>>3H44:HELIX   90  90 ASN B  994  GLY B 1001  1                                   8    
NMTEFKRGLPLFPLVKPHASLAKRSRQVASLASRQV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 90 90 ASN B 994 GLY B 1001 1 8 ATOM 15489 N ASN B 994 -106.197 -35.931 -32.231 1.00 52.52 N ATOM 15490 CA ASN B 994 -106.609 -35.893 -30.843 1.00 51.86 C ATOM 15491 C ASN B 994 -105.459 -35.354 -30.012 1.00 52.36 C ATOM 15492 O ASN B 994 -104.405 -35.980 -29.954 1.00 52.38 O ATOM 15493 CB ASN B 994 -106.916 -37.312 -30.411 1.00 51.30 C ATOM 15494 CG ASN B 994 -107.446 -37.380 -29.037 1.00 49.72 C ATOM 15495 OD1 ASN B 994 -106.709 -37.266 -28.057 1.00 47.54 O ATOM 15496 ND2 ASN B 994 -108.743 -37.570 -28.940 1.00 48.12 N ATOM 15497 N MET B 995 -105.616 -34.206 -29.364 1.00 52.85 N ATOM 15498 CA MET B 995 -104.426 -33.650 -28.706 1.00 53.59 C ATOM 15499 C MET B 995 -103.920 -34.456 -27.522 1.00 53.60 C ATOM 15500 O MET B 995 -102.773 -34.288 -27.093 1.00 53.82 O ATOM 15501 CB MET B 995 -104.546 -32.174 -28.326 1.00 53.81 C ATOM 15502 CG MET B 995 -105.886 -31.547 -28.453 1.00 55.21 C ATOM 15503 SD MET B 995 -105.456 -29.826 -28.730 1.00 59.38 S ATOM 15504 CE MET B 995 -107.080 -29.176 -29.119 1.00 58.98 C ATOM 15505 N THR B 996 -104.763 -35.332 -26.995 1.00 53.36 N ATOM 15506 CA THR B 996 -104.329 -36.148 -25.885 1.00 53.28 C ATOM 15507 C THR B 996 -103.468 -37.270 -26.440 1.00 53.44 C ATOM 15508 O THR B 996 -102.333 -37.461 -25.977 1.00 53.18 O ATOM 15509 CB THR B 996 -105.512 -36.635 -25.042 1.00 53.26 C ATOM 15510 OG1 THR B 996 -105.983 -35.540 -24.257 1.00 52.67 O ATOM 15511 CG2 THR B 996 -105.094 -37.752 -24.103 1.00 53.38 C ATOM 15512 N GLU B 997 -103.996 -37.974 -27.452 1.00 53.44 N ATOM 15513 CA GLU B 997 -103.229 -38.986 -28.179 1.00 53.48 C ATOM 15514 C GLU B 997 -101.903 -38.384 -28.634 1.00 52.73 C ATOM 15515 O GLU B 997 -100.833 -38.931 -28.357 1.00 53.00 O ATOM 15516 CB GLU B 997 -104.002 -39.538 -29.373 1.00 53.50 C ATOM 15517 CG GLU B 997 -105.129 -40.497 -29.026 1.00 57.02 C ATOM 15518 CD GLU B 997 -105.854 -41.034 -30.280 1.00 62.48 C ATOM 15519 OE1 GLU B 997 -105.156 -41.369 -31.274 1.00 63.59 O ATOM 15520 OE2 GLU B 997 -107.117 -41.122 -30.272 1.00 64.07 O ATOM 15521 N PHE B 998 -101.972 -37.232 -29.288 1.00 52.07 N ATOM 15522 CA PHE B 998 -100.769 -36.530 -29.700 1.00 51.42 C ATOM 15523 C PHE B 998 -99.699 -36.475 -28.600 1.00 51.20 C ATOM 15524 O PHE B 998 -98.607 -37.037 -28.765 1.00 51.34 O ATOM 15525 CB PHE B 998 -101.099 -35.122 -30.174 1.00 50.98 C ATOM 15526 CG PHE B 998 -99.889 -34.330 -30.543 1.00 50.60 C ATOM 15527 CD1 PHE B 998 -99.104 -34.702 -31.627 1.00 50.01 C ATOM 15528 CD2 PHE B 998 -99.509 -33.221 -29.799 1.00 51.81 C ATOM 15529 CE1 PHE B 998 -97.948 -33.981 -31.976 1.00 49.68 C ATOM 15530 CE2 PHE B 998 -98.355 -32.487 -30.143 1.00 51.69 C ATOM 15531 CZ PHE B 998 -97.575 -32.878 -31.236 1.00 50.53 C ATOM 15532 N LYS B 999 -100.044 -35.808 -27.495 1.00 50.87 N ATOM 15533 CA LYS B 999 -99.165 -35.547 -26.353 1.00 50.73 C ATOM 15534 C LYS B 999 -98.651 -36.811 -25.664 1.00 50.97 C ATOM 15535 O LYS B 999 -97.453 -36.932 -25.405 1.00 50.34 O ATOM 15536 CB LYS B 999 -99.913 -34.690 -25.334 1.00 50.76 C ATOM 15537 CG LYS B 999 -99.621 -33.206 -25.400 1.00 50.77 C ATOM 15538 CD LYS B 999 -100.897 -32.366 -25.233 1.00 50.97 C ATOM 15539 CE LYS B 999 -101.253 -32.061 -23.786 1.00 50.03 C ATOM 15540 NZ LYS B 999 -102.097 -30.825 -23.703 1.00 49.06 N ATOM 15541 N ARG B1000 -99.574 -37.733 -25.356 1.00 51.63 N ATOM 15542 CA ARG B1000 -99.253 -39.071 -24.835 1.00 