>>3MGS:HELIX   16  16 SER D   52  ASN D   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 16 SER D 52 ASN D 81 1 30 ATOM 2492 N SER D 52 8.014 -7.407 43.650 1.00 44.15 N ATOM 2493 CA SER D 52 8.624 -8.732 43.567 1.00 43.90 C ATOM 2494 C SER D 52 7.990 -9.559 42.454 1.00 43.82 C ATOM 2495 O SER D 52 6.808 -9.400 42.167 1.00 43.95 O ATOM 2496 CB SER D 52 8.471 -9.455 44.904 1.00 43.89 C ATOM 2497 OG SER D 52 7.202 -10.083 45.018 1.00 44.17 O ATOM 2498 N SER D 53 8.759 -10.451 41.836 1.00 43.65 N ATOM 2499 CA SER D 53 8.241 -11.191 40.687 1.00 43.66 C ATOM 2500 C SER D 53 7.146 -12.164 41.069 1.00 43.81 C ATOM 2501 O SER D 53 6.319 -12.515 40.218 1.00 44.30 O ATOM 2502 CB SER D 53 9.339 -11.903 39.921 1.00 43.44 C ATOM 2503 OG SER D 53 10.181 -12.570 40.825 1.00 43.94 O ATOM 2504 N LYS D 54 7.127 -12.601 42.329 1.00 43.45 N ATOM 2505 CA LYS D 54 5.996 -13.383 42.810 1.00 43.44 C ATOM 2506 C LYS D 54 4.756 -12.506 42.946 1.00 42.88 C ATOM 2507 O LYS D 54 3.643 -12.933 42.604 1.00 43.11 O ATOM 2508 CB LYS D 54 6.301 -14.048 44.138 1.00 43.88 C ATOM 2509 CG LYS D 54 7.130 -15.290 44.006 1.00 46.86 C ATOM 2510 CD LYS D 54 7.361 -15.978 45.356 1.00 50.41 C ATOM 2511 CE LYS D 54 8.229 -17.226 45.157 1.00 51.48 C ATOM 2512 NZ LYS D 54 8.547 -17.844 46.476 1.00 54.39 N ATOM 2513 N ALA D 55 4.943 -11.280 43.436 1.00 41.71 N ATOM 2514 CA ALA D 55 3.825 -10.369 43.581 1.00 40.55 C ATOM 2515 C ALA D 55 3.305 -10.007 42.209 1.00 39.93 C ATOM 2516 O ALA D 55 2.107 -9.888 42.023 1.00 39.93 O ATOM 2517 CB ALA D 55 4.219 -9.141 44.352 1.00 40.64 C ATOM 2518 N MET D 56 4.207 -9.861 41.245 1.00 39.33 N ATOM 2519 CA MET D 56 3.818 -9.589 39.865 1.00 38.99 C ATOM 2520 C MET D 56 3.034 -10.767 39.318 1.00 38.79 C ATOM 2521 O MET D 56 2.091 -10.600 38.538 1.00 38.82 O ATOM 2522 CB MET D 56 5.049 -9.307 38.997 1.00 39.08 C ATOM 2523 CG MET D 56 4.768 -8.990 37.518 1.00 39.19 C ATOM 2524 SD MET D 56 3.585 -7.644 37.245 1.00 41.90 S ATOM 2525 CE MET D 56 4.572 -6.161 37.448 1.00 41.83 C ATOM 2526 N SER D 57 3.411 -11.964 39.746 1.00 38.30 N ATOM 2527 CA SER D 57 2.703 -13.132 39.299 1.00 38.17 C ATOM 2528 C SER D 57 1.258 -13.119 39.787 1.00 37.85 C ATOM 2529 O SER D 57 0.346 -13.327 38.984 1.00 37.83 O ATOM 2530 CB