>>3S1R:HELIX  101 101 PRO C  239  ASP C  268  1                                  30    
PVDQVVVRGIDTLQKKVASILLALTQMDQD
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 101 101 PRO C 239 ASP C 268 1 30 ATOM 21773 N PRO C 239 -38.094 -43.754 20.762 1.00 75.67 N ANISOU21773 N PRO C 239 8792 10617 9340 -1750 -1519 530 N ATOM 21774 CA PRO C 239 -39.087 -43.749 21.856 1.00 75.15 C ANISOU21774 CA PRO C 239 8580 10652 9322 -1832 -1487 548 C ATOM 21775 C PRO C 239 -38.930 -44.950 22.811 1.00 76.65 C ANISOU21775 C PRO C 239 8793 10790 9541 -1983 -1467 562 C ATOM 21776 O PRO C 239 -38.469 -46.018 22.397 1.00 74.09 O ANISOU21776 O PRO C 239 8576 10370 9204 -2049 -1517 546 O ATOM 21777 CB PRO C 239 -40.426 -43.747 21.122 1.00 78.37 C ANISOU21777 CB PRO C 239 8873 11173 9730 -1850 -1578 524 C ATOM 21778 CG PRO C 239 -40.108 -44.126 19.687 1.00 82.86 C ANISOU21778 CG PRO C 239 9548 11682 10255 -1814 -1670 490 C ATOM 21779 CD PRO C 239 -38.645 -44.338 19.525 1.00 77.31 C ANISOU21779 CD PRO C 239 9013 10839 9523 -1772 -1635 493 C ATOM 21780 N VAL C 240 -39.303 -44.772 24.099 1.00 74.01 N ANISOU21780 N VAL C 240 8363 10514 9243 -2035 -1394 592 N ATOM 21781 CA VAL C 240 -39.163 -45.797 25.160 1.00 73.90 C ANISOU21781 CA VAL C 240 8368 10456 9256 -2176 -1362 613 C ATOM 21782 C VAL C 240 -39.484 -47.220 24.796 1.00 78.96 C ANISOU21782 C VAL C 240 9045 11055 9901 -2320 -1449 597 C ATOM 21783 O VAL C 240 -38.690 -48.106 25.099 1.00 78.27 O ANISOU21783 O VAL C 240 9069 10857 9813 -2388 -1442 604 O ATOM 21784 CB VAL C 240 -39.724 -45.446 26.548 1.00 77.45 C ANISOU21784 CB VAL C 240 8696 10992 9739 -2220 -1277 647 C ATOM 21785 CG1 VAL C 240 -38.649 -44.882 27.458 1.00 75.05 C ANISOU21785 CG1 VAL C 240 8464 10619 9435 -2163 -1175 673 C ATOM 21786 CG2 VAL C 240 -40.946 -44.544 26.458 1.00 78.35 C ANISOU21786 CG2 VAL C 240 8646 11261 9863 -2163 -1278 642 C ATOM 21787 N ASP C 241 -40.633 -47.449 24.152 1.00 77.82 N ANISOU21787 N ASP C 241 8809 10996 9761 -2366 -1534 575 N ATOM 21788 CA ASP C 241 -41.043 -48.786 23.702 1.00 79.16 C ANISOU21788 CA ASP C 241 9012 11130 9935 -2506 -1629 555 C ATOM 21789 C ASP C 241 -39.932 -49.429 22.866 1.00 85.55 C ANISOU21789 C ASP C 241 10007 11791 10708 -2476 -1676 530 C ATOM 21790 O ASP C 241 -39.622 -50.610 23.079 1.00 84.94 O ANISOU21790 O ASP C 241 10018 11620 10635 -2587 -1704 530 O ATOM 21791 CB ASP C 241 -42.353 -48.734 22.899 1.00 81.36 C ANISOU21791 CB ASP C 241 9169 11527 10217 -2532 -1720 529 C ATOM 21792 CG ASP C 241 -42.380 -47.749 21.745 1.00 85.00 C ANISOU21792 CG ASP C 241 9626 12026 10645 -2375 -1758 501 C ATOM 21793 OD1 ASP C 241 -41.957 -46.595 21.940 1.00 82.12 O ANISOU21793 OD1 ASP C 241 9240 11689 10272 -2243 -1684 516 O ATOM 21794 OD2 ASP C 241 -42.882 -48.116 20.666 1.00 94.90 O ANISOU21794 OD2 ASP C 241 10897 13282 11879 -2385 -1862 465 O ATOM 21795 N GLN C 242 -39.289 -48.617 21.965 1.00 82.69 N ANISOU21795 N GLN C 242 9707 11404 10308 -2322 -1680 511 N ATOM 21796 CA GLN C 242 -38.190 -49.063 21.106 1.00 81.59 C ANISOU21796 CA GLN C 242 9737 11137 10127 -2270 -1716 486 C ATOM 21797 C GLN C 242 -36.921 -49.400 21.877 1.00 84.29 C ANISOU21797 C GLN C 242 10197 11360 10468 -2270 -1642 506 C ATOM 21798 O GLN C 242 -36.313 -50.435 21.602 1.00 83.60 O ANISOU21798 O GLN C 242 10238 11163 10363 -2310 -1684 487 O ATOM 21799 CB GLN C 242 -37.931 -48.109 19.929 1.00 81.78 C ANISOU21799 CB GLN C 242 9787 11179 10108 -2114 -1739 463 C ATOM 21800 CG GLN C 242 -38.986 -48.155 18.839 1.00 85.29 C ANISOU21800 CG GLN C 242 10168 11701 10538 -2120 -1846 430 C ATOM 21801 CD GLN C 242 -39.382 -49.558 18.460 1.00103.26 C ANISOU21801 CD GLN C 242 12483 13933 12816 -2258 -1945 402 C ATOM 21802 OE1 GLN C 242 -40.370 -50.100 18.967 1.00100.59 O ANISOU21802 OE1 GLN C 242 12044 13659 12517 -2387 -1973 408 O ATOM 21803 NE2 GLN C 242 -38.611 -50.188 17.585 1.00 94.74 N ANISOU21803 NE2 GLN C 242 11554 12745 11697 -2237 -1998 371 N ATOM 21804 N VAL C 243 -36.569 -48.587 22.892 1.00 79.48 N ANISOU21804 N VAL C 243 9544 10775 9880 -2230 -1535 543 N ATOM 21805 CA VAL C 243 -35.385 -48.855 23.723 1.00 77.74 C ANISOU21805 CA VAL C 243 9427 10450 9661 -2231 -1464 563 C ATOM 21806 C VAL C 243 -35.409 -50.310 24.198 1.00 83.03 C ANISOU21806 C VAL C 243 10152 11049 10345 -2383 -1503 564 C ATOM 21807 O VAL C 243 -34.452 -51.045 23.949 1.00 83.17 O ANISOU21807 O VAL C 243 10312 10949 10342 -2384 -1528 548 O ATOM 21808 CB VAL C 243 -35.162 -47.857 24.894 1.00 78.93 C ANISOU21808 CB VAL C 243 9516 10641 9833 -2182 -1348 602 C ATOM 21809 CG1 VAL C 243 -33.774 -48.038 25.487 1.00 77.02 C ANISOU21809 CG1 VAL C 243 9396 10283 9584 -2163 -1287 615 C ATOM 21810 CG2 VAL C 243 -35.356 -46.414 24.439 1.00 78.07 C ANISOU21810 CG2 VAL C 243 9345 10607 9711 -2040 -1318 601 C ATOM 21811 N VAL C 244 -36.537 -50.741 24.781 1.00 79.79 N ANISOU21811 N VAL C 244 9634 10711 9969 -2510 -1516 580 N ATOM 21812 CA VAL C 244 -36.684 -52.113 25.249 1.00 80.26 C ANISOU21812 CA VAL C 244 9743 10706 10044 -2668 -1557 586 C ATOM 21813 C VAL C 244 -36.822 -53.145 24.118 1.00 83.79 C ANISOU21813 C VAL C 244 10272 11094 10472 -2721 -1679 544 C ATOM 21814 O VAL C 244 -36.103 -54.147 24.125 1.00 82.70 O ANISOU21814 O VAL C 244 10269 10832 10322 -2770 -1710 534 O ATOM 21815 CB VAL C 244 -37.620 -52.303 26.479 1.00 85.02 C ANISOU21815 CB VAL C 244 10226 11390 10689 -2798 -1514 626 C ATOM 21816 CG1 VAL C 244 -38.388 -51.030 26.820 1.00 84.77 C ANISOU21816 CG1 VAL C 244 10030 11505 10673 -2732 -1448 644 C ATOM 21817 CG2 VAL C 244 -38.542 -53.514 26.345 1.00 86.24 C ANISOU21817 CG2 VAL C 244 10352 11555 10860 -2965 -1604 619 C ATOM 21818 N VAL C 245 -37.681 -52.857 23.120 1.00 80.69 N ANISOU21818 N VAL C 245 9804 10784 10071 -2697 -1749 515 N ATOM 21819 CA VAL C 245 -37.895 -53.739 21.962 1.00 80.73 C ANISOU21819 CA VAL C 245 9878 10744 10053 -2738 -1871 470 C ATOM 21820 C VAL C 245 -36.581 -53.932 21.178 1.00 81.04 C ANISOU21820 C VAL C 245 10094 10654 10045 -2637 -1890 439 C ATOM 21821 O VAL C 245 -36.152 -55.083 20.998 1.00 81.21 O ANISOU21821 O VAL C 245 10237 10565 10054 -2706 -1948 419 O ATOM 21822 CB VAL C 245 -39.101 -53.297 21.088 1.00 85.24 C ANISOU21822 CB VAL C 245 10324 11440 10624 -2729 -1942 446 C ATOM 21823 CG1 VAL C 245 -39.078 -53.964 19.713 1.00 85.77 C ANISOU21823 CG1 VAL C 245 10485 11452 10653 -2719 -2062 393 C ATOM 21824 CG2 VAL C 245 -40.417 -53.592 21.803 1.00 85.95 C ANISOU21824 CG2 VAL C 245 10263 11633 10760 -2879 -1954 468 C ATOM 21825 N ARG C 246 -35.910 -52.811 20.797 1.00 72.42 N ANISOU21825 N ARG C 246 9016 9574 8926 -2476 -1835 438 N ATOM 21826 CA ARG C 246 -34.621 -52.863 20.112 1.00 69.65 C ANISOU21826 CA ARG C 246 8819 9115 8529 -2372 -1837 413 C ATOM 21827 C ARG C 246 -33.540 -53.450 21.019 1.00 72.93 C ANISOU21827 C ARG C 246 9339 9419 8951 -2399 -1779 432 C ATOM 21828 O ARG C 246 -32.701 -54.202 20.524 1.00 72.73 O ANISOU21828 O ARG C 246 9455 9285 8893 -2379 -1816 404 O ATOM 21829 CB ARG C 246 -34.223 -51.521 19.521 1.00 64.44 C ANISOU21829 CB ARG C 246 8145 8500 7838 -2207 -1793 411 C ATOM 21830 CG ARG C 246 -35.219 -51.041 18.504 1.00 69.30 C ANISOU21830 CG ARG C 246 8682 9212 8438 -2173 -1865 387 C ATOM 21831 CD ARG C 246 -34.784 -49.779 17.809 1.00 78.26 C ANISOU21831 CD ARG C 246 9813 10383 9537 -2010 -1826 388 C ATOM 21832 NE ARG C 246 -35.876 -49.237 17.000 1.00 84.06 N ANISOU21832 NE ARG C 246 10454 11223 10262 -1981 -1892 371 N ATOM 21833 CZ ARG C 246 -35.796 -48.127 16.278 1.00 91.99 C ANISOU21833 CZ ARG C 246 11439 12277 11235 -1848 -1878 372 C ATOM 21834 NH1 ARG C 246 -34.669 -47.425 16.249 1.00 75.78 N ANISOU21834 NH1 ARG C 246 9453 10179 9159 -1737 -1798 389 N ATOM 21835 NH2 ARG C 246 -36.839 -47.714 15.569 1.00 72.57 N ANISOU21835 NH2 ARG C 246 8894 9912 8766 -1827 -1946 355 N ATOM 21836 N GLY C 247 -33.620 -53.178 22.330 1.00 68.30 N ANISOU21836 N GLY C 247 8683 8862 8404 -2447 -1696 477 N ATOM 21837 CA GLY C 247 -32.733 -53.774 23.323 1.00 67.58 C ANISOU21837 CA GLY C 247 8680 8676 8324 -2487 -1644 499 C ATOM 21838 C GLY C 247 -32.814 -55.283 23.212 1.00 73.61 C ANISOU21838 C GLY C 247 9540 9344 9085 -2610 -1730 480 C ATOM 21839 O GLY C 247 -31.802 -55.932 22.926 1.00 72.98 O ANISOU21839 O GLY C 247 9605 9147 8978 -2579 -1749 459 O ATOM 21840 N ILE C 248 -34.051 -55.838 23.314 1.00 71.98 N ANISOU21840 N ILE C 248 9254 9189 8905 -2746 -1790 483 N ATOM 21841 CA ILE C 248 -34.325 -57.273 23.170 1.00 73.34 C ANISOU21841 CA ILE C 248 9509 9277 9079 -2881 -1883 466 C ATOM 21842 C ILE C 248 -33.769 -57.765 21.838 1.00 80.79 C ANISOU21842 C ILE C 248 10585 10137 9975 -2813 -1971 408 C ATOM 21843 O ILE C 248 -32.989 -58.722 21.809 1.00 80.82 O ANISOU21843 O ILE C 248 10736 10013 9960 -2828 -2002 391 O ATOM 21844 CB ILE C 248 -35.841 -57.578 23.267 1.00 77.51 C ANISOU21844 CB ILE C 248 9909 9900 9641 -3025 -1937 475 C ATOM 21845 CG1 ILE C 248 -36.391 -57.310 24.667 1.00 78.12 C ANISOU21845 CG1 ILE C 248 9865 10056 9762 -3108 -1851 532 C ATOM 21846 CG2 ILE C 248 -36.149 -59.018 22.827 1.00 79.20 C ANISOU21846 CG2 ILE C 248 10217 10025 9852 -3158 -2051 448 C ATOM 21847 CD1 ILE C 248 -37.872 -56.849 24.670 1.00 89.52 C ANISOU21847 CD1 ILE C 248 11120 11660 11235 -3166 -1862 542 C ATOM 21848 N ASP C 249 -34.172 -57.082 20.743 1.00 79.00 N ANISOU21848 N ASP C 249 10305 9986 9726 -2730 -2008 379 N ATOM 21849 CA ASP C 249 -33.818 -57.381 19.360 1.00 79.40 C ANISOU21849 CA ASP C 249 10456 9986 9726 -2656 -2093 323 C ATOM 21850 C ASP C 249 -32.323 -57.470 19.102 1.00 80.70 C ANISOU21850 C ASP C 249 10773 10041 9848 -2540 -2062 304 C ATOM 21851 O ASP C 249 -31.882 -58.421 18.465 1.00 80.03 O ANISOU21851 O ASP C 249 10821 9855 9731 -2548 -2137 263 O ATOM 21852 CB ASP C 249 -34.484 -56.378 18.420 1.00 82.48 C ANISOU21852 CB ASP C 249 10744 10495 10101 -2571 -2111 308 C ATOM 21853 CG ASP C 249 -34.459 -56.785 16.965 1.00105.62 C ANISOU21853 CG ASP C 249 13753 13397 12982 -2530 -2219 