>>3MGR:HELIX   15  15 SER D   52  ASN D   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 15 SER D 52 ASN D 81 1 30 ATOM 2492 N SER D 52 7.958 -7.395 43.422 1.00 30.85 N ATOM 2493 CA SER D 52 8.679 -8.642 43.266 1.00 31.47 C ATOM 2494 C SER D 52 8.057 -9.462 42.146 1.00 32.50 C ATOM 2495 O SER D 52 6.895 -9.229 41.772 1.00 33.26 O ATOM 2496 CB SER D 52 8.670 -9.429 44.579 1.00 30.56 C ATOM 2497 OG SER D 52 7.458 -10.142 44.708 1.00 30.92 O ATOM 2498 N SER D 53 8.801 -10.425 41.601 1.00 32.42 N ATOM 2499 CA SER D 53 8.254 -11.190 40.492 1.00 33.29 C ATOM 2500 C SER D 53 7.113 -12.092 40.929 1.00 33.60 C ATOM 2501 O SER D 53 6.196 -12.376 40.125 1.00 33.75 O ATOM 2502 CB SER D 53 9.318 -11.983 39.748 1.00 33.34 C ATOM 2503 OG SER D 53 10.104 -12.692 40.661 1.00 36.32 O ATOM 2504 N LYS D 54 7.159 -12.543 42.185 1.00 33.32 N ATOM 2505 CA LYS D 54 6.053 -13.313 42.753 1.00 33.69 C ATOM 2506 C LYS D 54 4.820 -12.427 42.911 1.00 32.53 C ATOM 2507 O LYS D 54 3.719 -12.856 42.624 1.00 33.26 O ATOM 2508 CB LYS D 54 6.445 -13.917 44.102 1.00 34.01 C ATOM 2509 CG LYS D 54 7.160 -15.251 44.023 1.00 35.39 C ATOM 2510 CD LYS D 54 7.511 -15.786 45.432 1.00 36.77 C ATOM 2511 CE LYS D 54 8.418 -17.059 45.342 1.00 39.24 C ATOM 2512 NZ LYS D 54 8.454 -17.756 46.677 1.00 43.63 N ATOM 2513 N ALA D 55 5.010 -11.175 43.342 1.00 31.59 N ATOM 2514 CA ALA D 55 3.898 -10.231 43.442 1.00 29.41 C ATOM 2515 C ALA D 55 3.317 -9.937 42.091 1.00 27.95 C ATOM 2516 O ALA D 55 2.117 -9.887 41.943 1.00 28.91 O ATOM 2517 CB ALA D 55 4.328 -8.957 44.125 1.00 29.36 C ATOM 2518 N MET D 56 4.164 -9.750 41.096 1.00 27.59 N ATOM 2519 CA MET D 56 3.721 -9.505 39.718 1.00 27.50 C ATOM 2520 C MET D 56 2.942 -10.693 39.143 1.00 27.61 C ATOM 2521 O MET D 56 2.007 -10.505 38.375 1.00 28.74 O ATOM 2522 CB MET D 56 4.910 -9.136 38.805 1.00 27.54 C ATOM 2523 CG MET D 56 4.561 -8.843 37.358 1.00 26.90 C ATOM 2524 SD MET D 56 3.530 -7.349 37.200 1.00 32.41 S ATOM 2525 CE MET D 56 4.845 -6.106 37.014 1.00 29.10 C ATOM 2526 N SER D 57 3.308 -11.897 39.543 1.00 27.41 N ATOM 2527 CA SER D 57 2.582 -13.095 39.165 1.00 27.98 C ATOM 2528 C SER D 57 1.141 -13.135 39.743 1.00 28.07 C ATOM 2529 O SER D 57 0.197 -13.392 38.997 1.00 28.03 O ATOM 2530 CB