SER D 57 3.418 -14.402 39.706 1.00 38.24 C ATOM 2531 OG SER D 57 2.736 -15.511 39.156 1.00 39.34 O ATOM 2532 N ILE D 58 1.058 -12.859 41.083 1.00 37.50 N ATOM 2533 CA ILE D 58 -0.293 -12.640 41.646 1.00 37.29 C ATOM 2534 C ILE D 58 -1.093 -11.609 40.837 1.00 37.67 C ATOM 2535 O ILE D 58 -2.243 -11.847 40.457 1.00 37.68 O ATOM 2536 CB ILE D 58 -0.258 -12.098 43.090 1.00 36.88 C ATOM 2537 CG1 ILE D 58 0.632 -12.934 44.009 1.00 36.69 C ATOM 2538 CG2 ILE D 58 -1.666 -11.870 43.621 1.00 35.69 C ATOM 2539 CD1 ILE D 58 0.244 -14.341 44.168 1.00 38.32 C ATOM 2540 N MET D 59 -0.475 -10.458 40.593 1.00 37.86 N ATOM 2541 CA MET D 59 -1.116 -9.408 39.833 1.00 38.24 C ATOM 2542 C MET D 59 -1.531 -9.916 38.471 1.00 38.56 C ATOM 2543 O MET D 59 -2.613 -9.602 37.989 1.00 38.33 O ATOM 2544 CB MET D 59 -0.199 -8.200 39.691 1.00 38.08 C ATOM 2545 CG MET D 59 -0.068 -7.371 40.959 1.00 38.13 C ATOM 2546 SD MET D 59 -1.638 -6.782 41.626 1.00 37.60 S ATOM 2547 CE MET D 59 -2.283 -5.797 40.298 1.00 36.02 C ATOM 2548 N ASN D 60 -0.682 -10.722 37.854 1.00 39.12 N ATOM 2549 CA ASN D 60 -1.042 -11.222 36.556 1.00 40.09 C ATOM 2550 C ASN D 60 -2.272 -12.154 36.607 1.00 40.76 C ATOM 2551 O ASN D 60 -3.211 -12.032 35.805 1.00 40.28 O ATOM 2552 CB ASN D 60 0.144 -11.869 35.863 1.00 39.81 C ATOM 2553 CG ASN D 60 -0.108 -12.045 34.390 1.00 40.59 C ATOM 2554 OD1 ASN D 60 -0.591 -11.135 33.722 1.00 40.90 O ATOM 2555 ND2 ASN D 60 0.177 -13.226 33.879 1.00 41.98 N ATOM 2556 N SER D 61 -2.263 -13.066 37.575 1.00 41.51 N ATOM 2557 CA SER D 61 -3.377 -13.966 37.788 1.00 42.58 C ATOM 2558 C SER D 61 -4.612 -13.159 38.093 1.00 42.90 C ATOM 2559 O SER D 61 -5.708 -13.485 37.610 1.00 43.79 O ATOM 2560 CB SER D 61 -3.094 -14.888 38.960 1.00 42.82 C ATOM 2561 OG SER D 61 -1.935 -15.667 38.706 1.00 45.41 O ATOM 2562 N PHE D 62 -4.429 -12.101 38.890 1.00 42.54 N ATOM 2563 CA PHE D 62 -5.524 -11.215 39.255 1.00 41.56 C ATOM 2564 C PHE D 62 -6.229 -10.710 38.039 1.00 41.29 C ATOM 2565 O PHE D 62 -7.436 -10.831 37.964 1.00 41.55 O ATOM 2566 CB PHE D 62 -5.048 -10.013 40.047 1.00 41.32 C ATOM 2567 CG PHE D 62 -6.120 -8.981 40.275 1.00 41.18 C ATOM 2568 CD1 PHE D 62 -7.303 -9.312 40.926 1.00 41.54 C ATOM 2569 CD2 PHE D 62 -5.944 -7.674 39.856 1.00 