249 C ATOM 21854 OD1 ASP C 249 -34.829 -57.952 16.663 1.00109.69 O ANISOU21854 OD1 ASP C 249 14332 13850 13495 -2636 -2317 220 O ATOM 21855 OD2 ASP C 249 -34.113 -55.931 16.120 1.00114.80 O ANISOU21855 OD2 ASP C 249 14912 14601 14106 -2396 -2210 234 O ATOM 21856 N THR C 250 -31.544 -56.497 19.608 1.00 75.98 N ANISOU21856 N THR C 250 10156 9461 9250 -2435 -1953 333 N ATOM 21857 CA THR C 250 -30.084 -56.479 19.463 1.00 74.72 C ANISOU21857 CA THR C 250 10124 9213 9055 -2324 -1911 321 C ATOM 21858 C THR C 250 -29.486 -57.723 20.133 1.00 77.57 C ANISOU21858 C THR C 250 10603 9448 9423 -2402 -1926 320 C ATOM 21859 O THR C 250 -28.678 -58.427 19.512 1.00 77.87 O ANISOU21859 O THR C 250 10779 9387 9420 -2356 -1971 280 O ATOM 21860 CB THR C 250 -29.500 -55.155 19.991 1.00 79.90 C ANISOU21860 CB THR C 250 10716 9924 9718 -2216 -1791 358 C ATOM 21861 OG1 THR C 250 -30.147 -54.090 19.298 1.00 84.67 O ANISOU21861 OG1 THR C 250 11224 10636 10313 -2147 -1793 355 O ATOM 21862 CG2 THR C 250 -27.989 -55.047 19.782 1.00 73.13 C ANISOU21862 CG2 THR C 250 9977 8987 8823 -2098 -1744 345 C ATOM 21863 N LEU C 251 -29.923 -58.006 21.378 1.00 71.15 N ANISOU21863 N LEU C 251 9736 8640 8657 -2518 -1893 363 N ATOM 21864 CA LEU C 251 -29.463 -59.156 22.130 1.00 70.23 C ANISOU21864 CA LEU C 251 9726 8409 8551 -2604 -1907 371 C ATOM 21865 C LEU C 251 -29.723 -60.444 21.320 1.00 75.32 C ANISOU21865 C LEU C 251 10480 8965 9172 -2674 -2034 323 C ATOM 21866 O LEU C 251 -28.796 -61.240 21.125 1.00 73.84 O ANISOU21866 O LEU C 251 10441 8659 8954 -2640 -2063 295 O ATOM 21867 CB LEU C 251 -30.118 -59.161 23.525 1.00 70.03 C ANISOU21867 CB LEU C 251 9605 8425 8577 -2726 -1853 428 C ATOM 21868 CG LEU C 251 -29.591 -60.139 24.603 1.00 73.89 C ANISOU21868 CG LEU C 251 10189 8806 9079 -2805 -1837 454 C ATOM 21869 CD1 LEU C 251 -28.079 -60.118 24.721 1.00 72.28 C ANISOU21869 CD1 LEU C 251 10100 8517 8847 -2682 -1788 444 C ATOM 21870 CD2 LEU C 251 -30.209 -59.834 25.950 1.00 76.69 C ANISOU21870 CD2 LEU C 251 10429 9230 9478 -2899 -1763 514 C ATOM 21871 N GLN C 252 -30.937 -60.570 20.739 1.00 73.91 N ANISOU21871 N GLN C 252 10230 8850 9003 -2753 -2111 308 N ATOM 21872 CA GLN C 252 -31.308 -61.700 19.881 1.00 75.19 C ANISOU21872 CA GLN C 252 10487 8939 9144 -2821 -2239 259 C ATOM 21873 C GLN C 252 -30.312 -61.782 18.740 1.00 79.79 C ANISOU21873 C GLN C 252 11199 9453 9663 -2678 -2273 203 C ATOM 21874 O GLN C 252 -29.735 -62.842 18.509 1.00 79.19 O ANISOU21874 O GLN C 252 11274 9253 9561 -2688 -2332 169 O ATOM 21875 CB GLN C 252 -32.704 -61.496 19.277 1.00 77.38 C ANISOU21875 CB GLN C 252 10646 9321 9435 -2893 -2309 248 C ATOM 21876 CG GLN C 252 -33.859 -62.083 20.055 1.00 89.61 C ANISOU21876 CG GLN C 252 12097 10913 11038 -3076 -2324 286 C ATOM 21877 CD GLN C 252 -35.177 -61.956 19.310 1.00108.19 C ANISOU21877 CD GLN C 252 14341 13365 13401 -3144 -2407 266 C ATOM 21878 OE1 GLN C 252 -35.410 -61.042 18.489 1.00 99.77 O ANISOU21878 OE1 GLN C 252 13194 12397 12318 -3045 -2407 248 O ATOM 21879 NE2 GLN C 252 -36.079 -62.880 19.592 1.00101.12 N ANISOU21879 NE2 GLN C 252 13439 12448 12533 -3317 -2480 270 N ATOM 21880 N LYS C 253 -30.083 -60.637 18.058 1.00 77.39 N ANISOU21880 N LYS C 253 10839 9233 9333 -2541 -2231 194 N ATOM 21881 CA LYS C 253 -29.181 -60.530 16.912 1.00 77.90 