SER D 57 3.394 -14.334 39.544 1.00 28.22 C ATOM 2531 OG SER D 57 2.794 -15.486 38.990 1.00 30.79 O ATOM 2532 N ILE D 58 0.966 -12.852 41.042 1.00 27.13 N ATOM 2533 CA ILE D 58 -0.389 -12.519 41.585 1.00 26.26 C ATOM 2534 C ILE D 58 -1.164 -11.444 40.766 1.00 25.84 C ATOM 2535 O ILE D 58 -2.357 -11.609 40.465 1.00 26.11 O ATOM 2536 CB ILE D 58 -0.342 -12.017 43.049 1.00 26.47 C ATOM 2537 CG1 ILE D 58 0.529 -12.906 43.960 1.00 26.27 C ATOM 2538 CG2 ILE D 58 -1.772 -11.683 43.565 1.00 26.35 C ATOM 2539 CD1 ILE D 58 0.138 -14.311 44.014 1.00 24.67 C ATOM 2540 N MET D 59 -0.499 -10.348 40.410 1.00 25.67 N ATOM 2541 CA MET D 59 -1.161 -9.275 39.627 1.00 25.64 C ATOM 2542 C MET D 59 -1.632 -9.728 38.255 1.00 24.68 C ATOM 2543 O MET D 59 -2.707 -9.341 37.771 1.00 24.30 O ATOM 2544 CB MET D 59 -0.260 -8.053 39.480 1.00 25.74 C ATOM 2545 CG MET D 59 -0.068 -7.250 40.771 1.00 27.79 C ATOM 2546 SD MET D 59 -1.641 -6.771 41.487 1.00 31.12 S ATOM 2547 CE MET D 59 -2.329 -5.715 40.215 1.00 27.72 C ATOM 2548 N ASN D 60 -0.810 -10.547 37.637 1.00 24.78 N ATOM 2549 CA ASN D 60 -1.130 -11.127 36.340 1.00 25.79 C ATOM 2550 C ASN D 60 -2.308 -12.105 36.365 1.00 25.20 C ATOM 2551 O ASN D 60 -3.163 -12.082 35.467 1.00 25.92 O ATOM 2552 CB ASN D 60 0.113 -11.766 35.712 1.00 25.80 C ATOM 2553 CG ASN D 60 -0.110 -12.098 34.232 1.00 29.20 C ATOM 2554 OD1 ASN D 60 -0.563 -11.248 33.453 1.00 32.91 O ATOM 2555 ND2 ASN D 60 0.156 -13.344 33.856 1.00 28.37 N ATOM 2556 N SER D 61 -2.328 -12.985 37.371 1.00 25.55 N ATOM 2557 CA SER D 61 -3.504 -13.834 37.690 1.00 25.39 C ATOM 2558 C SER D 61 -4.751 -12.981 37.986 1.00 25.72 C ATOM 2559 O SER D 61 -5.862 -13.362 37.612 1.00 26.89 O ATOM 2560 CB SER D 61 -3.227 -14.681 38.933 1.00 24.83 C ATOM 2561 OG SER D 61 -2.215 -15.668 38.735 1.00 24.89 O ATOM 2562 N PHE D 62 -4.571 -11.843 38.666 1.00 25.15 N ATOM 2563 CA PHE D 62 -5.686 -10.969 39.053 1.00 24.95 C ATOM 2564 C PHE D 62 -6.360 -10.381 37.826 1.00 25.29 C ATOM 2565 O PHE D 62 -7.577 -10.482 37.694 1.00 26.54 O ATOM 2566 CB PHE D 62 -5.232 -9.872 40.055 1.00 25.24 C ATOM 2567 CG PHE D 62 -6.220 -8.724 40.200 1.00 26.39 C ATOM 2568 CD1 PHE D 62 -7.456 -8.919 40.796 1.00 27.46 C ATOM 2569 CD2 PHE D 62 -5.919 -7.458 39.698 1.00 