>>3MGS:HELIX   34  34 SER H   52  ASN H   81  1                                  30    
SSKAMSIMNSFVNDVFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 34 SER H 52 ASN H 81 1 30 ATOM 5619 N SER H 52 -46.798 -33.889 36.595 1.00 59.22 N ATOM 5620 CA SER H 52 -47.437 -32.562 36.570 1.00 58.75 C ATOM 5621 C SER H 52 -46.653 -31.534 35.742 1.00 58.34 C ATOM 5622 O SER H 52 -45.486 -31.738 35.432 1.00 58.21 O ATOM 5623 CB SER H 52 -47.719 -32.040 37.990 1.00 58.88 C ATOM 5624 OG SER H 52 -46.620 -31.349 38.548 1.00 58.66 O ATOM 5625 N SER H 53 -47.311 -30.440 35.375 1.00 58.04 N ATOM 5626 CA SER H 53 -46.682 -29.395 34.578 1.00 58.14 C ATOM 5627 C SER H 53 -45.457 -28.830 35.264 1.00 58.33 C ATOM 5628 O SER H 53 -44.345 -28.868 34.710 1.00 58.63 O ATOM 5629 CB SER H 53 -47.662 -28.270 34.291 1.00 57.99 C ATOM 5630 OG SER H 53 -48.204 -28.440 32.998 1.00 58.52 O ATOM 5631 N LYS H 54 -45.674 -28.308 36.473 1.00 58.06 N ATOM 5632 CA LYS H 54 -44.600 -27.828 37.334 1.00 57.62 C ATOM 5633 C LYS H 54 -43.448 -28.837 37.402 1.00 56.94 C ATOM 5634 O LYS H 54 -42.288 -28.449 37.289 1.00 57.46 O ATOM 5635 CB LYS H 54 -45.133 -27.546 38.737 1.00 57.61 C ATOM 5636 CG LYS H 54 -46.252 -26.507 38.806 1.00 58.35 C ATOM 5637 CD LYS H 54 -46.907 -26.501 40.199 1.00 58.56 C ATOM 5638 CE LYS H 54 -47.815 -25.299 40.412 1.00 59.17 C ATOM 5639 NZ LYS H 54 -46.990 -24.083 40.608 1.00 60.51 N ATOM 5640 N ALA H 55 -43.767 -30.123 37.560 1.00 55.67 N ATOM 5641 CA ALA H 55 -42.749 -31.164 37.624 1.00 54.47 C ATOM 5642 C ALA H 55 -41.946 -31.249 36.338 1.00 53.62 C ATOM 5643 O ALA H 55 -40.732 -31.371 36.374 1.00 53.38 O ATOM 5644 CB ALA H 55 -43.370 -32.503 37.956 1.00 54.53 C ATOM 5645 N MET H 56 -42.629 -31.167 35.205 1.00 53.02 N ATOM 5646 CA MET H 56 -41.981 -31.261 33.904 1.00 52.57 C ATOM 5647 C MET H 56 -41.077 -30.071 33.702 1.00 52.30 C ATOM 5648 O MET H 56 -40.018 -30.164 33.074 1.00 52.21 O ATOM 5649 CB MET H 56 -43.024 -31.279 32.803 1.00 52.59 C ATOM 5650 CG MET H 56 -42.446 -31.194 31.408 1.00 53.25 C ATOM 5651 SD MET H 56 -41.490 -32.650 30.959 1.00 54.41 S ATOM 5652 CE MET H 56 -42.765 -33.885 30.768 1.00 53.62 C ATOM 5653 N SER H 57 -41.519 -28.941 34.241 1.00 51.91 N ATOM 5654 CA SER H 57 -40.761 -27.710 34.163 1.00 51.36 C ATOM 5655 C SER