>>3MGR:HELIX   20  20 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 20 GLN E 85 ALA E 114 1 30 ATOM 3458 N GLN E 85 5.521 -31.298 38.114 1.00 32.70 N ATOM 3459 CA GLN E 85 6.345 -30.086 38.070 1.00 32.63 C ATOM 3460 C GLN E 85 6.438 -29.633 39.486 1.00 32.27 C ATOM 3461 O GLN E 85 5.481 -29.776 40.247 1.00 33.16 O ATOM 3462 CB GLN E 85 5.690 -28.975 37.254 1.00 32.17 C ATOM 3463 CG GLN E 85 5.581 -29.284 35.796 1.00 33.41 C ATOM 3464 CD GLN E 85 5.018 -28.127 35.022 1.00 36.04 C ATOM 3465 OE1 GLN E 85 4.270 -27.297 35.563 1.00 35.17 O ATOM 3466 NE2 GLN E 85 5.363 -28.061 33.735 1.00 36.62 N ATOM 3467 N SER E 86 7.578 -29.103 39.873 1.00 31.79 N ATOM 3468 CA SER E 86 7.761 -28.833 41.283 1.00 31.42 C ATOM 3469 C SER E 86 6.825 -27.707 41.745 1.00 31.50 C ATOM 3470 O SER E 86 6.431 -27.690 42.898 1.00 32.65 O ATOM 3471 CB SER E 86 9.231 -28.576 41.602 1.00 30.71 C ATOM 3472 OG SER E 86 9.669 -27.404 40.955 1.00 32.51 O ATOM 3473 N SER E 87 6.443 -26.807 40.833 1.00 30.42 N ATOM 3474 CA SER E 87 5.512 -25.723 41.128 1.00 29.74 C ATOM 3475 C SER E 87 4.081 -26.232 41.239 1.00 29.57 C ATOM 3476 O SER E 87 3.218 -25.522 41.761 1.00 30.23 O ATOM 3477 CB SER E 87 5.565 -24.650 40.042 1.00 29.67 C ATOM 3478 OG SER E 87 5.275 -25.242 38.773 1.00 33.01 O ATOM 3479 N ALA E 88 3.819 -27.435 40.720 1.00 28.71 N ATOM 3480 CA ALA E 88 2.527 -28.089 40.883 1.00 28.01 C ATOM 3481 C ALA E 88 2.385 -28.562 42.327 1.00 27.75 C ATOM 3482 O ALA E 88 1.314 -28.471 42.922 1.00 28.11 O ATOM 3483 CB ALA E 88 2.369 -29.253 39.921 1.00 27.73 C ATOM 3484 N VAL E 89 3.483 -29.043 42.897 1.00 27.24 N ATOM 3485 CA VAL E 89 3.479 -29.457 44.291 1.00 26.16 C ATOM 3486 C VAL E 89 3.321 -28.280 45.219 1.00 25.91 C ATOM 3487 O VAL E 89 2.611 -28.378 46.203 1.00 25.59 O ATOM 3488 CB VAL E 89 4.740 -30.293 44.670 1.00 25.89 C ATOM 3489 CG1 VAL E 89 4.707 -30.696 46.136 1.00 22.94 C ATOM 3490 CG2 VAL E 89 4.788 -31.514 43.810 1.00 23.13 C ATOM 3491 N MET E 90 3.972 -27.174 44.889 1.00 26.74 N ATOM 3492 CA MET E 90 3.895 -25.950 45.689 1.00 27.90 C ATOM 3493 C MET E 90 2.518 -25.309 45.630 1.00 27.13 C ATOM 3494 O MET E 90 2.029 -24.809 46.652 1.00 27.39 O ATOM 3495 CB MET E 90 4.974 -24.946 45.271 1.00 28.81 C ATOM 3496 CG MET E 90 6.398 -25.409 45.520 1.00 34.47 C ATOM 3497 SD MET E 90 6.640 -26.075 47.216 1.00 47.20 S ATOM 3498 CE MET E 90 6.606 -24.560 48.177 1.00 45.04 C ATOM 3499 N ALA E 91 1.894 -25.334 44.444 1.00 26.45 N ATOM 3500 CA ALA E 91 0.503 -24.872 44.278 1.00 25.58 C ATOM 3501 C ALA E 91 -0.466 -25.640 45.178 1.00 25.39 C ATOM 3502 O ALA