52.05 C ATOM 15543 C ARG B1000 -98.219 -39.759 -25.741 1.00 51.22 C ATOM 15544 O ARG B1000 -97.250 -40.347 -25.249 1.00 51.42 O ATOM 15545 CB ARG B1000 -100.525 -39.927 -24.729 1.00 52.59 C ATOM 15546 CG ARG B1000 -101.185 -39.977 -23.323 1.00 56.27 C ATOM 15547 CD ARG B1000 -102.492 -40.885 -23.230 1.00 63.08 C ATOM 15548 NE ARG B1000 -102.491 -42.144 -24.027 1.00 67.83 N ATOM 15549 CZ ARG B1000 -103.304 -42.409 -25.070 1.00 70.57 C ATOM 15550 NH1 ARG B1000 -104.220 -41.523 -25.482 1.00 71.37 N ATOM 15551 NH2 ARG B1000 -103.215 -43.572 -25.711 1.00 70.39 N ATOM 15552 N GLY B1001 -98.423 -39.629 -27.056 1.00 50.17 N ATOM 15553 CA GLY B1001 -97.548 -40.177 -28.098 1.00 48.77 C ATOM 15554 C GLY B1001 -96.091 -39.741 -28.194 1.00 47.80 C ATOM 15555 O GLY B1001 -95.335 -40.373 -28.915 1.00 47.42 O ATOM 15556 N LEU B1002 -95.671 -38.682 -27.500 1.00 46.97 N ATOM 15557 CA LEU B1002 -94.253 -38.272 -27.576 1.00 46.51 C ATOM 15558 C LEU B1002 -93.622 -37.728 -26.283 1.00 46.10 C ATOM 15559 O LEU B1002 -94.327 -37.436 -25.322 1.00 46.14 O ATOM 15560 CB LEU B1002 -93.980 -37.335 -28.773 1.00 46.97 C ATOM 15561 CG LEU B1002 -94.997 -36.417 -29.446 1.00 46.82 C ATOM 15562 CD1 LEU B1002 -94.219 -35.343 -30.139 1.00 47.07 C ATOM 15563 CD2 LEU B1002 -95.824 -37.193 -30.463 1.00 48.84 C ATOM 15564 N PRO B1003 -92.280 -37.618 -26.245 1.00 45.65 N ATOM 15565 CA PRO B1003 -91.586 -37.248 -25.019 1.00 45.88 C ATOM 15566 C PRO B1003 -91.833 -35.823 -24.564 1.00 46.61 C ATOM 15567 O PRO B1003 -92.423 -35.034 -25.302 1.00 47.35 O ATOM 15568 CB PRO B1003 -90.112 -37.423 -25.388 1.00 45.40 C ATOM 15569 CG PRO B1003 -90.066 -37.407 -26.813 1.00 45.14 C ATOM 15570 CD PRO B1003 -91.324 -38.011 -27.285 1.00 45.43 C ATOM 15571 N LEU B1004 -91.385 -35.511 -23.350 1.00 47.06 N ATOM 15572 CA LEU B1004 -91.482 -34.176 -22.781 1.00 47.57 C ATOM 15573 C LEU B1004 -90.094 -33.665 -22.496 1.00 48.25 C ATOM 15574 O LEU B1004 -89.227 -34.420 -22.101 1.00 48.34 O ATOM 15575 CB LEU B1004 -92.265 -34.210 -21.477 1.00 47.21 C ATOM 15576 CG LEU B1004 -93.736 -34.571 -21.619 1.00 47.54 C ATOM 15577 CD1 LEU B1004 -94.390 -34.609 -20.262 1.00 47.67 C ATOM 15578 CD2 LEU B1004 -94.408 -33.563 -22.503 1.00 47.22 C ATOM 15579 N PHE B1005 -89.879 -32.373 -22.675 1.00 49.26 N ATOM 15580 CA PHE B1005 -88.561 -31.814 -22.447 1.00 49.99 C ATOM 15581 C PHE B1005 -88.205 -31.819 -20.972 1.00 50.45 C ATOM 15582 O PHE B1005 -89.090 -31.973 -20.141 1.00 50.27 O ATOM 15583 CB PHE B1005 -88.502 -30.396 -22.992 1.00 50.03 C ATOM 15584 CG PHE B1005 -88.061 -30.318 -24.423 1.00 49.71 C ATOM 15585 CD1 PHE B1005 -88.999 -30.297 -25.455 1.00 48.83 C ATOM 15586 CD2 PHE B1005 -86.701 -30.258 -24.741 1.00 48.88 C ATOM 15587 CE1 PHE B1005 -88.590 -30.210 -26.773 1.00 47.24 C ATOM 15588 CE2 PHE B1005 -86.286 -30.179 -26.062 1.00 47.51 C ATOM 15589 CZ PHE B1005 -87.235 -30.155 -27.078 1.00 47.12 C ATOM 15590 N PRO B1006 -86.902 -31.673 -20.649 1.00 51.14 N ATOM 15591 CA PRO B1006 -86.533 -31.323 -19.273 1.00 51.83 C ATOM 15592 C PRO B1006 -87.106 -29.955 -18.961 1.00 52.97 C ATOM 15593 O PRO B1006 -87.518 -29.247 -19.873 1.00 52.84 O ATOM 15594 CB PRO B1006 -85.000 -31.212 -19.315 1.00 51.56 C ATOM 15595 CG PRO B1006 -84.565 -31.903 -20.560 1.00 51.05 C ATOM 15596 CD PRO B1006 -85.727 -31.911 -21.514 1.00 50.86 C ATOM 15597 N LEU B1007 -87.151 -29.601 -17.683 1.00 54.63 N ATOM 15598 CA LEU B1007 -87.383 -28.221 -17.266 1.00 56.21 C ATOM 15599 C LEU B1007 -86.030 -27.492 -17.259 1.00 58.09 C ATOM 15600 O LEU B1007 -84.983 -28.122 -17.069 