H 57 -39.436 -27.841 34.935 1.00 50.85 C ATOM 5656 O SER H 57 -38.389 -27.424 34.434 1.00 51.19 O ATOM 5657 CB SER H 57 -41.605 -26.550 34.669 1.00 51.23 C ATOM 5658 OG SER H 57 -40.970 -25.323 34.395 1.00 52.44 O ATOM 5659 N ILE H 58 -39.485 -28.442 36.131 1.00 49.84 N ATOM 5660 CA ILE H 58 -38.288 -28.741 36.922 1.00 48.55 C ATOM 5661 C ILE H 58 -37.369 -29.612 36.098 1.00 48.27 C ATOM 5662 O ILE H 58 -36.161 -29.415 36.086 1.00 48.33 O ATOM 5663 CB ILE H 58 -38.614 -29.544 38.197 1.00 48.49 C ATOM 5664 CG1 ILE H 58 -39.721 -28.892 39.044 1.00 48.01 C ATOM 5665 CG2 ILE H 58 -37.342 -29.869 38.982 1.00 47.76 C ATOM 5666 CD1 ILE H 58 -39.304 -27.760 39.915 1.00 48.97 C ATOM 5667 N MET H 59 -37.947 -30.585 35.406 1.00 47.91 N ATOM 5668 CA MET H 59 -37.146 -31.515 34.635 1.00 47.82 C ATOM 5669 C MET H 59 -36.494 -30.800 33.476 1.00 47.96 C ATOM 5670 O MET H 59 -35.374 -31.114 33.091 1.00 48.15 O ATOM 5671 CB MET H 59 -37.982 -32.685 34.134 1.00 47.58 C ATOM 5672 CG MET H 59 -38.284 -33.721 35.180 1.00 47.09 C ATOM 5673 SD MET H 59 -36.824 -34.517 35.854 1.00 46.62 S ATOM 5674 CE MET H 59 -36.022 -35.092 34.360 1.00 46.22 C ATOM 5675 N ASN H 60 -37.192 -29.827 32.921 1.00 48.04 N ATOM 5676 CA ASN H 60 -36.629 -29.103 31.810 1.00 48.47 C ATOM 5677 C ASN H 60 -35.417 -28.266 32.271 1.00 48.42 C ATOM 5678 O ASN H 60 -34.343 -28.275 31.634 1.00 48.17 O ATOM 5679 CB ASN H 60 -37.707 -28.247 31.137 1.00 48.62 C ATOM 5680 CG ASN H 60 -37.226 -27.634 29.844 1.00 49.23 C ATOM 5681 OD1 ASN H 60 -36.575 -28.297 29.024 1.00 49.00 O ATOM 5682 ND2 ASN H 60 -37.519 -26.355 29.660 1.00 50.93 N ATOM 5683 N SER H 61 -35.599 -27.575 33.400 1.00 48.17 N ATOM 5684 CA SER H 61 -34.535 -26.830 34.052 1.00 48.04 C ATOM 5685 C SER H 61 -33.377 -27.754 34.327 1.00 47.83 C ATOM 5686 O SER H 61 -32.229 -27.392 34.101 1.00 48.32 O ATOM 5687 CB SER H 61 -35.021 -26.212 35.355 1.00 47.90 C ATOM 5688 OG SER H 61 -36.015 -25.236 35.101 1.00 49.42 O ATOM 5689 N PHE H 62 -33.675 -28.963 34.782 1.00 47.33 N ATOM 5690 CA PHE H 62 -32.621 -29.914 35.039 1.00 46.98 C ATOM 5691 C PHE H 62 -31.758 -30.193 33.827 1.00 46.64 C ATOM 5692 O PHE H 62 -30.543 -30.129 33.916 1.00 46.86 O ATOM 5693 CB PHE H 62 -33.169 -31.223 35.559 1.00 46.99 C ATOM 5694 CG PHE H 62 -32.119 -32.284 