C ANISOU21881 CA LYS C 253 11007 9258 9335 -2397 -2250 145 C ATOM 21882 C LYS C 253 -27.778 -60.992 17.267 1.00 82.35 C ANISOU21882 C LYS C 253 11706 9709 9875 -2330 -2210 138 C ATOM 21883 O LYS C 253 -27.233 -61.853 16.565 1.00 82.36 O ANISOU21883 O LYS C 253 11846 9615 9833 -2300 -2280 87 O ATOM 21884 CB LYS C 253 -29.170 -59.106 16.332 1.00 80.33 C ANISOU21884 CB LYS C 253 11220 9679 9623 -2270 -2192 153 C ATOM 21885 CG LYS C 253 -30.370 -58.753 15.455 1.00 92.95 C ANISOU21885 CG LYS C 253 12722 11374 11218 -2295 -2261 137 C ATOM 21886 CD LYS C 253 -30.336 -57.272 15.094 1.00 99.93 C ANISOU21886 CD LYS C 253 13514 12366 12088 -2169 -2193 155 C ATOM 21887 CE LYS C 253 -31.497 -56.844 14.241 1.00111.67 C ANISOU21887 CE LYS C 253 14892 13961 13577 -2191 -2255 145 C ATOM 21888 NZ LYS C 253 -31.563 -55.364 14.126 1.00119.05 N ANISOU21888 NZ LYS C 253 15722 15002 14510 -2085 -2179 175 N ATOM 21889 N LYS C 254 -27.208 -60.475 18.373 1.00 78.53 N ANISOU21889 N LYS C 254 11182 9233 9420 -2310 -2103 186 N ATOM 21890 CA LYS C 254 -25.876 -60.928 18.740 1.00 78.06 C ANISOU21890 CA LYS C 254 11245 9072 9342 -2248 -2066 179 C ATOM 21891 C LYS C 254 -25.782 -62.380 19.164 1.00 84.18 C ANISOU21891 C LYS C 254 12139 9722 10124 -2350 -2135 166 C ATOM 21892 O LYS C 254 -24.780 -63.020 18.848 1.00 84.75 O ANISOU21892 O LYS C 254 12348 9695 10160 -2283 -2153 132 O ATOM 21893 CB LYS C 254 -25.066 -59.951 19.589 1.00 79.01 C ANISOU21893 CB LYS C 254 11309 9231 9481 -2175 -1939 224 C ATOM 21894 CG LYS C 254 -25.733 -59.428 20.850 1.00 86.19 C ANISOU21894 CG LYS C 254 12089 10207 10450 -2267 -1874 286 C ATOM 21895 CD LYS C 254 -24.696 -58.895 21.859 1.00 88.07 C ANISOU21895 CD LYS C 254 12320 10438 10703 -2208 -1763 324 C ATOM 21896 CE LYS C 254 -23.837 -57.759 21.358 1.00 92.14 C ANISOU21896 CE LYS C 254 12816 11001 11192 -2054 -1691 320 C ATOM 21897 NZ LYS C 254 -22.505 -58.207 20.873 1.00 99.88 N ANISOU21897 NZ LYS C 254 13930 11895 12127 -1954 -1693 284 N ATOM 21898 N VAL C 255 -26.852 -62.942 19.766 1.00 81.46 N ANISOU21898 N VAL C 255 11748 9380 9821 -2511 -2180 190 N ATOM 21899 CA VAL C 255 -26.858 -64.375 20.119 1.00 81.94 C ANISOU21899 CA VAL C 255 11931 9314 9888 -2622 -2257 179 C ATOM 21900 C VAL C 255 -26.909 -65.180 18.812 1.00 86.83 C ANISOU21900 C VAL C 255 12667 9865 10459 -2602 -2376 108 C ATOM 21901 O VAL C 255 -26.143 -66.133 18.642 1.00 86.33 O ANISOU21901 O VAL C 255 12760 9677 10364 -2573 -2422 72 O ATOM 21902 CB VAL C 255 -27.986 -64.757 21.128 1.00 86.00 C ANISOU21902 CB VAL C 255 12364 9854 10460 -2810 -2270 228 C ATOM 21903 CG1 VAL C 255 -28.092 -66.271 21.334 1.00 86.36 C ANISOU21903 CG1 VAL C 255 12546 9761 10507 -2931 -2361 215 C ATOM 21904 CG2 VAL C 255 -27.763 -64.066 22.464 1.00 85.06 C ANISOU21904 CG2 VAL C 255 12142 9794 10381 -2822 -2151 295 C ATOM 21905 N ALA C 256 -27.759 -64.728 17.870 1.00 84.32 N ANISOU21905 N ALA C 256 12274 9633 10132 -2605 -2426 85 N ATOM 21906 CA ALA C 256 -27.957 -65.341 16.561 1.00 85.38 C ANISOU21906 CA ALA C 256 12497 9725 10219 -2587 -2542 17 C ATOM 21907 C ALA C 256 -26.679 -65.388 15.715 1.00 88.91 C ANISOU21907 C ALA C 256 13071 10113 10597 -2418 -2541 -36 C ATOM 21908 O ALA C 256 -26.537 -66.292 14.886 1.00 88.96 O ANISOU21908 O ALA C 256 13204 10038 10560 -2406 -2640 -96 O ATOM 