41.36 C ATOM 2570 CE1 PHE D 62 -8.293 -8.355 41.138 1.00 40.80 C ATOM 2571 CE2 PHE D 62 -6.925 -6.715 40.076 1.00 40.84 C ATOM 2572 CZ PHE D 62 -8.095 -7.059 40.711 1.00 40.79 C ATOM 2573 N VAL D 63 -5.471 -10.150 37.094 1.00 41.01 N ATOM 2574 CA VAL D 63 -6.046 -9.516 35.889 1.00 40.35 C ATOM 2575 C VAL D 63 -6.751 -10.524 34.980 1.00 40.29 C ATOM 2576 O VAL D 63 -7.843 -10.246 34.511 1.00 40.59 O ATOM 2577 CB VAL D 63 -5.001 -8.710 35.056 1.00 40.14 C ATOM 2578 CG1 VAL D 63 -5.634 -8.154 33.811 1.00 39.35 C ATOM 2579 CG2 VAL D 63 -4.387 -7.585 35.865 1.00 39.40 C ATOM 2580 N ASN D 64 -6.135 -11.680 34.740 1.00 39.85 N ATOM 2581 CA ASN D 64 -6.752 -12.708 33.923 1.00 39.89 C ATOM 2582 C ASN D 64 -8.039 -13.207 34.538 1.00 39.85 C ATOM 2583 O ASN D 64 -9.037 -13.390 33.843 1.00 39.46 O ATOM 2584 CB ASN D 64 -5.801 -13.875 33.761 1.00 40.27 C ATOM 2585 CG ASN D 64 -4.537 -13.486 33.045 1.00 41.45 C ATOM 2586 OD1 ASN D 64 -4.583 -13.102 31.879 1.00 43.06 O ATOM 2587 ND2 ASN D 64 -3.393 -13.576 33.735 1.00 42.35 N ATOM 2588 N ASP D 65 -8.001 -13.425 35.852 1.00 40.00 N ATOM 2589 CA ASP D 65 -9.160 -13.883 36.597 1.00 40.14 C ATOM 2590 C ASP D 65 -10.325 -12.950 36.319 1.00 40.19 C ATOM 2591 O ASP D 65 -11.368 -13.369 35.843 1.00 40.48 O ATOM 2592 CB ASP D 65 -8.852 -13.960 38.097 1.00 40.04 C ATOM 2593 CG ASP D 65 -10.051 -14.425 38.925 1.00 40.76 C ATOM 2594 OD1 ASP D 65 -10.734 -15.384 38.516 1.00 42.94 O ATOM 2595 OD2 ASP D 65 -10.312 -13.836 39.994 1.00 39.37 O ATOM 2596 N VAL D 66 -10.118 -11.671 36.571 1.00 40.51 N ATOM 2597 CA VAL D 66 -11.172 -10.679 36.417 1.00 40.93 C ATOM 2598 C VAL D 66 -11.604 -10.483 34.946 1.00 41.32 C ATOM 2599 O VAL D 66 -12.786 -10.263 34.660 1.00 41.07 O ATOM 2600 CB VAL D 66 -10.778 -9.349 37.110 1.00 40.80 C ATOM 2601 CG1 VAL D 66 -11.696 -8.214 36.699 1.00 41.23 C ATOM 2602 CG2 VAL D 66 -10.809 -9.513 38.616 1.00 40.10 C ATOM 2603 N PHE D 67 -10.648 -10.577 34.027 1.00 41.87 N ATOM 2604 CA PHE D 67 -10.949 -10.520 32.610 1.00 42.50 C ATOM 2605 C PHE D 67 -11.997 -11.581 32.315 1.00 42.97 C ATOM 2606 O PHE D 67 -13.019 -11.291 31.684 1.00 43.32 O ATOM 2607 CB PHE D 67 -9.692 -10.754 31.761 1.00 42.67 C ATOM 2608 CG PHE D 67 -9.978 -10.991 30.293 1.00 44.11 