1.00 58.25 O ATOM 15601 CB LEU B1007 -88.058 -28.205 -15.891 1.00 55.64 C ATOM 15602 CG LEU B1007 -89.598 -28.211 -15.814 1.00 54.69 C ATOM 15603 CD1 LEU B1007 -90.238 -28.620 -17.104 1.00 55.24 C ATOM 15604 CD2 LEU B1007 -90.136 -29.066 -14.701 1.00 52.66 C ATOM 15605 N VAL B1008 -86.031 -26.183 -17.500 1.00 60.42 N ATOM 15606 CA VAL B1008 -84.763 -25.430 -17.545 1.00 62.75 C ATOM 15607 C VAL B1008 -84.144 -25.323 -16.134 1.00 64.86 C ATOM 15608 O VAL B1008 -84.868 -25.325 -15.140 1.00 65.21 O ATOM 15609 CB VAL B1008 -84.920 -24.052 -18.274 1.00 62.14 C ATOM 15610 CG1 VAL B1008 -83.766 -23.126 -18.003 1.00 61.82 C ATOM 15611 CG2 VAL B1008 -85.008 -24.262 -19.762 1.00 62.42 C ATOM 15612 N LYS B1009 -82.811 -25.300 -16.059 1.00 67.42 N ATOM 15613 CA LYS B1009 -82.076 -25.063 -14.808 1.00 69.80 C ATOM 15614 C LYS B1009 -82.172 -23.588 -14.324 1.00 71.02 C ATOM 15615 O LYS B1009 -82.144 -22.670 -15.156 1.00 71.09 O ATOM 15616 CB LYS B1009 -80.596 -25.404 -15.020 1.00 70.23 C ATOM 15617 CG LYS B1009 -80.139 -26.784 -14.538 1.00 71.71 C ATOM 15618 CD LYS B1009 -78.659 -26.715 -14.046 1.00 74.83 C ATOM 15619 CE LYS B1009 -77.629 -26.519 -15.201 1.00 76.86 C ATOM 15620 NZ LYS B1009 -77.355 -27.781 -15.988 1.00 77.76 N ATOM 15621 N PRO B1010 -82.285 -23.356 -12.983 1.00 72.33 N ATOM 15622 CA PRO B1010 -82.083 -21.987 -12.423 1.00 73.23 C ATOM 15623 C PRO B1010 -80.604 -21.540 -12.499 1.00 74.18 C ATOM 15624 O PRO B1010 -79.743 -22.376 -12.760 1.00 74.51 O ATOM 15625 CB PRO B1010 -82.567 -22.120 -10.964 1.00 72.97 C ATOM 15626 CG PRO B1010 -83.488 -23.311 -10.962 1.00 72.67 C ATOM 15627 CD PRO B1010 -82.868 -24.268 -11.973 1.00 72.49 C ATOM 15628 N HIS B1011 -80.306 -20.253 -12.276 1.00 75.35 N ATOM 15629 CA HIS B1011 -78.949 -19.708 -12.557 1.00 76.19 C ATOM 15630 C HIS B1011 -77.883 -19.907 -11.453 1.00 76.31 C ATOM 15631 O HIS B1011 -77.892 -19.335 -10.353 1.00 76.66 O ATOM 15632 CB HIS B1011 -79.023 -18.238 -12.991 1.00 76.20 C ATOM 15633 CG HIS B1011 -77.915 -17.834 -13.910 1.00 77.77 C ATOM 15634 ND1 HIS B1011 -76.740 -17.268 -13.459 1.00 79.32 N ATOM 15635 CD2 HIS B1011 -77.790 -17.936 -15.257 1.00 78.87 C ATOM 15636 CE1 HIS B1011 -75.943 -17.026 -14.489 1.00 79.18 C ATOM 15637 NE2 HIS B1011 -76.556 -17.422 -15.593 1.00 79.00 N TER 15638 HIS B1011 ATOM 15639 N ALA C 1 -110.696 61.618 26.963 1.00 39.09 N ATOM 15640 CA ALA C 1 -111.365 60.618 26.101 1.00 40.30 C ATOM 15641 C ALA C 1 -112.335 59.750 26.953 1.00 41.23 C ATOM 15642 O ALA C 1 -112.018 59.426 28.110 1.00 41.14 O ATOM 15643 CB ALA C 1 -110.297 59.748 25.350 1.00 39.01 C ATOM 15644 N SER C 2 -113.520 59.434 26.395 1.00 42.22 N ATOM 15645 CA SER C 2 -114.432 58.355 26.863 1.00 43.30 C ATOM 15646 C SER C 2 -113.671 57.078 26.481 1.00 44.37 C ATOM 15647 O SER C 2 -112.967 57.132 25.505 1.00 43.85 O ATOM 15648 CB SER C 2 -115.760 58.457 26.066 1.00 43.46 C ATOM 15649 OG SER C 2 -116.964 58.021 26.717 1.00 42.77 O ATOM 15650 N LEU C 3 -113.734 55.957 27.216 1.00 46.55 N ATOM 15651 CA LEU C 3 -113.030 54.725 26.725 1.00 48.54 C ATOM 15652 C LEU C 3 -113.720 54.161 25.466 1.00 49.66 C ATOM 15653 O LEU C 3 -114.955 54.248 25.337 1.00 49.51 O ATOM 15654 CB LEU C 3 -112.804 53.616 27.793 1.00 48.72 C ATOM 15655 CG LEU C 3 -111.917 52.396 27.329 1.00 50.74 C ATOM 15656 CD1 LEU C 3 -110.626 52.065 28.180 1.00 49.83 C ATOM 15657 CD2 LEU C 3 -112.717 51.091 27.039 1.00 51.20 C ATOM 15658 N ALA C 4 -112.914 53.617 24.541 1.00 51.04 N ATOM 15659 CA ALA C 4 -113.414 53.111 23.244 1.00 52.11 C ATOM 15660 C ALA C 4 -113.772 