35.709 1.00 47.32 C ATOM 5695 CD1 PHE H 62 -31.087 -32.135 36.631 1.00 47.56 C ATOM 5696 CD2 PHE H 62 -32.154 -33.432 34.927 1.00 47.52 C ATOM 5697 CE1 PHE H 62 -30.111 -33.124 36.779 1.00 47.55 C ATOM 5698 CE2 PHE H 62 -31.189 -34.429 35.073 1.00 46.75 C ATOM 5699 CZ PHE H 62 -30.163 -34.271 35.995 1.00 47.01 C ATOM 5700 N VAL H 63 -32.379 -30.511 32.702 1.00 46.42 N ATOM 5701 CA VAL H 63 -31.605 -30.844 31.509 1.00 46.43 C ATOM 5702 C VAL H 63 -30.816 -29.627 31.025 1.00 46.70 C ATOM 5703 O VAL H 63 -29.629 -29.742 30.692 1.00 46.66 O ATOM 5704 CB VAL H 63 -32.476 -31.434 30.374 1.00 46.29 C ATOM 5705 CG1 VAL H 63 -31.627 -31.728 29.159 1.00 45.61 C ATOM 5706 CG2 VAL H 63 -33.146 -32.713 30.837 1.00 45.85 C ATOM 5707 N ASN H 64 -31.468 -28.466 31.013 1.00 46.65 N ATOM 5708 CA ASN H 64 -30.788 -27.224 30.669 1.00 46.79 C ATOM 5709 C ASN H 64 -29.581 -26.936 31.534 1.00 46.70 C ATOM 5710 O ASN H 64 -28.522 -26.575 31.021 1.00 46.81 O ATOM 5711 CB ASN H 64 -31.739 -26.051 30.766 1.00 46.92 C ATOM 5712 CG ASN H 64 -32.555 -25.898 29.544 1.00 47.42 C ATOM 5713 OD1 ASN H 64 -32.136 -26.303 28.460 1.00 48.00 O ATOM 5714 ND2 ASN H 64 -33.740 -25.320 29.690 1.00 48.76 N ATOM 5715 N ASP H 65 -29.752 -27.094 32.843 1.00 46.38 N ATOM 5716 CA ASP H 65 -28.687 -26.844 33.776 1.00 46.32 C ATOM 5717 C ASP H 65 -27.529 -27.741 33.417 1.00 45.93 C ATOM 5718 O ASP H 65 -26.428 -27.264 33.151 1.00 46.32 O ATOM 5719 CB ASP H 65 -29.150 -27.116 35.201 1.00 46.71 C ATOM 5720 CG ASP H 65 -28.090 -26.777 36.240 1.00 48.31 C ATOM 5721 OD1 ASP H 65 -27.194 -25.952 35.952 1.00 50.16 O ATOM 5722 OD2 ASP H 65 -28.153 -27.342 37.352 1.00 48.73 O ATOM 5723 N VAL H 66 -27.786 -29.040 33.364 1.00 45.49 N ATOM 5724 CA VAL H 66 -26.712 -30.001 33.136 1.00 45.06 C ATOM 5725 C VAL H 66 -26.059 -29.819 31.763 1.00 44.83 C ATOM 5726 O VAL H 66 -24.832 -29.890 31.650 1.00 44.58 O ATOM 5727 CB VAL H 66 -27.168 -31.451 33.396 1.00 45.09 C ATOM 5728 CG1 VAL H 66 -26.074 -32.429 33.033 1.00 45.34 C ATOM 5729 CG2 VAL H 66 -27.522 -31.623 34.859 1.00 44.30 C ATOM 5730 N PHE H 67 -26.873 -29.550 30.740 1.00 44.58 N ATOM 5731 CA PHE H 67 -26.342 -29.201 29.426 1.00 44.29 C ATOM 5732 C PHE H 67 -25.268 -28.133 29.563 1.00 44.63 C ATOM 5733 O PHE H 67 -24.136 -28.311 29.080 1.00 