29.12 C ATOM 2570 CE1 PHE D 62 -8.374 -7.879 40.903 1.00 28.90 C ATOM 2571 CE2 PHE D 62 -6.840 -6.406 39.798 1.00 30.54 C ATOM 2572 CZ PHE D 62 -8.070 -6.627 40.403 1.00 28.38 C ATOM 2573 N VAL D 63 -5.581 -9.788 36.922 1.00 25.54 N ATOM 2574 CA VAL D 63 -6.101 -9.222 35.651 1.00 25.99 C ATOM 2575 C VAL D 63 -6.766 -10.291 34.765 1.00 26.43 C ATOM 2576 O VAL D 63 -7.848 -10.064 34.251 1.00 26.99 O ATOM 2577 CB VAL D 63 -4.984 -8.526 34.789 1.00 25.75 C ATOM 2578 CG1 VAL D 63 -5.575 -7.986 33.491 1.00 25.34 C ATOM 2579 CG2 VAL D 63 -4.260 -7.406 35.559 1.00 24.80 C ATOM 2580 N ASN D 64 -6.104 -11.430 34.554 1.00 27.40 N ATOM 2581 CA ASN D 64 -6.717 -12.568 33.833 1.00 28.19 C ATOM 2582 C ASN D 64 -8.018 -13.058 34.433 1.00 27.53 C ATOM 2583 O ASN D 64 -9.019 -13.175 33.744 1.00 27.76 O ATOM 2584 CB ASN D 64 -5.758 -13.731 33.788 1.00 29.20 C ATOM 2585 CG ASN D 64 -4.581 -13.463 32.894 1.00 31.97 C ATOM 2586 OD1 ASN D 64 -4.738 -12.936 31.799 1.00 33.92 O ATOM 2587 ND2 ASN D 64 -3.383 -13.841 33.351 1.00 36.49 N ATOM 2588 N ASP D 65 -8.006 -13.326 35.728 1.00 27.58 N ATOM 2589 CA ASP D 65 -9.225 -13.695 36.453 1.00 27.40 C ATOM 2590 C ASP D 65 -10.406 -12.710 36.235 1.00 26.82 C ATOM 2591 O ASP D 65 -11.475 -13.075 35.783 1.00 27.33 O ATOM 2592 CB ASP D 65 -8.891 -13.800 37.934 1.00 27.82 C ATOM 2593 CG ASP D 65 -9.993 -14.448 38.732 1.00 29.32 C ATOM 2594 OD1 ASP D 65 -10.654 -15.369 38.208 1.00 34.15 O ATOM 2595 OD2 ASP D 65 -10.197 -14.043 39.880 1.00 29.62 O ATOM 2596 N VAL D 66 -10.203 -11.451 36.550 1.00 27.21 N ATOM 2597 CA VAL D 66 -11.243 -10.426 36.375 1.00 27.48 C ATOM 2598 C VAL D 66 -11.646 -10.217 34.900 1.00 27.92 C ATOM 2599 O VAL D 66 -12.824 -10.000 34.593 1.00 27.33 O ATOM 2600 CB VAL D 66 -10.822 -9.090 37.092 1.00 27.91 C ATOM 2601 CG1 VAL D 66 -11.803 -7.947 36.805 1.00 26.40 C ATOM 2602 CG2 VAL D 66 -10.678 -9.327 38.578 1.00 25.28 C ATOM 2603 N PHE D 67 -10.681 -10.293 33.985 1.00 29.42 N ATOM 2604 CA PHE D 67 -11.011 -10.394 32.542 1.00 30.80 C ATOM 2605 C PHE D 67 -12.061 -11.497 32.273 1.00 31.37 C ATOM 2606 O PHE D 67 -13.070 -11.246 31.613 1.00 32.03 O ATOM 2607 CB PHE D 67 -9.747 -10.671 31.710 1.00 31.20 C ATOM 2608 CG PHE D 67 -10.013 -10.925 30.233 1.00 32.65 C