E 91 -1.354 -25.053 45.777 1.00 25.58 O ATOM 3503 CB ALA E 91 0.060 -24.947 42.817 1.00 24.13 C ATOM 3504 N LEU E 92 -0.309 -26.958 45.241 1.00 25.26 N ATOM 3505 CA LEU E 92 -1.111 -27.807 46.134 1.00 24.75 C ATOM 3506 C LEU E 92 -0.874 -27.490 47.612 1.00 25.31 C ATOM 3507 O LEU E 92 -1.824 -27.552 48.432 1.00 27.06 O ATOM 3508 CB LEU E 92 -0.779 -29.291 45.893 1.00 24.00 C ATOM 3509 CG LEU E 92 -1.266 -29.884 44.565 1.00 23.17 C ATOM 3510 CD1 LEU E 92 -0.430 -31.081 44.185 1.00 24.28 C ATOM 3511 CD2 LEU E 92 -2.722 -30.241 44.586 1.00 20.85 C ATOM 3512 N GLN E 93 0.381 -27.225 47.966 1.00 23.54 N ATOM 3513 CA GLN E 93 0.714 -26.864 49.333 1.00 24.16 C ATOM 3514 C GLN E 93 0.164 -25.529 49.783 1.00 24.65 C ATOM 3515 O GLN E 93 -0.360 -25.441 50.902 1.00 26.55 O ATOM 3516 CB GLN E 93 2.222 -26.915 49.622 1.00 23.23 C ATOM 3517 CG GLN E 93 2.455 -27.085 51.147 1.00 23.38 C ATOM 3518 CD GLN E 93 3.893 -27.370 51.523 1.00 24.51 C ATOM 3519 OE1 GLN E 93 4.725 -27.730 50.678 1.00 23.08 O ATOM 3520 NE2 GLN E 93 4.201 -27.207 52.798 1.00 24.97 N ATOM 3521 N GLU E 94 0.321 -24.498 48.949 1.00 24.30 N ATOM 3522 CA GLU E 94 -0.241 -23.180 49.205 1.00 24.40 C ATOM 3523 C GLU E 94 -1.735 -23.234 49.348 1.00 23.91 C ATOM 3524 O GLU E 94 -2.289 -22.619 50.256 1.00 25.20 O ATOM 3525 CB GLU E 94 0.093 -22.207 48.069 1.00 24.85 C ATOM 3526 CG GLU E 94 1.542 -21.825 47.966 1.00 26.02 C ATOM 3527 CD GLU E 94 1.963 -20.757 48.945 1.00 27.44 C ATOM 3528 OE1 GLU E 94 1.105 -19.993 49.437 1.00 28.37 O ATOM 3529 OE2 GLU E 94 3.189 -20.660 49.194 1.00 30.08 O ATOM 3530 N ALA E 95 -2.393 -23.952 48.443 1.00 22.91 N ATOM 3531 CA ALA E 95 -3.843 -24.137 48.517 1.00 22.20 C ATOM 3532 C ALA E 95 -4.256 -24.915 49.750 1.00 22.40 C ATOM 3533 O ALA E 95 -5.234 -24.564 50.384 1.00 23.61 O ATOM 3534 CB ALA E 95 -4.366 -24.811 47.261 1.00 20.88 C ATOM 3535 N SER E 96 -3.523 -25.981 50.082 1.00 22.84 N ATOM 3536 CA SER E 96 -3.887 -26.869 51.200 1.00 22.59 C ATOM 3537 C SER E 96 -3.754 -26.173 52.516 1.00 21.97 C ATOM 3538 O SER E 96 -4.570 -26.399 53.406 1.00 21.92 O ATOM 3539 CB SER E 96 -3.007 -28.134 51.243 1.00 22.24 C ATOM 3540 OG SER E 96 -3.244 -28.962 50.118 1.00 23.99 O ATOM 3541 N GLU E 97 -2.688 -25.379 52.646 1.00 22.45 N ATOM 3542 CA GLU E 97 -2.442 -24.575 53.856 1.00 22.94 C ATOM 3543 C GLU E 97 -3.426 -23.431 54.053 1.00 23.12 C ATOM 3544 O GLU E 97 -3.874 -23.243 55.180 1.00 24.90 O ATOM 3545 CB GLU E 97 -0.979 -24.108 53.957 1.00 22.99 C ATOM 3546 CG GLU E 97 0.010 -25.318 54.077 1.00 23.18 C ATOM 3547 CD GLU E 97 1.335 -24.976 54.716 1.00 