C ATOM 27699 O LYS R 33 34.165 108.572 123.812 1.00 68.53 O ATOM 27700 CB LYS R 33 34.356 105.251 123.989 1.00 65.73 C ATOM 27701 CG LYS R 33 35.156 104.258 123.178 1.00 61.89 C ATOM 27702 CD LYS R 33 34.349 103.025 122.845 1.00 62.57 C ATOM 27703 CE LYS R 33 34.016 102.213 124.103 1.00 63.41 C ATOM 27704 NZ LYS R 33 33.477 100.822 123.860 1.00 61.41 N ATOM 27705 N GLY R 34 33.597 107.720 125.804 1.00 66.63 N ATOM 27706 CA GLY R 34 32.729 108.849 126.086 1.00 65.24 C ATOM 27707 C GLY R 34 33.458 110.188 126.007 1.00 64.27 C ATOM 27708 O GLY R 34 32.921 111.176 125.522 1.00 63.57 O ATOM 27709 N PHE R 35 34.696 110.223 126.481 1.00 64.14 N ATOM 27710 CA PHE R 35 35.463 111.453 126.475 1.00 63.49 C ATOM 27711 C PHE R 35 35.836 111.918 125.088 1.00 65.84 C ATOM 27712 O PHE R 35 35.603 113.073 124.730 1.00 66.34 O ATOM 27713 CB PHE R 35 36.747 111.296 127.260 1.00 60.01 C ATOM 27714 CG PHE R 35 37.583 112.518 127.247 1.00 57.12 C ATOM 27715 CD1 PHE R 35 37.211 113.625 128.002 1.00 56.56 C ATOM 27716 CD2 PHE R 35 38.711 112.594 126.443 1.00 55.35 C ATOM 27717 CE1 PHE R 35 37.952 114.801 127.959 1.00 56.25 C ATOM 27718 CE2 PHE R 35 39.462 113.758 126.389 1.00 56.41 C ATOM 27719 CZ PHE R 35 39.082 114.871 127.152 1.00 56.29 C ATOM 27720 N SER R 36 36.447 111.025 124.315 1.00 67.91 N ATOM 27721 CA SER R 36 36.863 111.364 122.959 1.00 69.77 C ATOM 27722 C SER R 36 35.690 111.773 122.100 1.00 69.82 C ATOM 27723 O SER R 36 35.763 112.741 121.344 1.00 70.66 O ATOM 27724 CB SER R 36 37.582 110.191 122.310 1.00 70.05 C ATOM 27725 OG SER R 36 38.896 110.093 122.823 1.00 73.16 O ATOM 27726 N TYR R 37 34.602 111.032 122.221 1.00 69.58 N ATOM 27727 CA TYR R 37 33.421 111.346 121.448 1.00 69.93 C ATOM 27728 C TYR R 37 32.846 112.696 121.865 1.00 70.70 C ATOM 27729 O TYR R 37 32.247 113.394 121.043 1.00 71.18 O ATOM 27730 CB TYR R 37 32.401 110.213 121.599 1.00 68.59 C ATOM 27731 CG TYR R 37 32.779 108.986 120.784 1.00 66.88 C ATOM 27732 CD1 TYR R 37 32.411 107.710 121.198 1.00 65.82 C ATOM 27733 CD2 TYR R 37 33.502 109.111 119.591 1.00 65.52 C ATOM 27734 CE1 TYR R 37 32.746 106.594 120.454 1.00 66.15 C ATOM 27735 CE2 TYR R 37 33.844 108.004 118.842 1.00 65.68 C ATOM 27736 CZ TYR R 37 33.461 106.745 119.276 1.00 66.77 C ATOM 27737 OH TYR R 37 33.770 105.629 118.523 1.00 67.63 O ATOM 27738 N LEU R 38 33.048 113.064 123.133 1.00 71.34 N ATOM 27739 CA LEU R 38 32.570 114.346 123.666 1.00 70.75 C ATOM 27740 C LEU R 38 33.319 