ATOM 2609 CD1 PHE D 67 -9.867 -9.907 29.304 1.00 34.92 C ATOM 2610 CD2 PHE D 67 -10.382 -12.188 29.771 1.00 35.59 C ATOM 2611 CE1 PHE D 67 -10.107 -10.127 27.945 1.00 34.81 C ATOM 2612 CE2 PHE D 67 -10.619 -12.419 28.410 1.00 34.81 C ATOM 2613 CZ PHE D 67 -10.486 -11.376 27.504 1.00 34.49 C ATOM 2614 N GLU D 68 -11.810 -12.707 32.773 1.00 31.84 N ATOM 2615 CA GLU D 68 -12.635 -13.877 32.455 1.00 33.16 C ATOM 2616 C GLU D 68 -14.020 -13.757 33.074 1.00 31.82 C ATOM 2617 O GLU D 68 -15.020 -14.037 32.432 1.00 31.19 O ATOM 2618 CB GLU D 68 -11.959 -15.165 32.940 1.00 32.94 C ATOM 2619 CG GLU D 68 -10.732 -15.568 32.155 1.00 36.60 C ATOM 2620 CD GLU D 68 -9.783 -16.537 32.900 1.00 38.23 C ATOM 2621 OE1 GLU D 68 -8.679 -16.768 32.360 1.00 46.27 O ATOM 2622 OE2 GLU D 68 -10.105 -17.052 34.006 1.00 44.02 O ATOM 2623 N ARG D 69 -14.070 -13.320 34.328 1.00 31.59 N ATOM 2624 CA ARG D 69 -15.344 -13.062 34.980 1.00 31.14 C ATOM 2625 C ARG D 69 -16.204 -12.012 34.292 1.00 31.61 C ATOM 2626 O ARG D 69 -17.416 -12.220 34.109 1.00 32.80 O ATOM 2627 CB ARG D 69 -15.126 -12.671 36.424 1.00 31.28 C ATOM 2628 CG ARG D 69 -14.477 -13.720 37.272 1.00 28.87 C ATOM 2629 CD ARG D 69 -14.704 -13.269 38.684 1.00 30.17 C ATOM 2630 NE ARG D 69 -13.548 -13.356 39.542 1.00 28.05 N ATOM 2631 CZ ARG D 69 -13.543 -12.944 40.808 1.00 29.84 C ATOM 2632 NH1 ARG D 69 -14.648 -12.452 41.356 1.00 27.60 N ATOM 2633 NH2 ARG D 69 -12.434 -13.051 41.546 1.00 28.52 N ATOM 2634 N ILE D 70 -15.611 -10.883 33.904 1.00 31.33 N ATOM 2635 CA ILE D 70 -16.382 -9.857 33.185 1.00 30.19 C ATOM 2636 C ILE D 70 -16.780 -10.328 31.789 1.00 31.24 C ATOM 2637 O ILE D 70 -17.909 -10.078 31.353 1.00 31.73 O ATOM 2638 CB ILE D 70 -15.663 -8.499 33.063 1.00 30.45 C ATOM 2639 CG1 ILE D 70 -15.496 -7.841 34.439 1.00 28.08 C ATOM 2640 CG2 ILE D 70 -16.440 -7.581 32.075 1.00 29.47 C ATOM 2641 CD1 ILE D 70 -14.525 -6.659 34.458 1.00 29.41 C ATOM 2642 N ALA D 71 -15.867 -11.000 31.085 1.00 31.12 N ATOM 2643 CA ALA D 71 -16.187 -11.531 29.752 1.00 31.09 C ATOM 2644 C ALA D 71 -17.284 -12.621 29.777 1.00 30.98 C ATOM 2645 O ALA D 71 -18.155 -12.662 28.905 1.00 30.66 O ATOM 2646 CB ALA D 71 -14.938 -12.022 29.059 1.00 30.79 C ATOM 2647 N GLY D 72 -17.238 -13.482 