21909 CB ALA C 256 -29.061 -64.620 15.811 1.00 86.54 C ANISOU21909 CB ALA C 256 12514 9998 10370 -2604 -2574 12 C ATOM 21910 N SER C 257 -25.746 -64.435 15.933 1.00 84.42 N ANISOU21910 N SER C 257 12470 9588 10019 -2290 -2429 -13 N ATOM 21911 CA SER C 257 -24.487 -64.412 15.192 1.00 83.83 C ANISOU21911 CA SER C 257 12501 9471 9880 -2128 -2413 -58 C ATOM 21912 C SER C 257 -23.565 -65.517 15.657 1.00 87.83 C ANISOU21912 C SER C 257 13160 9837 10373 -2123 -2434 -78 C ATOM 21913 O SER C 257 -22.809 -66.036 14.842 1.00 87.63 O ANISOU21913 O SER C 257 13261 9745 10288 -2030 -2481 -138 O ATOM 21914 CB SER C 257 -23.810 -63.051 15.281 1.00 86.26 C ANISOU21914 CB SER C 257 12719 9872 10183 -2004 -2289 -25 C ATOM 21915 OG SER C 257 -23.590 -62.675 16.628 1.00 96.65 O ANISOU21915 OG SER C 257 13960 11207 11554 -2047 -2197 38 O ATOM 21916 N ILE C 258 -23.667 -65.905 16.952 1.00 84.51 N ANISOU21916 N ILE C 258 12733 9373 10005 -2222 -2404 -31 N ATOM 21917 CA ILE C 258 -22.888 -66.987 17.584 1.00 84.57 C ANISOU21917 CA ILE C 258 12882 9243 10008 -2233 -2424 -41 C ATOM 21918 C ILE C 258 -23.349 -68.330 17.056 1.00 92.26 C ANISOU21918 C ILE C 258 13986 10106 10963 -2316 -2562 -90 C ATOM 21919 O ILE C 258 -22.520 -69.210 16.804 1.00 93.20 O ANISOU21919 O ILE C 258 14262 10111 11040 -2254 -2610 -138 O ATOM 21920 CB ILE C 258 -22.955 -66.937 19.137 1.00 86.27 C ANISOU21920 CB ILE C 258 13042 9453 10284 -2327 -2353 31 C ATOM 21921 CG1 ILE C 258 -22.550 -65.556 19.683 1.00 84.94 C ANISOU21921 CG1 ILE C 258 12740 9397 10137 -2250 -2219 79 C ATOM 21922 CG2 ILE C 258 -22.172 -68.088 19.800 1.00 85.69 C ANISOU21922 CG2 ILE C 258 13122 9233 10205 -2342 -2382 24 C ATOM 21923 CD1 ILE C 258 -21.184 -64.975 19.137 1.00 92.91 C ANISOU21923 CD1 ILE C 258 13787 10416 11098 -2064 -2157 51 C ATOM 21924 N LEU C 259 -24.678 -68.487 16.910 1.00 89.83 N ANISOU21924 N LEU C 259 13611 9834 10686 -2456 -2625 -80 N ATOM 21925 CA LEU C 259 -25.344 -69.670 16.366 1.00 90.91 C ANISOU21925 CA LEU C 259 13847 9883 10813 -2561 -2763 -123 C ATOM 21926 C LEU C 259 -24.810 -69.883 14.934 1.00 95.95 C ANISOU21926 C LEU C 259 14587 10493 11375 -2430 -2830 -205 C ATOM 21927 O LEU C 259 -24.419 -70.993 14.560 1.00 95.87 O ANISOU21927 O LEU C 259 14742 10355 11328 -2420 -2918 -259 O ATOM 21928 CB LEU C 259 -26.850 -69.350 16.323 1.00 91.15 C ANISOU21928 CB LEU C 259 13731 10012 10888 -2705 -2791 -92 C ATOM 21929 CG LEU C 259 -27.870 -70.314 16.922 1.00 96.15 C ANISOU21929 CG LEU C 259 14385 10583 11563 -2909 -2878 -76 C ATOM 21930 CD1 LEU C 259 -27.234 -71.505 17.576 1.00 96.39 C ANISOU21930 CD1 LEU C 259 14580 10451 11592 -2953 -2911 -77 C ATOM 21931 CD2 LEU C 259 -28.838 -69.579 17.832 1.00 97.54 C ANISOU21931 CD2 LEU C 259 14377 10879 11807 -3034 -2817 -3 C ATOM 21932 N LEU C 260 -24.735 -68.763 14.184 1.00 92.79 N ANISOU21932 N LEU C 260 14094 10214 10950 -2319 -2780 -212 N ATOM 21933 CA LEU C 260 -24.269 -68.625 12.817 1.00 93.51 C ANISOU21933 CA LEU C 260 14249 10313 10966 -2182 -2818 -280 C ATOM 21934 C LEU C 260 -22.757 -68.818 12.691 1.00 99.15 C ANISOU21934 C LEU C 260 15085 10960 11628 -2025 -2776 -312 C ATOM 21935 O LEU C 260 -22.297 -69.411 11.719 1.00 99.20 O ANISOU21935 O LEU C 260 15220 10903 11570 -1944 -2846 -382 O ATOM 21936 CB LEU C 260 -24.687 -67.236 12.314 