C ATOM 2609 CD1 PHE D 67 -9.755 -9.988 29.355 1.00 45.60 C ATOM 2610 CD2 PHE D 67 -10.480 -12.208 29.844 1.00 44.47 C ATOM 2611 CE1 PHE D 67 -10.022 -10.197 27.998 1.00 44.64 C ATOM 2612 CE2 PHE D 67 -10.751 -12.414 28.500 1.00 44.68 C ATOM 2613 CZ PHE D 67 -10.514 -11.406 27.575 1.00 43.99 C ATOM 2614 N GLU D 68 -11.750 -12.803 32.788 1.00 43.18 N ATOM 2615 CA GLU D 68 -12.627 -13.919 32.470 1.00 43.42 C ATOM 2616 C GLU D 68 -13.980 -13.722 33.097 1.00 42.67 C ATOM 2617 O GLU D 68 -14.994 -13.990 32.468 1.00 42.70 O ATOM 2618 CB GLU D 68 -12.038 -15.245 32.931 1.00 44.00 C ATOM 2619 CG GLU D 68 -10.857 -15.730 32.106 1.00 47.34 C ATOM 2620 CD GLU D 68 -9.881 -16.604 32.910 1.00 51.79 C ATOM 2621 OE1 GLU D 68 -8.697 -16.673 32.500 1.00 53.65 O ATOM 2622 OE2 GLU D 68 -10.285 -17.206 33.945 1.00 52.68 O ATOM 2623 N ARG D 69 -14.000 -13.239 34.329 1.00 42.06 N ATOM 2624 CA ARG D 69 -15.263 -13.090 35.029 1.00 42.04 C ATOM 2625 C ARG D 69 -16.218 -12.113 34.328 1.00 42.43 C ATOM 2626 O ARG D 69 -17.421 -12.392 34.172 1.00 42.51 O ATOM 2627 CB ARG D 69 -15.024 -12.650 36.452 1.00 41.70 C ATOM 2628 CG ARG D 69 -14.237 -13.624 37.251 1.00 40.46 C ATOM 2629 CD ARG D 69 -14.712 -13.514 38.641 1.00 38.79 C ATOM 2630 NE ARG D 69 -13.617 -13.452 39.584 1.00 36.98 N ATOM 2631 CZ ARG D 69 -13.746 -12.925 40.792 1.00 37.56 C ATOM 2632 NH1 ARG D 69 -14.901 -12.410 41.157 1.00 36.19 N ATOM 2633 NH2 ARG D 69 -12.726 -12.894 41.632 1.00 40.09 N ATOM 2634 N ILE D 70 -15.664 -10.979 33.901 1.00 42.49 N ATOM 2635 CA ILE D 70 -16.414 -9.965 33.178 1.00 42.21 C ATOM 2636 C ILE D 70 -16.788 -10.437 31.794 1.00 42.30 C ATOM 2637 O ILE D 70 -17.931 -10.252 31.369 1.00 42.36 O ATOM 2638 CB ILE D 70 -15.642 -8.651 33.065 1.00 42.22 C ATOM 2639 CG1 ILE D 70 -15.415 -8.063 34.469 1.00 42.36 C ATOM 2640 CG2 ILE D 70 -16.406 -7.679 32.162 1.00 41.63 C ATOM 2641 CD1 ILE D 70 -14.457 -6.901 34.518 1.00 42.09 C ATOM 2642 N ALA D 71 -15.838 -11.046 31.087 1.00 42.35 N ATOM 2643 CA ALA D 71 -16.126 -11.543 29.747 1.00 42.59 C ATOM 2644 C ALA D 71 -17.187 -12.629 29.848 1.00 43.02 C ATOM 2645 O ALA D 71 -18.092 -12.708 29.022 1.00 43.09 O ATOM 2646 CB ALA D 71 -14.883 -12.050 29.086 1.00 42.29 C ATOM 2647 N GLY D 72 -17.084 -13.433 