115.490 122.982 1.00 69.92 C ATOM 27741 O LEU R 38 32.729 116.512 122.617 1.00 69.11 O ATOM 27742 CB LEU R 38 32.796 114.435 125.182 1.00 70.86 C ATOM 27743 CG LEU R 38 32.499 115.809 125.806 1.00 69.73 C ATOM 27744 CD1 LEU R 38 31.016 116.095 125.746 1.00 69.33 C ATOM 27745 CD2 LEU R 38 32.958 115.836 127.241 1.00 68.40 C ATOM 27746 N VAL R 39 34.624 115.317 122.827 1.00 68.42 N ATOM 27747 CA VAL R 39 35.427 116.323 122.164 1.00 68.37 C ATOM 27748 C VAL R 39 34.800 116.559 120.803 1.00 69.31 C ATOM 27749 O VAL R 39 34.472 117.691 120.436 1.00 70.27 O ATOM 27750 CB VAL R 39 36.847 115.831 121.943 1.00 66.51 C ATOM 27751 CG1 VAL R 39 37.652 116.880 121.204 1.00 64.74 C ATOM 27752 CG2 VAL R 39 37.463 115.498 123.263 1.00 66.82 C ATOM 27753 N THR R 40 34.636 115.463 120.068 1.00 69.32 N ATOM 27754 CA THR R 40 34.056 115.487 118.732 1.00 68.09 C ATOM 27755 C THR R 40 32.681 116.155 118.741 1.00 66.09 C ATOM 27756 O THR R 40 32.442 117.112 118.012 1.00 66.48 O ATOM 27757 CB THR R 40 33.923 114.058 118.177 1.00 68.53 C ATOM 27758 OG1 THR R 40 35.214 113.430 118.145 1.00 68.72 O ATOM 27759 CG2 THR R 40 33.348 114.092 116.782 1.00 68.21 C ATOM 27760 N ALA R 41 31.778 115.653 119.567 1.00 63.65 N ATOM 27761 CA ALA R 41 30.452 116.230 119.654 1.00 63.06 C ATOM 27762 C ALA R 41 30.569 117.751 119.806 1.00 64.02 C ATOM 27763 O ALA R 41 29.905 118.527 119.114 1.00 64.64 O ATOM 27764 CB ALA R 41 29.715 115.639 120.844 1.00 61.49 C ATOM 27765 N THR R 42 31.432 118.177 120.714 1.00 64.37 N ATOM 27766 CA THR R 42 31.631 119.597 120.959 1.00 62.96 C ATOM 27767 C THR R 42 32.106 120.321 119.700 1.00 62.42 C ATOM 27768 O THR R 42 31.591 121.380 119.342 1.00 61.30 O ATOM 27769 CB THR R 42 32.631 119.777 122.099 1.00 61.67 C ATOM 27770 OG1 THR R 42 32.115 119.107 123.255 1.00 58.98 O ATOM 27771 CG2 THR R 42 32.845 121.238 122.414 1.00 60.80 C ATOM 27772 N ALA R 43 33.086 119.743 119.023 1.00 62.37 N ATOM 27773 CA ALA R 43 33.590 120.350 117.805 1.00 62.97 C ATOM 27774 C ALA R 43 32.413 120.522 116.849 1.00 62.91 C ATOM 27775 O ALA R 43 32.249 121.573 116.222 1.00 62.11 O ATOM 27776 CB ALA R 43 34.672 119.465 117.176 1.00 63.00 C ATOM 27777 N CYS R 44 31.579 119.494 116.747 1.00 62.86 N ATOM 27778 CA CYS R 44 30.429 119.583 115.864 1.00 64.07 C ATOM 27779 C CYS R 44 29.571 120.774 116.274 1.00 64.40 C ATOM 27780 O CYS R 44 29.211 121.599 115.438 1.00 64.18 O ATOM 27781 CB CYS R 44 29.611 118.288 115.897 1.00 64.48 C ATOM 27782 