44.46 O ATOM 5734 CB PHE H 67 -27.426 -28.687 28.480 1.00 43.88 C ATOM 5735 CG PHE H 67 -26.898 -28.328 27.118 1.00 43.57 C ATOM 5736 CD1 PHE H 67 -26.733 -29.308 26.141 1.00 43.44 C ATOM 5737 CD2 PHE H 67 -26.525 -27.022 26.820 1.00 43.48 C ATOM 5738 CE1 PHE H 67 -26.221 -28.996 24.878 1.00 42.65 C ATOM 5739 CE2 PHE H 67 -26.018 -26.692 25.562 1.00 43.56 C ATOM 5740 CZ PHE H 67 -25.867 -27.693 24.586 1.00 43.55 C ATOM 5741 N GLU H 68 -25.636 -27.032 30.233 1.00 44.69 N ATOM 5742 CA GLU H 68 -24.746 -25.881 30.397 1.00 44.91 C ATOM 5743 C GLU H 68 -23.492 -26.256 31.176 1.00 44.02 C ATOM 5744 O GLU H 68 -22.381 -25.914 30.756 1.00 44.18 O ATOM 5745 CB GLU H 68 -25.460 -24.660 30.998 1.00 44.47 C ATOM 5746 CG GLU H 68 -26.412 -23.921 30.022 1.00 45.85 C ATOM 5747 CD GLU H 68 -27.422 -22.959 30.726 1.00 47.12 C ATOM 5748 OE1 GLU H 68 -27.468 -22.920 31.980 1.00 50.60 O ATOM 5749 OE2 GLU H 68 -28.181 -22.234 30.032 1.00 49.34 O ATOM 5750 N ARG H 69 -23.643 -26.996 32.265 1.00 43.16 N ATOM 5751 CA ARG H 69 -22.457 -27.367 33.040 1.00 43.07 C ATOM 5752 C ARG H 69 -21.445 -28.171 32.214 1.00 43.04 C ATOM 5753 O ARG H 69 -20.251 -27.842 32.125 1.00 42.76 O ATOM 5754 CB ARG H 69 -22.839 -28.138 34.287 1.00 42.76 C ATOM 5755 CG ARG H 69 -23.790 -27.411 35.187 1.00 42.55 C ATOM 5756 CD ARG H 69 -23.641 -27.964 36.547 1.00 42.09 C ATOM 5757 NE ARG H 69 -24.888 -27.961 37.280 1.00 42.20 N ATOM 5758 CZ ARG H 69 -25.063 -28.642 38.408 1.00 44.07 C ATOM 5759 NH1 ARG H 69 -24.080 -29.376 38.908 1.00 43.57 N ATOM 5760 NH2 ARG H 69 -26.223 -28.600 39.037 1.00 46.30 N ATOM 5761 N ILE H 70 -21.953 -29.215 31.584 1.00 43.01 N ATOM 5762 CA ILE H 70 -21.124 -30.104 30.818 1.00 42.80 C ATOM 5763 C ILE H 70 -20.478 -29.332 29.685 1.00 43.06 C ATOM 5764 O ILE H 70 -19.252 -29.291 29.580 1.00 42.84 O ATOM 5765 CB ILE H 70 -21.940 -31.316 30.344 1.00 42.59 C ATOM 5766 CG1 ILE H 70 -22.327 -32.147 31.571 1.00 41.50 C ATOM 5767 CG2 ILE H 70 -21.150 -32.153 29.354 1.00 42.49 C ATOM 5768 CD1 ILE H 70 -22.940 -33.445 31.261 1.00 40.54 C ATOM 5769 N ALA H 71 -21.309 -28.678 28.878 1.00 43.43 N ATOM 5770 CA ALA H 71 -20.825 -27.879 27.753 1.00 43.68 C ATOM 5771 C ALA H 71 -19.789 -26.833 28.184 1.00 43.92 C ATOM 5772 O ALA H 71 -18.758 -26.671 27.534 1.00 43.80 O