51.606 23.296 1.00 52.65 C ATOM 15661 O ALA C 4 -112.981 50.771 23.773 1.00 52.99 O ATOM 15662 CB ALA C 4 -112.392 53.419 22.098 1.00 52.19 C ATOM 15663 N LYS C 16 -105.365 42.225 24.700 1.00 85.81 N ATOM 15664 CA LYS C 16 -106.766 42.444 24.320 1.00 85.79 C ATOM 15665 C LYS C 16 -107.403 41.200 23.632 1.00 86.14 C ATOM 15666 O LYS C 16 -108.333 40.577 24.172 1.00 85.92 O ATOM 15667 CB LYS C 16 -106.895 43.725 23.453 1.00 85.46 C ATOM 15668 CG LYS C 16 -105.822 44.807 23.734 1.00 83.64 C ATOM 15669 CD LYS C 16 -105.711 45.141 25.243 1.00 79.11 C ATOM 15670 CE LYS C 16 -104.284 45.318 25.683 1.00 74.91 C ATOM 15671 NZ LYS C 16 -103.455 44.217 25.180 1.00 70.83 N ATOM 15672 N ARG C 17 -106.839 40.819 22.480 1.00 86.55 N ATOM 15673 CA ARG C 17 -107.497 39.978 21.461 1.00 86.78 C ATOM 15674 C ARG C 17 -106.436 39.278 20.586 1.00 86.40 C ATOM 15675 O ARG C 17 -105.887 39.884 19.647 1.00 86.40 O ATOM 15676 CB ARG C 17 -108.385 40.885 20.591 1.00 87.12 C ATOM 15677 CG ARG C 17 -107.697 42.263 20.332 1.00 88.93 C ATOM 15678 CD ARG C 17 -108.628 43.384 19.948 1.00 90.75 C ATOM 15679 NE ARG C 17 -108.881 43.349 18.515 1.00 92.19 N ATOM 15680 CZ ARG C 17 -110.006 42.905 17.960 1.00 93.02 C ATOM 15681 NH1 ARG C 17 -111.011 42.475 18.726 1.00 92.52 N ATOM 15682 NH2 ARG C 17 -110.129 42.909 16.632 1.00 93.03 N ATOM 15683 N SER C 18 -106.155 38.007 20.905 1.00 85.99 N ATOM 15684 CA SER C 18 -105.123 37.177 20.231 1.00 85.25 C ATOM 15685 C SER C 18 -105.451 36.835 18.746 1.00 85.48 C ATOM 15686 O SER C 18 -106.565 36.390 18.448 1.00 85.26 O ATOM 15687 CB SER C 18 -104.867 35.899 21.049 1.00 84.88 C ATOM 15688 OG SER C 18 -104.349 36.181 22.336 1.00 82.28 O ATOM 15689 N ARG C 19 -104.469 37.004 17.842 1.00 85.75 N ATOM 15690 CA ARG C 19 -104.712 37.130 16.375 1.00 85.88 C ATOM 15691 C ARG C 19 -103.860 36.238 15.422 1.00 85.82 C ATOM 15692 O ARG C 19 -103.407 35.154 15.803 1.00 85.20 O ATOM 15693 CB ARG C 19 -104.563 38.619 15.975 1.00 85.81 C ATOM 15694 CG ARG C 19 -105.383 39.080 14.761 1.00 85.50 C ATOM 15695 CD ARG C 19 -105.088 40.522 14.454 1.00 84.96 C ATOM 15696 NE ARG C 19 -105.182 41.312 15.676 1.00 84.47 N ATOM 15697 CZ ARG C 19 -106.292 41.894 16.113 1.00 83.89 C ATOM 15698 NH1 ARG C 19 -107.421 41.798 15.421 1.00 82.65 N ATOM 15699 NH2 ARG C 19 -106.263 42.582 17.244 1.00 83.62 N ATOM 15700 N GLN C 20 -103.753 36.707 14.165 1.00 86.40 N ATOM 15701 CA GLN C 20 -102.719 36.347 13.121 1.00 86.86 C ATOM 15702 C GLN C 20 -102.418 37.523 12.095 1.00 86.92 C ATOM 15703 O GLN C 20 -103.045 38.603 12.170 1.00 87.11 O ATOM 15704 CB GLN C 20 -103.000 34.998 12.422 1.00 86.74 C ATOM 15705 CG GLN C 20 -104.459 34.570 12.405 1.00 85.83 C ATOM 15706 CD GLN C 20 -104.657 33.217 11.775 1.00 85.54 C ATOM 15707 OE1 GLN C 20 -105.178 32.307 12.410 1.00 86.54 O ATOM 15708 NE2 GLN C 20 -104.241 33.070 10.522 1.00 84.32 N ATOM 15709 N VAL C 21 -101.450 37.329 11.188 1.00 86.62 N ATOM 15710 CA VAL C 21 -100.934 38.423 10.322 1.00 86.56 C ATOM 15711 C VAL C 21 -100.974 39.851 10.940 1.00 86.15 C ATOM 15712 O VAL C 21 -100.206 40.191 11.853 1.00 85.49 O ATOM 15713 CB VAL C 21 -101.633 38.395 8.934 1.00 86.34 C TER 15714 VAL C 21 ATOM 15715 N ALA D 1 -116.523 3.114 -14.768 1.00 51.44 N ATOM 15716 CA ALA D 1 -115.307 3.833 -15.188 1.00 52.18 C ATOM 15717 C ALA D 1 -115.734 5.083 -15.966 1.00 53.18 C ATOM 15718 O ALA D 1 -116.781 5.059 -16.654 1.00 53.58 O ATOM 15719 CB ALA D 1 -114.409 2.919 -16.037 1.00 51.15 C ATOM 15720 N SER D 2 -114.955 6.175 -15.811 1.00 53.98 N ATOM 15721 CA SER D 2 -114.985 