SG CYS R 44 30.421 116.892 115.053 1.00 65.35 S ATOM 27783 N VAL R 45 29.265 120.880 117.562 1.00 64.89 N ATOM 27784 CA VAL R 45 28.464 122.001 118.047 1.00 64.79 C ATOM 27785 C VAL R 45 29.103 123.340 117.674 1.00 64.92 C ATOM 27786 O VAL R 45 28.411 124.259 117.241 1.00 65.98 O ATOM 27787 CB VAL R 45 28.299 121.958 119.568 1.00 64.98 C ATOM 27788 CG1 VAL R 45 27.338 123.059 120.025 1.00 62.31 C ATOM 27789 CG2 VAL R 45 27.802 120.587 119.982 1.00 64.79 C ATOM 27790 N ALA R 46 30.416 123.454 117.846 1.00 64.01 N ATOM 27791 CA ALA R 46 31.104 124.692 117.503 1.00 65.01 C ATOM 27792 C ALA R 46 30.919 125.004 116.025 1.00 66.08 C ATOM 27793 O ALA R 46 30.448 126.084 115.659 1.00 66.97 O ATOM 27794 CB ALA R 46 32.579 124.576 117.814 1.00 65.19 C ATOM 27795 N THR R 47 31.291 124.049 115.175 1.00 66.04 N ATOM 27796 CA THR R 47 31.167 124.231 113.730 1.00 64.21 C ATOM 27797 C THR R 47 29.716 124.537 113.368 1.00 62.71 C ATOM 27798 O THR R 47 29.443 125.425 112.570 1.00 60.47 O ATOM 27799 CB THR R 47 31.616 122.977 112.982 1.00 63.64 C ATOM 27800 OG1 THR R 47 32.616 122.302 113.748 1.00 63.07 O ATOM 27801 CG2 THR R 47 32.214 123.357 111.644 1.00 62.21 C ATOM 27802 N ALA R 48 28.794 123.797 113.968 1.00 61.99 N ATOM 27803 CA ALA R 48 27.384 124.016 113.713 1.00 63.67 C ATOM 27804 C ALA R 48 27.075 125.479 113.966 1.00 65.09 C ATOM 27805 O ALA R 48 26.366 126.116 113.182 1.00 67.82 O ATOM 27806 CB ALA R 48 26.532 123.144 114.623 1.00 63.13 C ATOM 27807 N TYR R 49 27.607 126.012 115.061 1.00 64.55 N ATOM 27808 CA TYR R 49 27.378 127.410 115.407 1.00 64.53 C ATOM 27809 C TYR R 49 27.962 128.313 114.330 1.00 64.02 C ATOM 27810 O TYR R 49 27.270 129.158 113.775 1.00 63.51 O ATOM 27811 CB TYR R 49 28.036 127.738 116.750 1.00 65.55 C ATOM 27812 CG TYR R 49 27.941 129.199 117.141 1.00 66.19 C ATOM 27813 CD1 TYR R 49 26.770 129.715 117.707 1.00 67.14 C ATOM 27814 CD2 TYR R 49 29.011 130.074 116.918 1.00 65.25 C ATOM 27815 CE1 TYR R 49 26.667 131.066 118.041 1.00 66.73 C ATOM 27816 CE2 TYR R 49 28.917 131.425 117.244 1.00 64.96 C ATOM 27817 CZ TYR R 49 27.743 131.912 117.807 1.00 66.00 C ATOM 27818 OH TYR R 49 27.635 133.240 118.152 1.00 67.85 O ATOM 27819 N ALA R 50 29.244 128.126 114.042 1.00 63.96 N ATOM 27820 CA ALA R 50 29.923 128.929 113.038 1.00 65.11 C ATOM 27821 C ALA R 50 29.200 128.867 111.702 1.00 65.45 C ATOM 27822 O ALA R 50 29.016 129.880 111.029 1.00 66.52 O ATOM 27823 CB ALA R 50 31.344 128.449 112.876 