1.00 92.86 C ANISOU21936 CB LEU C 260 14013 10388 10881 -2123 -2759 -259 C ATOM 21937 CG LEU C 260 -24.421 -66.889 10.854 1.00 97.49 C ANISOU21937 CG LEU C 260 14639 11013 11390 -1990 -2793 -318 C ATOM 21938 CD1 LEU C 260 -25.292 -67.698 9.928 1.00 98.97 C ANISOU21938 CD1 LEU C 260 14864 11183 11559 -2069 -2931 -368 C ATOM 21939 CD2 LEU C 260 -24.663 -65.424 10.612 1.00 99.33 C ANISOU21939 CD2 LEU C 260 14730 11389 11622 -1906 -2697 -281 C ATOM 21940 N ALA C 261 -21.982 -68.317 13.654 1.00 97.35 N ANISOU21940 N ALA C 261 14814 10747 11426 -1979 -2663 -264 N ATOM 21941 CA ALA C 261 -20.524 -68.482 13.634 1.00 98.08 C ANISOU21941 CA ALA C 261 15006 10785 11474 -1833 -2616 -290 C ATOM 21942 C ALA C 261 -20.104 -69.969 13.780 1.00105.59 C ANISOU21942 C ALA C 261 16139 11575 12406 -1854 -2705 -335 C ATOM 21943 O ALA C 261 -19.064 -70.364 13.248 1.00105.59 O ANISOU21943 O ALA C 261 16254 11519 12345 -1723 -2715 -389 O ATOM 21944 CB ALA C 261 -19.876 -67.631 14.715 1.00 97.42 C ANISOU21944 CB ALA C 261 14830 10754 11430 -1800 -2483 -226 C ATOM 21945 N LEU C 262 -20.933 -70.787 14.467 1.00104.11 N ANISOU21945 N LEU C 262 15978 11313 12266 -2019 -2771 -313 N ATOM 21946 CA LEU C 262 -20.710 -72.221 14.665 1.00105.53 C ANISOU21946 CA LEU C 262 16332 11330 12434 -2065 -2867 -348 C ATOM 21947 C LEU C 262 -20.920 -72.979 13.359 1.00113.70 C ANISOU21947 C LEU C 262 17488 12305 13407 -2037 -2992 -433 C ATOM 21948 O LEU C 262 -20.405 -74.090 13.193 1.00114.36 O ANISOU21948 O LEU C 262 17742 12255 13454 -2003 -3067 -485 O ATOM 21949 CB LEU C 262 -21.714 -72.752 15.687 1.00105.82 C ANISOU21949 CB LEU C 262 16345 11321 12539 -2266 -2902 -294 C ATOM 21950 CG LEU C 262 -21.451 -72.454 17.141 1.00109.10 C ANISOU21950 CG LEU C 262 16705 11739 13007 -2310 -2807 -220 C ATOM 21951 CD1 LEU C 262 -22.678 -72.764 17.959 1.00109.86 C ANISOU21951 CD1 LEU C 262 16734 11840 13170 -2515 -2831 -161 C ATOM 21952 CD2 LEU C 262 -20.261 -73.242 17.653 1.00110.89 C ANISOU21952 CD2 LEU C 262 17092 11832 13211 -2242 -2816 -239 C ATOM 21953 N THR C 263 -21.711 -72.375 12.455 1.00111.87 N ANISOU21953 N THR C 263 17169 12171 13166 -2054 -3020 -446 N ATOM 21954 CA THR C 263 -22.096 -72.897 11.153 1.00113.39 C ANISOU21954 CA THR C 263 17450 12332 13302 -2036 -3138 -523 C ATOM 21955 C THR C 263 -21.015 -72.666 10.101 1.00120.13 C ANISOU21955 C THR C 263 18376 13199 14069 -1833 -3119 -586 C ATOM 21956 O THR C 263 -20.837 -73.517 9.237 1.00121.16 O ANISOU21956 O THR C 263 18657 13239 14140 -1786 -3217 -662 O ATOM 21957 CB THR C 263 -23.478 -72.357 10.795 1.00117.77 C ANISOU21957 CB THR C 263 17872 12989 13886 -2147 -3174 -504 C ATOM 21958 OG1 THR C 263 -24.358 -72.624 11.892 1.00115.90 O ANISOU21958 OG1 THR C 263 17573 12737 13729 -2335 -3185 -444 O ATOM 21959 CG2 THR C 263 -24.036 -72.962 9.534 1.00117.43 C ANISOU21959 CG2 THR C 263 17917 12913 13790 -2151 -3308 -581 C ATOM 21960 N GLN C 264 -20.288 -71.540 10.169 1.00118.24 N ANISOU21960 N GLN C 264 18035 13070 13820 -1714 -2994 -556 N ATOM 21961 CA GLN C 264 -19.197 -71.254 9.224 1.00119.49 C ANISOU21961 CA GLN C 264 18248 13257 13897 -1521 -2958 -608 C ATOM 21962 C GLN C 264 -17.949 -72.045 9.600 1.00126.37 C ANISOU21962 C GLN C 264 19258 14017 14739 -1429 -2950 -640 C ATOM 21963 O GLN C 264 -17.087 -72.294 8.751 1.00126.09 