25.76 C ATOM 3548 OE1 GLU E 97 1.463 -23.937 55.393 1.00 26.69 O ATOM 3549 OE2 GLU E 97 2.283 -25.767 54.548 1.00 30.17 O ATOM 3550 N ALA E 98 -3.790 -22.695 52.994 1.00 21.90 N ATOM 3551 CA ALA E 98 -4.837 -21.682 53.113 1.00 21.74 C ATOM 3552 C ALA E 98 -6.187 -22.284 53.386 1.00 21.82 C ATOM 3553 O ALA E 98 -6.995 -21.671 54.055 1.00 22.03 O ATOM 3554 CB ALA E 98 -4.937 -20.807 51.870 1.00 21.98 C ATOM 3555 N TYR E 99 -6.473 -23.455 52.818 1.00 21.91 N ATOM 3556 CA TYR E 99 -7.683 -24.157 53.175 1.00 21.38 C ATOM 3557 C TYR E 99 -7.676 -24.523 54.696 1.00 22.14 C ATOM 3558 O TYR E 99 -8.646 -24.272 55.404 1.00 22.73 O ATOM 3559 CB TYR E 99 -7.851 -25.415 52.307 1.00 20.99 C ATOM 3560 CG TYR E 99 -8.979 -26.298 52.804 1.00 21.90 C ATOM 3561 CD1 TYR E 99 -10.328 -26.003 52.510 1.00 19.91 C ATOM 3562 CD2 TYR E 99 -8.704 -27.405 53.600 1.00 20.92 C ATOM 3563 CE1 TYR E 99 -11.358 -26.805 53.017 1.00 21.70 C ATOM 3564 CE2 TYR E 99 -9.703 -28.208 54.080 1.00 22.76 C ATOM 3565 CZ TYR E 99 -11.023 -27.916 53.814 1.00 20.53 C ATOM 3566 OH TYR E 99 -11.971 -28.773 54.322 1.00 20.86 O ATOM 3567 N LEU E 100 -6.585 -25.099 55.195 1.00 21.83 N ATOM 3568 CA LEU E 100 -6.561 -25.557 56.594 1.00 22.51 C ATOM 3569 C LEU E 100 -6.581 -24.390 57.596 1.00 22.32 C ATOM 3570 O LEU E 100 -7.275 -24.447 58.597 1.00 22.84 O ATOM 3571 CB LEU E 100 -5.378 -26.516 56.858 1.00 22.08 C ATOM 3572 CG LEU E 100 -5.421 -27.958 56.267 1.00 22.73 C ATOM 3573 CD1 LEU E 100 -4.163 -28.765 56.603 1.00 21.75 C ATOM 3574 CD2 LEU E 100 -6.650 -28.743 56.742 1.00 20.79 C ATOM 3575 N VAL E 101 -5.829 -23.333 57.315 1.00 22.00 N ATOM 3576 CA VAL E 101 -5.844 -22.115 58.144 1.00 21.98 C ATOM 3577 C VAL E 101 -7.267 -21.530 58.284 1.00 21.69 C ATOM 3578 O VAL E 101 -7.759 -21.346 59.403 1.00 21.50 O ATOM 3579 CB VAL E 101 -4.847 -21.062 57.609 1.00 21.70 C ATOM 3580 CG1 VAL E 101 -4.990 -19.732 58.324 1.00 21.79 C ATOM 3581 CG2 VAL E 101 -3.423 -21.586 57.763 1.00 24.19 C ATOM 3582 N ALA E 102 -7.920 -21.281 57.150 1.00 20.85 N ATOM 3583 CA ALA E 102 -9.280 -20.771 57.128 1.00 21.86 C ATOM 3584 C ALA E 102 -10.311 -21.705 57.775 1.00 22.20 C ATOM 3585 O ALA E 102 -11.314 -21.244 58.303 1.00 24.53 O ATOM 3586 CB ALA E 102 -9.698 -20.379 55.681 1.00 20.40 C ATOM 3587 N LEU E 103 -10.075 -23.003 57.741 1.00 21.85 N ATOM 3588 CA LEU E 103 -10.954 -23.953 58.420 1.00 21.64 C ATOM 3589 C LEU E 103 -10.773 -23.899 59.934 1.00 22.14 C ATOM 3590 O LEU E 103 -11.753 -23.877 60.679 1.00 22.74 O ATOM 3591 CB LEU E 103 -10.752 -25.373 57.861 1.00 20.97 C ATOM 3592 CG LEU E 103 -11.512 -26.524 58.506 1.00 21.31 C ATOM 3593 CD1 LEU E 103 -13.006 -26.400 58.312 1.00 22.61 C ATOM 3594 CD2 LEU E 103 -11.004 -27.822 57.936 1.00 21.00 C ATOM 3595 N PHE E 104 -9.528 -23.838 60.398 1.00 22.88 N ATOM 3596 CA PHE E 104 -9.258 -23.563 61.826 1.00 23.62 C ATOM 3597 C PHE E 104 -9.915 -22.305 62.388 1.00 24.48 C ATOM 3598 O PHE E 104 -10.369 -22.311 63.553 1.00 25.42 O ATOM 3599 CB PHE E 104 -7.765 -23.572 62.130 1.00 22.88 C ATOM 3600 CG PHE E 104 -7.162 -24.940 62.109 1.00 21.77 C ATOM 3601 CD1 PHE E 104 -6.091 -25.246 61.271 1.00 23.02 C ATOM 3602 CD2 PHE E 104 -7.674 -25.936 62.918 1.00 21.51 C ATOM 3603 CE1 PHE E 104 -5.528 -26.558 61.261 1.00 20.85 C ATOM 3604 CE2 PHE E 104 -7.134 -27.235 62.918 1.00 21.25 C ATOM 3605 CZ PHE E 104 -6.052 -27.540 62.084 1.00 22.41 C ATOM 3606 N GLU E 105 -9.977 -21.237 61.583 1.00 24.81 N ATOM 3607 CA GLU E 105 -10.680 -20.003 61.986 1.00 25.06 C ATOM 3608 C GLU E 105 -12.130 -20.316 62.231 1.00 25.07 C ATOM 3609 O GLU E 105 -12.636 -19.998 63.294 1.00 25.13 O ATOM 3610 CB GLU E 105 -10.591 -18.888 60.938 1.00 23.85 C ATOM 3611 CG GLU E 105 -9.197 -18.514 60.567 1.00 26.28 C ATOM 3612 CD GLU E 105 -9.159 -17.554 59.379 1.00 30.61 C ATOM 3613 OE1 GLU E 105 -10.235 -17.294 58.788 1.00 32.30 O ATOM 3614 OE2 GLU E 105 -8.059 -17.067 59.037 1.00 31.47 O ATOM 3615 N ASP E 106 -12.801 -20.954 61.257 1.00 25.59 N ATOM 3616 CA ASP E 106 -14.230 -21.355 61.441 1.00 24.60 C ATOM 3617 C ASP E 106 -14.416 -22.280 62.641 1.00 24.35 C ATOM 3618 O ASP E 106 -15.337 -22.121 63.430 1.00 25.19 O ATOM 3619 CB ASP E 106 -14.770 -22.006 60.181 1.00 24.48 C ATOM 3620 CG ASP E 106 -14.873 -21.036 59.023 1.00 24.16 C ATOM 3621 OD1 ASP E 106 -14.765 -19.816 59.244 1.00 25.25 O ATOM 3622 OD2 ASP E 106 -15.082 -21.490 57.885 1.00 26.41 O ATOM 3623 N THR E 107 -13.508 -23.240 62.775 1.00 24.56 N ATOM 3624 CA THR E 107 -13.466 -24.200 63.905 1.00 23.46 C ATOM 3625 C THR E 107 -13.368 -23.473 65.238 1.00 23.75 C ATOM 3626 O THR E 107 -14.080 -23.787 66.174 1.00 23.96 O ATOM 3627 CB THR E 107 -12.260 -25.158 63.709 1.00 23.23 C ATOM 3628 OG1 THR E 107 -12.428 -25.863 62.467 1.00 23.67 O ATOM 3629 CG2 THR E 107 -12.105 -26.155 64.845 1.00 21.65 C ATOM 3630 N ASN E 108 -12.469 -22.495 65.310 1.00 24.47 N ATOM 3631 CA ASN E 108 -12.285 -21.669 66.477 1.00 24.79 C ATOM 3632 C ASN E 108 -13.549 -20.921 66.862 1.00 25.88 C ATOM 3633 O ASN E 108 -13.913 -20.814 68.040 1.00 26.34 O ATOM 3634 CB ASN E 108 -11.167 -20.663 66.205 1.00 24.89 C ATOM 3635 CG ASN E 108 -10.450 -20.240 67.467 1.00 25.71 C ATOM 3636 OD1 ASN