1.00 65.27 C ATOM 27824 N ALA R 51 28.792 127.665 111.324 1.00 65.20 N ATOM 27825 CA ALA R 51 28.089 127.445 110.071 1.00 64.69 C ATOM 27826 C ALA R 51 26.775 128.205 110.008 1.00 64.26 C ATOM 27827 O ALA R 51 26.545 128.995 109.089 1.00 64.48 O ATOM 27828 CB ALA R 51 27.831 125.972 109.895 1.00 65.10 C ATOM 27829 N LYS R 52 25.908 127.951 110.981 1.00 63.73 N ATOM 27830 CA LYS R 52 24.612 128.612 111.034 1.00 64.64 C ATOM 27831 C LYS R 52 24.766 130.129 110.871 1.00 66.54 C ATOM 27832 O LYS R 52 24.010 130.768 110.141 1.00 67.56 O ATOM 27833 CB LYS R 52 23.914 128.268 112.353 1.00 62.38 C ATOM 27834 CG LYS R 52 22.578 128.937 112.576 1.00 60.62 C ATOM 27835 CD LYS R 52 22.759 130.380 112.997 1.00 63.96 C ATOM 27836 CE LYS R 52 21.438 131.010 113.398 1.00 66.91 C ATOM 27837 NZ LYS R 52 20.775 130.265 114.514 1.00 68.36 N ATOM 27838 N ASN R 53 25.755 130.707 111.538 1.00 67.59 N ATOM 27839 CA ASN R 53 25.962 132.135 111.435 1.00 68.21 C ATOM 27840 C ASN R 53 26.435 132.575 110.062 1.00 68.20 C ATOM 27841 O ASN R 53 25.897 133.525 109.503 1.00 68.82 O ATOM 27842 CB ASN R 53 26.924 132.599 112.521 1.00 69.53 C ATOM 27843 CG ASN R 53 26.200 132.964 113.798 1.00 72.01 C ATOM 27844 OD1 ASN R 53 25.915 134.136 114.049 1.00 73.98 O ATOM 27845 ND2 ASN R 53 25.866 131.958 114.599 1.00 73.09 N ATOM 27846 N VAL R 54 27.430 131.903 109.499 1.00 67.88 N ATOM 27847 CA VAL R 54 27.883 132.310 108.178 1.00 68.29 C ATOM 27848 C VAL R 54 26.763 132.159 107.167 1.00 69.50 C ATOM 27849 O VAL R 54 26.607 132.997 106.284 1.00 71.29 O ATOM 27850 CB VAL R 54 29.080 131.497 107.680 1.00 67.17 C ATOM 27851 CG1 VAL R 54 29.299 131.756 106.190 1.00 64.91 C ATOM 27852 CG2 VAL R 54 30.313 131.896 108.447 1.00 67.37 C ATOM 27853 N VAL R 55 25.980 131.097 107.281 1.00 69.16 N ATOM 27854 CA VAL R 55 24.894 130.922 106.337 1.00 70.16 C ATOM 27855 C VAL R 55 23.888 132.042 106.510 1.00 70.50 C ATOM 27856 O VAL R 55 23.476 132.676 105.540 1.00 70.56 O ATOM 27857 CB VAL R 55 24.211 129.579 106.530 1.00 70.95 C ATOM 27858 CG1 VAL R 55 22.985 129.488 105.631 1.00 69.61 C ATOM 27859 CG2 VAL R 55 25.210 128.465 106.213 1.00 71.74 C ATOM 27860 N THR R 56 23.500 132.277 107.755 1.00 71.48 N ATOM 27861 CA THR R 56 22.571 133.344 108.100 1.00 72.25 C ATOM 27862 C THR R 56 22.997 134.659 107.429 1.00 74.08 C ATOM 27863 O THR R 56 22.251 135.254 106.654 1.00 74.88 O ATOM 27864 CB THR R 56 22.553 133.535 109.625 1.00 71.27 C ATOM 27865 OG1 THR R 56 