7.398 -16.663 1.00 54.35 C ATOM 15722 C SER D 2 -114.511 7.010 -18.086 1.00 54.59 C ATOM 15723 O SER D 2 -113.614 6.193 -18.205 1.00 54.15 O ATOM 15724 CB SER D 2 -114.045 8.437 -16.027 1.00 54.33 C ATOM 15725 OG SER D 2 -114.317 9.778 -16.409 1.00 55.21 O ATOM 15726 N LEU D 3 -115.093 7.539 -19.166 1.00 55.56 N ATOM 15727 CA LEU D 3 -114.649 7.085 -20.520 1.00 56.64 C ATOM 15728 C LEU D 3 -113.157 7.391 -20.882 1.00 57.40 C ATOM 15729 O LEU D 3 -112.661 8.487 -20.601 1.00 57.39 O ATOM 15730 CB LEU D 3 -115.607 7.487 -21.661 1.00 56.00 C ATOM 15731 CG LEU D 3 -115.089 6.946 -23.025 1.00 57.44 C ATOM 15732 CD1 LEU D 3 -115.225 5.393 -23.269 1.00 57.86 C ATOM 15733 CD2 LEU D 3 -115.650 7.723 -24.221 1.00 58.42 C ATOM 15734 N ALA D 4 -112.479 6.417 -21.511 1.00 58.27 N ATOM 15735 CA ALA D 4 -111.035 6.463 -21.843 1.00 58.96 C ATOM 15736 C ALA D 4 -110.526 7.790 -22.456 1.00 59.44 C ATOM 15737 O ALA D 4 -110.389 7.934 -23.689 1.00 60.07 O ATOM 15738 CB ALA D 4 -110.663 5.253 -22.747 1.00 58.94 C ATOM 15739 N SER D 18 -107.812 2.618 -37.463 1.00 89.62 N ATOM 15740 CA SER D 18 -107.298 2.050 -38.709 1.00 89.85 C ATOM 15741 C SER D 18 -105.746 2.100 -38.816 1.00 90.36 C ATOM 15742 O SER D 18 -105.184 3.100 -39.287 1.00 90.61 O ATOM 15743 CB SER D 18 -107.963 2.740 -39.907 1.00 89.49 C ATOM 15744 OG SER D 18 -109.316 2.356 -40.027 1.00 88.19 O ATOM 15745 N ARG D 19 -105.073 1.014 -38.402 1.00 90.58 N ATOM 15746 CA ARG D 19 -103.596 0.965 -38.267 1.00 90.59 C ATOM 15747 C ARG D 19 -103.039 -0.027 -39.302 1.00 90.68 C ATOM 15748 O ARG D 19 -103.748 -0.410 -40.236 1.00 90.16 O ATOM 15749 CB ARG D 19 -103.215 0.358 -36.900 1.00 90.44 C ATOM 15750 CG ARG D 19 -102.057 1.051 -36.157 1.00 89.99 C ATOM 15751 CD ARG D 19 -102.001 0.625 -34.691 1.00 89.21 C ATOM 15752 NE ARG D 19 -103.312 0.765 -34.055 1.00 88.84 N ATOM 15753 CZ ARG D 19 -103.671 1.760 -33.246 1.00 88.36 C ATOM 15754 NH1 ARG D 19 -102.816 2.721 -32.926 1.00 88.51 N ATOM 15755 NH2 ARG D 19 -104.894 1.790 -32.740 1.00 87.20 N ATOM 15756 N GLN D 20 -101.769 -0.421 -39.148 1.00 91.14 N ATOM 15757 CA GLN D 20 -101.111 -1.323 -40.132 1.00 91.43 C ATOM 15758 C GLN D 20 -100.631 -2.602 -39.359 1.00 91.94 C ATOM 15759 O GLN D 20 -101.074 -3.706 -39.697 1.00 92.09 O ATOM 15760 CB GLN D 20 -100.646 -0.549 -41.379 1.00 91.02 C ATOM 15761 CG GLN D 20 -100.116 0.842 -41.106 1.00 89.36 C ATOM 15762 CD GLN D 20 -99.111 1.254 -42.137 1.00 87.14 C ATOM 15763 OE1 GLN D 20 -99.445 1.909 -43.115 1.00 85.60 O ATOM 15764 NE2 GLN D 20 -97.869 0.841 -41.945 1.00 86.82 N ATOM 15765 N VAL D 21 -99.772 -2.460 -38.335 1.00 92.21 N ATOM 15766 CA VAL D 21 -98.733 -3.379 -37.785 1.00 92.44 C ATOM 15767 C VAL D 21 -98.792 -3.545 -36.253 1.00 92.45 C ATOM 15768 O VAL D 21 -99.491 -4.414 -35.722 1.00 92.31 O ATOM 15769 CB VAL D 21 -97.291 -2.953 -38.228 1.00 92.28 C TER 15770 VAL D 21 HETATM15771 C1 DIO A2000 -104.951 46.869 30.531 1.00 99.11 C HETATM15772 C2 DIO A2000 -103.967 47.852 32.535 1.00 98.38 C HETATM15773 C1' DIO A2000 -106.157 46.447 31.373 1.00 99.25 C HETATM15774 C2' DIO A2000 -105.177 47.432 33.357 1.00 98.10 C HETATM15775 O1 DIO A2000 -103.812 46.986 31.395 1.00 99.34 O HETATM15776 O1' DIO A2000 -106.312 47.340 32.491 1.00 99.05 O HETATM15777 C1 DIO A2001 -115.754 47.048 -2.705 1.00155.60 C HETATM15778 C2 DIO A2001 -117.794 47.891 -1.651 1.00155.85 C HETATM15779 C1' DIO A2001 -115.762 48.282 -3.614 1.00155.74 C HETATM15780 C2' DIO A2001 -117.811 49.072 -2.629 1.00155.78 C HETATM15781 O1 DIO A2001 -116.487 47.304 -1.501 1.00155.76 