30.788 1.00 31.07 N ATOM 2648 CA GLY D 72 -18.248 -14.512 30.995 1.00 30.45 C ATOM 2649 C GLY D 72 -19.608 -13.934 31.306 1.00 31.02 C ATOM 2650 O GLY D 72 -20.604 -14.380 30.747 1.00 31.32 O ATOM 2651 N GLU D 73 -19.669 -12.944 32.195 1.00 31.36 N ATOM 2652 CA GLU D 73 -20.937 -12.267 32.481 1.00 32.40 C ATOM 2653 C GLU D 73 -21.462 -11.600 31.207 1.00 32.42 C ATOM 2654 O GLU D 73 -22.652 -11.691 30.899 1.00 32.47 O ATOM 2655 CB GLU D 73 -20.804 -11.203 33.574 1.00 32.28 C ATOM 2656 CG GLU D 73 -20.292 -11.683 34.918 1.00 37.16 C ATOM 2657 CD GLU D 73 -21.378 -12.284 35.833 1.00 42.28 C ATOM 2658 OE1 GLU D 73 -22.601 -12.240 35.488 1.00 44.35 O ATOM 2659 OE2 GLU D 73 -20.986 -12.807 36.905 1.00 41.09 O ATOM 2660 N ALA D 74 -20.568 -10.931 30.479 1.00 32.64 N ATOM 2661 CA ALA D 74 -20.929 -10.270 29.220 1.00 33.24 C ATOM 2662 C ALA D 74 -21.496 -11.279 28.225 1.00 33.48 C ATOM 2663 O ALA D 74 -22.570 -11.067 27.691 1.00 33.01 O ATOM 2664 CB ALA D 74 -19.713 -9.516 28.628 1.00 33.31 C ATOM 2665 N SER D 75 -20.763 -12.375 28.013 1.00 34.64 N ATOM 2666 CA SER D 75 -21.170 -13.523 27.176 1.00 35.91 C ATOM 2667 C SER D 75 -22.573 -14.020 27.464 1.00 37.12 C ATOM 2668 O SER D 75 -23.392 -14.081 26.557 1.00 37.78 O ATOM 2669 CB SER D 75 -20.191 -14.684 27.362 1.00 35.88 C ATOM 2670 OG SER D 75 -20.461 -15.743 26.458 1.00 36.59 O ATOM 2671 N ARG D 76 -22.823 -14.376 28.727 1.00 38.46 N ATOM 2672 CA ARG D 76 -24.137 -14.775 29.253 1.00 39.49 C ATOM 2673 C ARG D 76 -25.213 -13.722 29.048 1.00 40.11 C ATOM 2674 O ARG D 76 -26.327 -14.054 28.648 1.00 40.73 O ATOM 2675 CB ARG D 76 -24.043 -15.080 30.754 1.00 39.47 C ATOM 2676 CG ARG D 76 -23.853 -16.531 31.137 1.00 39.36 C ATOM 2677 CD ARG D 76 -23.349 -16.642 32.608 1.00 39.98 C ATOM 2678 NE ARG D 76 -21.959 -17.065 32.559 1.00 40.19 N ATOM 2679 CZ ARG D 76 -20.963 -16.644 33.322 1.00 37.12 C ATOM 2680 NH1 ARG D 76 -21.139 -15.757 34.285 1.00 32.87 N ATOM 2681 NH2 ARG D 76 -19.755 -17.132 33.080 1.00 38.31 N ATOM 2682 N LEU D 77 -24.896 -12.462 29.347 1.00 40.87 N ATOM 2683 CA LEU D 77 -25.808 -11.350 29.050 1.00 41.66 C ATOM 2684 C LEU D 77 -26.255 -11.310 27.586 1.00 42.00 C ATOM 2685 O LEU D 77 -27.458 -11.265 27.297 1.00 42.04 O ATOM 2686 CB LEU D 77 -25.168 -10.011 29.374 1.00 41.32 C ATOM 2687 CG LEU D 77 -25.503 -9.366 30.697 1.00 42.70 C ATOM 2688 CD1 LEU D 77 -24.438 -8.277 30.946 1.00 41.87 C ATOM 2689 CD2 LEU D 77 -26.970 -8.824 30.725 1.00 40.24 C ATOM 2690 N ALA D 78 -25.279 -11.292 26.677 1.00 42.15 N ATOM 2691 CA ALA D 78 -25.566 -11.302 25.260 1.00 43.01 C ATOM 2692 C ALA D 78 -26.494 -12.479 24.920 1.00 43.62 C ATOM 2693 O ALA D 78 -27.545 -12.287 24.308 1.00 43.76 O ATOM 2694 CB ALA D 78 -24.276 -11.353 24.448 1.00 42.51 C ATOM 2695 N HIS D 79 -26.130 -13.684 25.352 1.00 44.27 N ATOM 2696 CA HIS D 79 -26.947 -14.865 25.064 1.00 45.25 C ATOM 2697 C HIS D 79 -28.367 -14.728 25.586 1.00 45.11 C ATOM 2698 O HIS D 79 -29.298 -14.916 24.829 1.00 45.30 O ATOM 2699 CB HIS D 79 -26.285 -16.155 25.547 1.00 45.77 C ATOM 2700 CG HIS D 79 -25.153 -16.611 24.672 1.00 49.18 C ATOM 2701 ND1 HIS D 79 -25.351 -17.174 23.426 1.00 53.33 N ATOM 2702 CD2 HIS D 79 -23.810 -16.588 24.861 1.00 52.34 C ATOM 2703 CE1 HIS D 79 -24.181 -17.473 22.886 1.00 53.17 C ATOM 2704 NE2 HIS D 79 -23.229 -17.133 23.737 1.00 52.97 N ATOM 2705 N TYR D 80 -28.531 -14.358 26.854 1.00 45.27 N ATOM 2706 CA TYR D 80 -29.857 -14.201 27.453 1.00 45.43 C ATOM 2707 C TYR D 80 -30.769 -13.277 26.652 1.00 45.96 C ATOM 2708 O TYR D 80 -31.997 -13.409 26.705 1.00 45.43 O ATOM 2709 CB TYR D 80 -29.762 -13.632 28.869 1.00 45.44 C ATOM 2710 CG TYR D 80 -29.020 -14.456 29.900 1.00 46.83 C ATOM 2711 CD1 TYR D 80 -28.613 -13.860 31.094 1.00 46.59 C ATOM 2712 CD2 TYR D 80 -28.704 -15.820 29.694 1.00 47.07 C ATOM 2713 CE1 TYR D 80 -27.943 -14.570 32.071 1.00 45.50 C ATOM 2714 CE2 TYR D 80 -28.015 -16.546 30.678 1.00 47.67 C ATOM 2715 CZ TYR D 80 -27.643 -15.901 31.872 1.00 47.03 C ATOM 2716 OH TYR D 80 -26.969 -16.565 32.882 1.00 46.58 O ATOM 2717 N ASN D 81 -30.162 -12.325 25.935 1.00 46.45 N ATOM 2718 CA ASN D 81 -30.897 -11.326 25.163 1.00 46.38 C ATOM 2719 C ASN D 81 -30.875 -11.577 23.663 1.00 46.94 C ATOM 2720 O ASN D 81 -31.297 -10.712 22.884 1.00 46.77 O ATOM 2721 CB ASN D 81 -30.340 -9.937 25.441 1.00 45.97 C ATOM 2722 CG ASN D 81 -30.676 -9.457 26.809 1.00 46.23 C ATOM 2723 OD1 ASN D 81 -31.760 -8.907 27.044 1.00 43.85 O ATOM 2724 ND2 ASN D 81 -29.748 -9.659 27.746 1.00 48.20 N