E 108 -10.506 -20.933 68.473 1.00 27.86 O ATOM 3637 ND2 ASN E 108 -9.787 -19.099 67.425 1.00 24.23 N ATOM 3638 N LEU E 109 -14.208 -20.372 65.856 1.00 26.63 N ATOM 3639 CA LEU E 109 -15.469 -19.678 66.038 1.00 26.82 C ATOM 3640 C LEU E 109 -16.542 -20.625 66.598 1.00 26.66 C ATOM 3641 O LEU E 109 -17.400 -20.232 67.378 1.00 26.69 O ATOM 3642 CB LEU E 109 -15.901 -19.120 64.688 1.00 26.38 C ATOM 3643 CG LEU E 109 -15.863 -17.616 64.486 1.00 27.43 C ATOM 3644 CD1 LEU E 109 -15.104 -16.839 65.592 1.00 26.94 C ATOM 3645 CD2 LEU E 109 -15.365 -17.295 63.101 1.00 26.72 C ATOM 3646 N CYS E 110 -16.486 -21.872 66.158 1.00 26.90 N ATOM 3647 CA CYS E 110 -17.366 -22.932 66.643 1.00 26.67 C ATOM 3648 C CYS E 110 -17.082 -23.351 68.105 1.00 26.86 C ATOM 3649 O CYS E 110 -18.013 -23.622 68.841 1.00 26.98 O ATOM 3650 CB CYS E 110 -17.291 -24.133 65.691 1.00 26.01 C ATOM 3651 SG CYS E 110 -18.237 -23.890 64.167 1.00 26.96 S ATOM 3652 N ALA E 111 -15.807 -23.431 68.500 1.00 27.00 N ATOM 3653 CA ALA E 111 -15.432 -23.706 69.900 1.00 27.61 C ATOM 3654 C ALA E 111 -15.944 -22.602 70.807 1.00 27.76 C ATOM 3655 O ALA E 111 -16.592 -22.867 71.802 1.00 28.57 O ATOM 3656 CB ALA E 111 -13.913 -23.855 70.059 1.00 26.38 C ATOM 3657 N ILE E 112 -15.657 -21.362 70.433 1.00 29.27 N ATOM 3658 CA ILE E 112 -16.028 -20.164 71.190 1.00 29.69 C ATOM 3659 C ILE E 112 -17.528 -20.058 71.350 1.00 30.49 C ATOM 3660 O ILE E 112 -18.015 -19.659 72.409 1.00 31.59 O ATOM 3661 CB ILE E 112 -15.463 -18.896 70.536 1.00 29.17 C ATOM 3662 CG1 ILE E 112 -13.945 -18.899 70.642 1.00 30.14 C ATOM 3663 CG2 ILE E 112 -16.000 -17.620 71.190 1.00 28.71 C ATOM 3664 CD1 ILE E 112 -13.283 -17.801 69.847 1.00 28.10 C ATOM 3665 N HIS E 113 -18.260 -20.438 70.312 1.00 31.24 N ATOM 3666 CA HIS E 113 -19.726 -20.490 70.375 1.00 31.37 C ATOM 3667 C HIS E 113 -20.210 -21.394 71.508 1.00 32.23 C ATOM 3668 O HIS E 113 -21.222 -21.111 72.157 1.00 33.09 O ATOM 3669 CB HIS E 113 -20.289 -20.991 69.046 1.00 29.75 C ATOM 3670 CG HIS E 113 -21.771 -20.845 68.922 1.00 28.76 C ATOM 3671 ND1 HIS E 113 -22.398 -19.616 68.862 1.00 27.96 N ATOM 3672 CD2 HIS E 113 -22.752 -21.774 68.820 1.00 26.79 C ATOM 3673 CE1 HIS E 113 -23.702 -19.797 68.729 1.00 26.98 C ATOM 3674 NE2 HIS E 113 -23.942 -21.098 68.710 1.00 27.35 N ATOM 3675 N ALA E 114 -19.485 -22.489 71.717 1.00 33.15 N ATOM 3676 CA ALA E 114 -19.806 -23.483 72.723 1.00 33.92 C ATOM 3677 C ALA E 114 -19.227 -23.093 74.092 1.00 35.01 C ATOM 3678 O ALA E 114 -19.274 -23.874 75.049 1.00 34.75 O ATOM 3679 CB ALA E 114 -19.281 -24.830 72.272 1.00 33.28 C