O HETATM15782 O1' DIO A2001 -117.097 48.755 -3.829 1.00155.75 O HETATM15783 C1 DIO A2002 -103.415 46.623 36.603 1.00 53.97 C HETATM15784 C2 DIO A2002 -103.719 45.344 38.592 1.00 54.52 C HETATM15785 C1' DIO A2002 -104.876 47.056 36.651 1.00 56.14 C HETATM15786 C2' DIO A2002 -104.428 46.645 38.988 1.00 56.60 C HETATM15787 O1 DIO A2002 -103.273 45.357 37.240 1.00 52.45 O HETATM15788 O1' DIO A2002 -105.376 47.087 38.005 1.00 58.21 O HETATM15789 ZN ZN B 1 -104.284 0.705 -41.722 1.00 2.00 ZN HETATM15790 C1 DIO B2000 -118.962 2.629 -30.612 1.00 93.75 C HETATM15791 C2 DIO B2000 -120.862 1.670 -29.452 1.00 93.12 C HETATM15792 C1' DIO B2000 -119.800 3.864 -30.929 1.00 94.28 C HETATM15793 C2' DIO B2000 -121.706 2.881 -29.813 1.00 93.23 C HETATM15794 O1 DIO B2000 -119.834 1.506 -30.439 1.00 93.62 O HETATM15795 O1' DIO B2000 -120.830 4.004 -29.936 1.00 94.39 O HETATM15796 C1 DIO B2001 -83.131 5.193 -22.163 1.00158.93 C HETATM15797 C2 DIO B2001 -83.506 7.021 -20.689 1.00158.53 C HETATM15798 C1' DIO B2001 -83.239 4.238 -20.973 1.00158.88 C HETATM15799 C2' DIO B2001 -83.777 6.084 -19.514 1.00158.24 C HETATM15800 O1 DIO B2001 -83.906 6.367 -21.897 1.00159.06 O HETATM15801 O1' DIO B2001 -82.998 4.904 -19.724 1.00158.74 O HETATM15802 C1 DIO B2002 -124.842 1.887 -31.598 1.00 57.16 C HETATM15803 C2 DIO B2002 -126.914 2.531 -32.654 1.00 55.26 C HETATM15804 C1' DIO B2002 -125.064 2.955 -30.523 1.00 58.14 C HETATM15805 C2' DIO B2002 -127.076 3.668 -31.662 1.00 56.90 C HETATM15806 O1 DIO B2002 -125.525 2.261 -32.802 1.00 56.33 O HETATM15807 O1' DIO B2002 -125.828 4.040 -31.059 1.00 58.98 O HETATM15808 ZN ZN C 42 -103.617 34.210 17.094 1.00 2.00 ZN HETATM15809 O HOH A 1 -126.450 34.108 21.220 1.00 28.31 O HETATM15810 O HOH A 4 -73.805 44.103 17.580 1.00 47.21 O HETATM15811 O HOH A 5 -101.228 81.094 22.244 1.00 38.44 O HETATM15812 O HOH A 7 -75.144 36.853 8.267 1.00 36.90 O HETATM15813 O HOH A 8 -119.670 53.781 26.136 1.00 32.44 O HETATM15814 O HOH A 9 -73.591 55.254 12.449 1.00 37.79 O HETATM15815 O HOH A 11 -98.460 66.265 -16.875 1.00 47.30 O HETATM15816 O HOH A 14 -88.884 63.734 16.165 1.00 43.76 O HETATM15817 O HOH A 15 -104.719 65.852 17.304 1.00 39.33 O HETATM15818 O HOH A 16 -114.294 63.766 6.281 1.00 50.41 O HETATM15819 O HOH A 17 -74.892 60.674 19.300 1.00 37.79 O HETATM15820 O HOH A 20 -134.223 52.557 7.086 1.00 57.70 O HETATM15821 O HOH A 21 -110.258 18.317 29.040 1.00 39.88 O HETATM15822 O HOH A 22 -90.735 69.480 34.989 1.00 44.06 O HETATM15823 O HOH A 23 -106.176 61.647 3.936 1.00 30.36 O HETATM15824 O HOH A 27 -94.492 42.930 -22.219 1.00 45.72 O HETATM15825 O HOH A 28 -134.909 64.223 19.975 1.00 33.92 O HETATM15826 O HOH A 29 -99.706 36.811 25.007 1.00 25.99 O HETATM15827 O HOH A1020 -95.968 57.734 31.100 1.00 32.00 O HETATM15828 O HOH A1021 -107.671 49.836 32.518 1.00 36.79 O HETATM15829 O HOH A1022 -110.491 14.473 10.273 1.00 50.18 O HETATM15830 O HOH A1023 -103.573 31.546 35.595 1.00 37.20 O HETATM15831 O HOH A1024 -113.836 50.996 6.426 1.00 45.42 O HETATM15832 O HOH A1025 -89.343 48.956 5.150 1.00 42.65 O HETATM15833 O HOH A1026 -124.673 20.756 24.855 1.00 66.72 O HETATM15834 O HOH A1027 -134.112 45.302 5.605 1.00 47.30 O HETATM15835 O HOH A1028 -137.173 55.934 19.470 1.00 42.91 O HETATM15836 O HOH A1029 -93.508 63.072 23.510 1.00 43.33 O HETATM15837 O HOH A1030 -129.312 70.947 6.744 1.00 43.22 O HETATM15838 O HOH A1031 -118.581 70.804 11.246 1.00 41.22 O HETATM15839 O HOH A1032 -102.241 80.244 -9.818 1.00 43.34 O HETATM15840 O HOH A1033 -107.670 69.767 28.049 1.00 