ATOM 5773 CB ALA H 71 -21.978 -27.224 27.053 1.00 43.63 C ATOM 5774 N GLY H 72 -20.060 -26.142 29.290 1.00 44.06 N ATOM 5775 CA GLY H 72 -19.128 -25.144 29.810 1.00 44.28 C ATOM 5776 C GLY H 72 -17.764 -25.719 30.157 1.00 44.37 C ATOM 5777 O GLY H 72 -16.721 -25.165 29.799 1.00 43.87 O ATOM 5778 N GLU H 73 -17.782 -26.845 30.858 1.00 44.72 N ATOM 5779 CA GLU H 73 -16.562 -27.489 31.286 1.00 45.17 C ATOM 5780 C GLU H 73 -15.788 -28.037 30.094 1.00 45.29 C ATOM 5781 O GLU H 73 -14.558 -27.997 30.070 1.00 45.28 O ATOM 5782 CB GLU H 73 -16.907 -28.603 32.250 1.00 45.30 C ATOM 5783 CG GLU H 73 -15.721 -29.228 32.888 1.00 46.97 C ATOM 5784 CD GLU H 73 -15.128 -28.353 33.945 1.00 50.97 C ATOM 5785 OE1 GLU H 73 -14.027 -27.790 33.665 1.00 52.48 O ATOM 5786 OE2 GLU H 73 -15.769 -28.234 35.035 1.00 51.14 O ATOM 5787 N ALA H 74 -16.524 -28.541 29.105 1.00 45.59 N ATOM 5788 CA ALA H 74 -15.939 -29.132 27.917 1.00 45.92 C ATOM 5789 C ALA H 74 -15.267 -28.046 27.140 1.00 46.58 C ATOM 5790 O ALA H 74 -14.205 -28.246 26.580 1.00 47.00 O ATOM 5791 CB ALA H 74 -16.996 -29.756 27.089 1.00 45.91 C ATOM 5792 N SER H 75 -15.913 -26.888 27.116 1.00 47.39 N ATOM 5793 CA SER H 75 -15.363 -25.682 26.529 1.00 48.08 C ATOM 5794 C SER H 75 -14.012 -25.311 27.168 1.00 48.22 C ATOM 5795 O SER H 75 -13.000 -25.230 26.469 1.00 48.53 O ATOM 5796 CB SER H 75 -16.383 -24.548 26.664 1.00 48.24 C ATOM 5797 OG SER H 75 -15.820 -23.284 26.346 1.00 50.03 O ATOM 5798 N ARG H 76 -13.987 -25.102 28.482 1.00 48.26 N ATOM 5799 CA ARG H 76 -12.732 -24.776 29.159 1.00 48.68 C ATOM 5800 C ARG H 76 -11.637 -25.785 28.812 1.00 48.98 C ATOM 5801 O ARG H 76 -10.518 -25.408 28.457 1.00 49.11 O ATOM 5802 CB ARG H 76 -12.916 -24.689 30.675 1.00 48.50 C ATOM 5803 CG ARG H 76 -13.586 -23.423 31.124 1.00 48.61 C ATOM 5804 CD ARG H 76 -14.139 -23.527 32.531 1.00 49.48 C ATOM 5805 NE ARG H 76 -15.514 -23.028 32.549 1.00 51.14 N ATOM 5806 CZ ARG H 76 -16.569 -23.715 32.986 1.00 51.59 C ATOM 5807 NH1 ARG H 76 -16.416 -24.937 33.502 1.00 50.71 N ATOM 5808 NH2 ARG H 76 -17.782 -23.159 32.937 1.00 51.69 N ATOM 5809 N LEU H 77 -11.976 -27.064 28.892 1.00 49.19 N ATOM 5810 CA LEU H 77 -11.038 -28.109 28.552 1.00 49.58 C ATOM 5811 C LEU H 77 -10.344 -27.840 27.226 1.00 49.97 C ATOM 5812 O LEU H 77 -9.110 -27.875 27.142 1.00 49.89 O ATOM 5813 CB LEU H 77 -11.760 -29.448 28.484 1.00 49.57 C ATOM 5814 CG LEU H 77 -11.717 -30.302 29.743 1.00 49.22 C ATOM 5815 CD1 LEU H 77 -12.573 -31.529 29.554 1.00 49.31 C ATOM 5816 CD2 LEU H 77 -10.302 -30.710 30.032 1.00 49.08 C ATOM 5817 N ALA H 78 -11.149 -27.565 26.202 1.00 50.35 N ATOM 5818 CA ALA H 78 -10.648 -27.330 24.865 1.00 51.07 C ATOM 5819 C ALA H 78 -9.739 -26.120 24.847 1.00 51.98 C ATOM 5820 O ALA H 78 -8.688 -26.142 24.216 1.00 51.95 O ATOM 5821 CB ALA H 78 -11.785 -27.150 23.904 1.00 50.81 C ATOM 5822 N HIS H 79 -10.131 -25.071 25.559 1.00 53.29 N ATOM 5823 CA HIS H 79 -9.323 -23.862 25.586 1.00 54.87 C ATOM 5824 C HIS H 79 -8.003 -24.092 26.287 1.00 54.74 C ATOM 5825 O HIS H 79 -6.964 -23.705 25.771 1.00 54.64 O ATOM 5826 CB HIS H 79 -10.081 -22.680 26.193 1.00 55.74 C ATOM 5827 CG HIS H 79 -11.008 -22.002 25.224 1.00 59.77 C ATOM 5828 ND1 HIS H 79 -12.373 -22.248 25.193 1.00 63.02 N ATOM 5829 CD2 HIS H 79 -10.762 -21.104 24.233 1.00 61.98 C ATOM 5830 CE1 HIS H 79 -12.929 -21.521 24.236 1.00 63.64 C ATOM 5831 NE2 HIS H 79 -11.974 -20.819 23.638 1.00 64.17 N ATOM 5832 N TYR H 80 -8.041 -24.743 27.444 1.00 55.07 N ATOM 5833 CA TYR H 80 -6.817 -25.077 28.152 1.00 55.48 C ATOM 5834 C TYR H 80 -5.867 -25.739 27.191 1.00 55.65 C ATOM 5835 O TYR H 80 -4.723 -25.333 27.084 1.00 56.10 O ATOM 5836 CB TYR H 80 -7.082 -25.998 29.337 1.00 55.72 C ATOM 5837 CG TYR H 80 -7.968 -25.387 30.404 1.00 56.93 C ATOM 5838 CD1 TYR H 80 -8.186 -24.005 30.454 1.00 57.04 C ATOM 5839 CD2 TYR H 80 -8.572 -26.182 31.382 1.00 57.04 C ATOM 5840 CE1 TYR H 80 -8.988 -23.443 31.419 1.00 56.18 C ATOM 5841 CE2 TYR H 80 -9.370 -25.615 32.363 1.00 56.45 C ATOM 5842 CZ TYR H 80 -9.572 -24.245 32.369 1.00 56.12 C ATOM 5843 OH TYR H 80 -10.360 -23.657 33.329 1.00 56.98 O ATOM 5844 N ASN H 81 -6.357 -26.726 26.452 1.00 55.80 N ATOM 5845 CA ASN H 81 -5.517 -27.453 25.518 1.00 55.89 C ATOM 5846 C ASN H 81 -5.447 -26.891 24.104 1.00 56.23 C ATOM 5847 O ASN H 81 -5.113 -27.614 23.172 1.00 56.14 O ATOM 5848 CB ASN H 81 -5.941 -28.903 25.492 1.00 55.85 C ATOM 5849 CG ASN H 81 -5.800 -29.556 26.841 1.00 55.71 C ATOM 5850 OD1 ASN H 81 -4.687 -29.844 27.298 1.00 54.62 O ATOM 5851 ND2 ASN H 81 -6.934 -29.789 27.499 1.00 55.71 N