21.661 132.581 110.204 1.00 69.14 O ATOM 27866 CG2 THR R 56 22.144 134.952 110.004 1.00 71.43 C ATOM 27867 N GLN R 57 24.206 135.106 107.734 1.00 75.08 N ATOM 27868 CA GLN R 57 24.727 136.334 107.164 1.00 76.98 C ATOM 27869 C GLN R 57 24.659 136.317 105.655 1.00 77.20 C ATOM 27870 O GLN R 57 24.029 137.173 105.050 1.00 77.94 O ATOM 27871 CB GLN R 57 26.172 136.533 107.599 1.00 79.11 C ATOM 27872 CG GLN R 57 26.319 136.567 109.097 1.00 80.79 C ATOM 27873 CD GLN R 57 27.741 136.388 109.554 1.00 81.81 C ATOM 27874 OE1 GLN R 57 27.995 136.325 110.746 1.00 84.03 O ATOM 27875 NE2 GLN R 57 28.678 136.302 108.613 1.00 81.78 N ATOM 27876 N PHE R 58 25.312 135.340 105.045 1.00 77.96 N ATOM 27877 CA PHE R 58 25.310 135.252 103.599 1.00 78.72 C ATOM 27878 C PHE R 58 23.897 135.219 103.025 1.00 77.69 C ATOM 27879 O PHE R 58 23.603 135.941 102.071 1.00 76.92 O ATOM 27880 CB PHE R 58 26.144 134.044 103.137 1.00 80.26 C ATOM 27881 CG PHE R 58 27.656 134.260 103.255 1.00 83.13 C ATOM 27882 CD1 PHE R 58 28.561 133.347 102.698 1.00 83.61 C ATOM 27883 CD2 PHE R 58 28.173 135.382 103.910 1.00 82.98 C ATOM 27884 CE1 PHE R 58 29.953 133.549 102.789 1.00 82.68 C ATOM 27885 CE2 PHE R 58 29.557 135.584 104.000 1.00 83.19 C ATOM 27886 CZ PHE R 58 30.444 134.663 103.437 1.00 81.72 C ATOM 27887 N ILE R 59 23.013 134.422 103.618 1.00 77.01 N ATOM 27888 CA ILE R 59 21.635 134.350 103.128 1.00 76.75 C ATOM 27889 C ILE R 59 20.975 135.718 103.147 1.00 76.89 C ATOM 27890 O ILE R 59 20.214 136.054 102.247 1.00 78.71 O ATOM 27891 CB ILE R 59 20.744 133.400 103.971 1.00 75.95 C ATOM 27892 CG1 ILE R 59 19.970 132.462 103.049 1.00 75.80 C ATOM 27893 CG2 ILE R 59 19.711 134.189 104.770 1.00 73.83 C ATOM 27894 CD1 ILE R 59 20.393 131.000 103.168 1.00 75.24 C ATOM 27895 N SER R 60 21.259 136.506 104.174 1.00 76.38 N ATOM 27896 CA SER R 60 20.650 137.819 104.277 1.00 76.92 C ATOM 27897 C SER R 60 21.342 138.887 103.425 1.00 76.53 C ATOM 27898 O SER R 60 20.891 140.029 103.369 1.00 76.49 O ATOM 27899 CB SER R 60 20.608 138.262 105.740 1.00 78.59 C ATOM 27900 OG SER R 60 21.900 138.577 106.221 1.00 80.97 O ATOM 27901 N SER R 61 22.435 138.522 102.765 1.00 76.33 N ATOM 27902 CA SER R 61 23.135 139.470 101.910 1.00 76.13 C ATOM 27903 C SER R 61 22.319 139.565 100.629 1.00 76.91 C ATOM 27904 O SER R 61 22.603 140.369 99.744 1.00 77.24 O ATOM 27905 CB SER R 61 24.545 138.971 101.579 1.00 75.75 C ATOM 27906 OG SER R 61 24.536 138.071 100.487 1.00 73.90 O