37.42 O HETATM15841 O HOH A1034 -108.700 66.219 20.440 1.00 44.57 O HETATM15842 O HOH A1035 -139.528 27.190 8.150 1.00 47.39 O HETATM15843 O HOH A1036 -118.289 57.390 49.185 1.00 54.01 O HETATM15844 O HOH A1037 -112.179 73.247 -11.308 1.00 47.86 O HETATM15845 O HOH A1038 -73.998 49.694 -10.105 1.00 47.95 O HETATM15846 O HOH A1039 -81.545 84.416 10.646 1.00 46.97 O HETATM15847 O HOH A1040 -132.141 47.152 2.823 1.00 39.23 O HETATM15848 O HOH A1041 -89.511 56.283 14.383 1.00 48.95 O HETATM15849 O HOH A1042 -106.976 27.010 -4.592 1.00 44.24 O HETATM15850 O HOH A1043 -125.266 72.825 20.133 1.00 42.30 O HETATM15851 O HOH A1044 -86.945 79.988 32.126 1.00 47.83 O HETATM15852 O HOH A1045 -121.159 69.102 26.479 1.00 36.16 O HETATM15853 O HOH A1046 -73.090 46.521 11.912 1.00 43.27 O HETATM15854 O HOH A1047 -116.242 31.717 26.163 1.00 45.49 O HETATM15855 O HOH A1048 -76.500 58.697 9.762 1.00 42.69 O HETATM15856 O HOH A1049 -93.857 67.324 37.028 1.00 45.09 O HETATM15857 O HOH A1050 -92.278 37.137 17.994 1.00 34.25 O HETATM15858 O HOH A1051 -107.733 20.347 -0.984 1.00 41.73 O HETATM15859 O HOH A1052 -81.901 34.270 21.939 1.00 54.05 O HETATM15860 O HOH A1053 -107.137 21.644 10.361 1.00 37.50 O HETATM15861 O HOH A1054 -119.678 47.433 1.876 1.00 42.74 O HETATM15862 O HOH A1055 -92.921 17.780 24.807 1.00 43.99 O HETATM15863 O HOH A1056 -106.761 45.274 -2.448 1.00 44.68 O HETATM15864 O HOH A1057 -80.653 77.207 19.253 1.00 50.52 O HETATM15865 O HOH A1058 -73.025 38.580 20.519 1.00 57.86 O HETATM15866 O HOH A1059 -73.195 38.574 -11.692 1.00 58.12 O HETATM15867 O HOH A1060 -125.275 72.590 43.248 1.00 55.40 O HETATM15868 O HOH A1061 -95.220 28.964 33.939 1.00 49.51 O HETATM15869 O HOH A1062 -135.492 56.085 6.640 1.00 51.77 O HETATM15870 O HOH A1063 -66.386 57.458 3.444 1.00 51.34 O HETATM15871 O HOH A1064 -130.594 26.120 24.374 1.00 50.02 O HETATM15872 O HOH A1065 -116.056 69.667 30.873 1.00 34.70 O HETATM15873 O HOH A1066 -84.788 26.009 -15.808 1.00 49.68 O HETATM15874 O HOH A1067 -128.631 27.711 25.905 1.00 61.47 O HETATM15875 O HOH B 2 -106.744 -32.386 -37.270 1.00 36.55 O HETATM15876 O HOH B 3 -125.506 13.109 -1.635 1.00 43.78 O HETATM15877 O HOH B 6 -86.477 28.266 -25.426 1.00 46.89 O HETATM15878 O HOH B 12 -83.233 -19.575 -6.120 1.00 47.02 O HETATM15879 O HOH B 13 -112.181 -15.721 -19.878 1.00 39.34 O HETATM15880 O HOH B 18 -69.592 -19.607 -31.986 1.00 42.84 O HETATM15881 O HOH B 19 -116.914 -10.890 1.711 1.00 51.00 O HETATM15882 O HOH B 24 -109.839 14.294 -61.790 1.00 52.42 O HETATM15883 O HOH B 25 -104.285 -10.433 10.958 1.00 51.43 O HETATM15884 O HOH B 26 -124.485 -1.255 -2.945 1.00 46.89 O HETATM15885 O HOH B1020 -94.731 -6.259 -13.374 1.00 21.67 O HETATM15886 O HOH B1021 -98.169 30.246 -40.589 1.00 45.84 O HETATM15887 O HOH B1022 -91.817 -10.509 -39.507 1.00 43.04 O HETATM15888 O HOH B1023 -144.834 7.842 -29.686 1.00 50.53 O HETATM15889 O HOH B1024 -103.550 9.788 -10.053 1.00 49.77 O HETATM15890 O HOH B1025 -122.706 -9.242 -21.736 1.00 40.30 O HETATM15891 O HOH B1026 -118.719 6.449 -47.064 1.00 40.02 O HETATM15892 O HOH B1027 -102.169 22.106 -56.406 1.00 41.26 O HETATM15893 O HOH B1028 -75.698 2.565 -41.775 1.00 42.12 O HETATM15894 O HOH B1029 -112.365 -29.918 -39.303 1.00 47.52 O HETATM15895 O HOH B1030 -122.975 20.032 -32.671 1.00 43.70 O HETATM15896 O HOH B1031 -105.098 4.113 -61.319 1.00 49.49 O HETATM15897 O HOH B1032 -107.193 -7.992 -11.833 1.00 33.03 O HETATM15898 O HOH B1033 -116.401 -22.861 -27.039 1.00 49.53 O HETATM15899 O HOH B1034 -125.487 -12.742 -16.164 1.00 57.31 