30.900 1.00 43.56 N ATOM 2648 CA GLY D 72 -18.023 -14.506 31.152 1.00 44.35 C ATOM 2649 C GLY D 72 -19.420 -13.966 31.307 1.00 45.08 C ATOM 2650 O GLY D 72 -20.334 -14.412 30.623 1.00 45.05 O ATOM 2651 N GLU D 73 -19.578 -12.992 32.202 1.00 45.94 N ATOM 2652 CA GLU D 73 -20.882 -12.394 32.476 1.00 46.89 C ATOM 2653 C GLU D 73 -21.475 -11.779 31.215 1.00 47.34 C ATOM 2654 O GLU D 73 -22.684 -11.879 30.957 1.00 47.40 O ATOM 2655 CB GLU D 73 -20.754 -11.335 33.556 1.00 46.72 C ATOM 2656 CG GLU D 73 -20.364 -11.904 34.895 1.00 49.15 C ATOM 2657 CD GLU D 73 -21.562 -12.325 35.747 1.00 52.06 C ATOM 2658 OE1 GLU D 73 -22.726 -12.303 35.246 1.00 52.47 O ATOM 2659 OE2 GLU D 73 -21.323 -12.667 36.931 1.00 52.05 O ATOM 2660 N ALA D 74 -20.607 -11.152 30.429 1.00 47.81 N ATOM 2661 CA ALA D 74 -21.017 -10.507 29.205 1.00 48.42 C ATOM 2662 C ALA D 74 -21.531 -11.573 28.249 1.00 48.92 C ATOM 2663 O ALA D 74 -22.668 -11.504 27.761 1.00 49.11 O ATOM 2664 CB ALA D 74 -19.847 -9.781 28.609 1.00 48.47 C ATOM 2665 N SER D 75 -20.685 -12.574 28.020 1.00 49.25 N ATOM 2666 CA SER D 75 -21.022 -13.720 27.197 1.00 49.47 C ATOM 2667 C SER D 75 -22.439 -14.198 27.486 1.00 49.72 C ATOM 2668 O SER D 75 -23.235 -14.368 26.557 1.00 49.83 O ATOM 2669 CB SER D 75 -20.004 -14.833 27.424 1.00 49.28 C ATOM 2670 OG SER D 75 -20.287 -15.922 26.586 1.00 49.48 O ATOM 2671 N ARG D 76 -22.740 -14.371 28.776 1.00 50.10 N ATOM 2672 CA ARG D 76 -24.050 -14.813 29.272 1.00 50.74 C ATOM 2673 C ARG D 76 -25.185 -13.813 29.023 1.00 51.53 C ATOM 2674 O ARG D 76 -26.284 -14.195 28.593 1.00 51.38 O ATOM 2675 CB ARG D 76 -23.961 -15.084 30.769 1.00 50.56 C ATOM 2676 CG ARG D 76 -24.058 -16.528 31.169 1.00 49.49 C ATOM 2677 CD ARG D 76 -23.496 -16.702 32.561 1.00 47.12 C ATOM 2678 NE ARG D 76 -22.096 -17.114 32.497 1.00 46.24 N ATOM 2679 CZ ARG D 76 -21.135 -16.649 33.287 1.00 45.43 C ATOM 2680 NH1 ARG D 76 -21.406 -15.731 34.202 1.00 45.54 N ATOM 2681 NH2 ARG D 76 -19.898 -17.095 33.155 1.00 45.33 N ATOM 2682 N LEU D 77 -24.913 -12.544 29.325 1.00 52.41 N ATOM 2683 CA LEU D 77 -25.841 -11.452 29.054 1.00 53.36 C ATOM 2684 C LEU D 77 -26.291 -11.424 27.601 1.00 54.08 C ATOM 2685 O LEU D 77 -27.498 -11.434 27.310 1.00 54.13 O ATOM 2686 CB LEU D 77 -25.206 -10.105 29.404 1.00 53.30 C ATOM 2687 CG LEU D 77 -25.646 -9.435 30.705 1.00 53.36 C ATOM 2688 CD1 LEU D 77 -24.807 -8.207 30.930 1.00 53.63 C ATOM 2689 CD2 LEU D 77 -27.110 -9.062 30.664 1.00 52.69 C ATOM 2690 N ALA D 78 -25.316 -11.385 26.694 1.00 54.80 N ATOM 2691 CA ALA D 78 -25.605 -11.386 25.277 1.00 55.78 C ATOM 2692 C ALA D 78 -26.493 -12.584 24.964 1.00 56.82 C ATOM 2693 O ALA D 78 -27.565 -12.440 24.365 1.00 56.73 O ATOM 2694 CB ALA D 78 -24.326 -11.430 24.481 1.00 55.68 C ATOM 2695 N HIS D 79 -26.071 -13.764 25.411 1.00 58.07 N ATOM 2696 CA HIS D 79 -26.862 -14.945 25.157 1.00 59.43 C ATOM 2697 C HIS D 79 -28.260 -14.762 25.693 1.00 59.20 C ATOM 2698 O HIS D 79 -29.205 -14.851 24.932 1.00 59.10 O ATOM 2699 CB HIS D 79 -26.177 -16.224 25.635 1.00 60.14 C ATOM 2700 CG HIS D 79 -25.138 -16.733 24.674 1.00 64.31 C ATOM 2701 ND1 HIS D 79 -25.412 -16.974 23.335 1.00 67.36 N ATOM 2702 CD2 HIS D 79 -23.822 -17.031 24.850 1.00 66.73 C ATOM 2703 CE1 HIS D 79 -24.313 -17.403 22.735 1.00 67.72 C ATOM 2704 NE2 HIS D 79 -23.335 -17.449 23.631 1.00 67.75 N ATOM 2705 N TYR D 80 -28.401 -14.422 26.966 1.00 59.58 N ATOM 2706 CA TYR D 80 -29.742 -14.245 27.525 1.00 60.26 C ATOM 2707 C TYR D 80 -30.661 -13.382 26.657 1.00 60.58 C ATOM 2708 O TYR D 80 -31.874 -13.599 26.648 1.00 60.88 O ATOM 2709 CB TYR D 80 -29.702 -13.664 28.929 1.00 60.32 C ATOM 2710 CG TYR D 80 -29.025 -14.531 29.957 1.00 61.31 C ATOM 2711 CD1 TYR D 80 -28.595 -13.978 31.162 1.00 62.25 C ATOM 2712 CD2 TYR D 80 -28.794 -15.894 29.735 1.00 61.32 C ATOM 2713 CE1 TYR D 80 -27.968 -14.747 32.128 1.00 61.75 C ATOM 2714 CE2 TYR D 80 -28.158 -16.672 30.694 1.00 61.26 C ATOM 2715 CZ TYR D 80 -27.752 -16.085 31.893 1.00 61.48 C ATOM 2716 OH TYR D 80 -27.128 -16.820 32.874 1.00 61.91 O ATOM 2717 N ASN D 81 -30.085 -12.423 25.930 1.00 60.65 N ATOM 2718 CA ASN D 81 -30.864 -11.476 25.131 1.00 60.64 C ATOM 2719 C ASN D 81 -30.801 -11.694 23.620 1.00 60.92 C ATOM 2720 O ASN D 81 -31.079 -10.771 22.847 1.00 61.36 O ATOM 2721 CB ASN D 81 -30.423 -10.051 25.443 1.00 60.41 C ATOM 2722 CG ASN D 81 -30.867 -9.599 26.798 1.00 60.50 C ATOM 2723 OD1 ASN D 81 -32.016 -9.192 26.986 1.00 60.59 O ATOM 2724 ND2 ASN D 81 -29.956 -9.650 27.763 1.00 60.73 N