O HETATM15900 O HOH B1035 -114.637 1.250 -66.809 1.00 45.17 O HETATM15901 O HOH B1036 -108.288 23.711 -28.037 1.00 45.80 O HETATM15902 O HOH B1037 -116.408 24.121 -35.153 1.00 50.60 O HETATM15903 O HOH B1038 -125.990 -8.532 -7.769 1.00 35.97 O HETATM15904 O HOH B1039 -86.062 16.127 -8.304 1.00 44.76 O HETATM15905 O HOH B1040 -116.130 -31.906 -23.745 1.00 56.82 O HETATM15906 O HOH B1041 -109.672 10.286 -61.624 1.00 51.33 O HETATM15907 O HOH B1042 -136.457 15.446 -29.173 1.00 38.26 O HETATM15908 O HOH B1043 -120.167 -0.618 -8.080 1.00 46.15 O HETATM15909 O HOH B1044 -142.330 13.719 -30.980 1.00 57.02 O HETATM15910 O HOH B1045 -121.049 5.440 -46.128 1.00 46.02 O HETATM15911 O HOH B1046 -104.429 22.710 -54.240 1.00 45.73 O HETATM15912 O HOH B1047 -82.746 -28.017 -18.024 1.00 49.86 O HETATM15913 O HOH B1048 -103.920 22.568 -36.420 1.00 46.62 O HETATM15914 O HOH B1049 -122.033 -30.963 -7.797 1.00 35.03 O HETATM15915 O HOH B1050 -113.769 0.162 -13.596 1.00 40.64 O HETATM15916 O HOH B1051 -125.553 -8.401 -36.782 1.00 33.86 O HETATM15917 O HOH B1052 -115.248 -8.106 -29.354 1.00 48.18 O HETATM15918 O HOH B1053 -123.156 -1.992 -60.799 1.00 58.48 O HETATM15919 O HOH B1054 -98.692 16.014 1.042 1.00 45.93 O HETATM15920 O HOH B1055 -101.108 -19.184 -15.798 1.00 40.72 O HETATM15921 O HOH B1056 -95.413 -19.798 -63.029 1.00 52.61 O HETATM15922 O HOH B1057 -96.384 3.905 -29.952 1.00 49.56 O HETATM15923 O HOH B1058 -75.826 -22.840 -24.636 1.00 46.83 O HETATM15924 O HOH B1059 -135.003 13.159 -15.673 1.00 57.06 O HETATM15925 O HOH B1060 -87.628 34.694 -37.878 1.00 49.79 O HETATM15926 O HOH B1061 -131.839 6.528 -37.317 1.00 36.77 O HETATM15927 O HOH B1062 -100.702 -5.362 9.722 1.00 55.58 O HETATM15928 O HOH B1063 -83.663 9.933 -0.958 1.00 54.36 O HETATM15929 O HOH B1064 -92.874 -15.917 -61.382 1.00 39.12 O HETATM15930 O HOH B1065 -109.533 4.556 -13.546 1.00 51.41 O HETATM15931 O HOH B1066 -98.358 -8.757 10.690 1.00 44.60 O HETATM15932 O HOH B1067 -83.881 -7.384 -23.587 1.00 51.43 O HETATM15933 O HOH B1068 -95.817 -5.411 -59.123 1.00 49.99 O HETATM15934 O HOH B1069 -126.009 -22.758 -12.033 1.00 45.68 O HETATM15935 O HOH B1070 -80.160 -25.500 -24.516 1.00 55.18 O HETATM15936 O HOH C 128 -116.115 55.315 23.439 1.00 70.18 O HETATM15937 O HOH D 10 -95.805 -0.808 -42.379 1.00 40.05 O HETATM15938 O HOH D 86 -101.572 -2.284 -36.204 1.00 54.60 O HETATM15939 O HOH D 93 -110.627 8.834 -18.532 1.00 47.38 O HETATM15940 O HOH D 113 -95.422 -1.306 -45.005 1.00 43.86 O HETATM15941 O HOH D 130 -105.304 4.891 -32.309 1.00 62.40 O CONECT 49615808 CONECT 53415808 CONECT 115915808 CONECT 831815789 CONECT 835615789 CONECT1574815789 CONECT157711577315775 CONECT157721577415775 CONECT157731577115776 CONECT157741577215776 CONECT157751577115772 CONECT157761577315774 CONECT157771577915781 CONECT157781578015781 CONECT157791577715782 CONECT157801577815782 CONECT157811577715778 CONECT157821577915780 CONECT157831578515787 CONECT157841578615787 CONECT157851578315788 CONECT157861578415788 CONECT157871578315784 CONECT157881578515786 CONECT15789 8318 835615748 CONECT157901579215794 CONECT157911579315794 CONECT157921579015795 CONECT157931579115795 CONECT157941579015791 CONECT157951579215793 CONECT157961579815800 CONECT157971579915800 CONECT157981579615801 CONECT157991579715801 CONECT158001579615797 CONECT158011579815799 CONECT158021580415806 CONECT158031580515806 CONECT158041580215807 CONECT158051580315807 CONECT158061580215803 CONECT158071580415805 CONECT15808 496 534 1159 MASTER 674 0 8 90 52 0 13 615937 4 44 166 END