O ANISOU21963 O GLN C 264 19324 13958 14626 -1286 -2968 -706 O ATOM 21964 CB GLN C 264 -18.889 -69.745 9.164 1.00119.88 C ANISOU21964 CB GLN C 264 18140 13458 13950 -1438 -2825 -558 C ATOM 21965 CG GLN C 264 -19.556 -69.019 7.995 1.00141.97 C ANISOU21965 CG GLN C 264 20870 16364 16710 -1404 -2843 -575 C ATOM 21966 CD GLN C 264 -21.066 -69.023 8.087 1.00164.90 C ANISOU21966 CD GLN C 264 23700 19294 19661 -1564 -2919 -556 C ATOM 21967 OE1 GLN C 264 -21.661 -68.437 8.999 1.00161.82 O ANISOU21967 OE1 GLN C 264 23181 18956 19346 -1670 -2871 -487 O ATOM 21968 NE2 GLN C 264 -21.715 -69.694 7.144 1.00154.94 N ANISOU21968 NE2 GLN C 264 22514 18002 18355 -1581 -3039 -618 N ATOM 21969 N MET C 265 -17.861 -72.415 10.892 1.00125.46 N ANISOU21969 N MET C 265 19142 13840 14685 -1508 -2920 -591 N ATOM 21970 CA MET C 265 -16.798 -73.208 11.505 1.00126.70 C ANISOU21970 CA MET C 265 19422 13888 14831 -1444 -2914 -607 C ATOM 21971 C MET C 265 -16.962 -74.611 10.970 1.00135.69 C ANISOU21971 C MET C 265 20747 14876 15932 -1470 -3058 -679 C ATOM 21972 O MET C 265 -15.990 -75.236 10.547 1.00135.56 O ANISOU21972 O MET C 265 20866 14785 15854 -1342 -3084 -742 O ATOM 21973 CB MET C 265 -16.989 -73.219 13.033 1.00128.40 C ANISOU21973 CB MET C 265 19575 14082 15128 -1558 -2858 -527 C ATOM 21974 CG MET C 265 -15.707 -73.305 13.799 1.00131.45 C ANISOU21974 CG MET C 265 20022 14414 15508 -1460 -2798 -523 C ATOM 21975 SD MET C 265 -15.376 -71.782 14.713 1.00133.98 S ANISOU21975 SD MET C 265 20156 14870 15879 -1429 -2628 -438 S ATOM 21976 CE MET C 265 -14.605 -70.759 13.417 1.00130.06 C ANISOU21976 CE MET C 265 19603 14502 15313 -1243 -2559 -477 C ATOM 21977 N ASP C 266 -18.231 -75.064 10.952 1.00136.49 N ANISOU21977 N ASP C 266 20851 14938 16069 -1638 -3152 -671 N ATOM 21978 CA ASP C 266 -18.745 -76.350 10.491 1.00139.40 C ANISOU21978 CA ASP C 266 21381 15166 16419 -1714 -3302 -728 C ATOM 21979 C ASP C 266 -18.311 -76.730 9.080 1.00145.99 C ANISOU21979 C ASP C 266 22335 15974 17160 -1586 -3381 -827 C ATOM 21980 O ASP C 266 -18.036 -77.910 8.859 1.00146.74 O ANISOU21980 O ASP C 266 22608 15925 17220 -1577 -3485 -889 O ATOM 21981 CB ASP C 266 -20.281 -76.337 10.557 1.00142.26 C ANISOU21981 CB ASP C 266 21665 15546 16842 -1921 -3364 -690 C ATOM 21982 CG ASP C 266 -20.901 -77.464 11.345 1.00155.18 C ANISOU21982 CG ASP C 266 23432 17025 18506 -2072 -3481 -697 C ATOM 21983 OD1 ASP C 266 -20.302 -77.874 12.371 1.00155.41 O ANISOU21983 OD1 ASP C 266 23547 16950 18551 -2076 -3467 -677 O ATOM 21984 OD2 ASP C 266 -22.010 -77.908 10.969 1.00163.35 O ANISOU21984 OD2 ASP C 266 24478 18041 19549 -2196 -3585 -716 O ATOM 21985 N GLN C 267 -18.270 -75.750 8.131 1.00143.45 N ANISOU21985 N GLN C 267 21921 15786 16796 -1487 -3334 -843 N ATOM 21986 CA GLN C 267 -17.888 -75.967 6.729 1.00144.92 C ANISOU21986 CA GLN C 267 22206 15969 16887 -1358 -3397 -934 C ATOM 21987 C GLN C 267 -16.608 -76.809 6.546 1.00152.46 C ANISOU21987 C GLN C 267 23333 16820 17774 -1204 -3415 -1002 C ATOM 21988 O GLN C 267 -16.701 -77.913 5.983 1.00154.71 O ANISOU21988 O GLN C 267 23784 16981 18016 -1205 -3541 -1076 O ATOM 21989 CB GLN C 267 -17.877 -74.660 5.907 1.00145.27 C ANISOU21989 CB GLN C 267 22117 16183 16898 -1268 -3320 -925 C ATOM 21990 CG GLN C 267 -17.698 -74.853 4.383 1.00163.07 C ANISOU21990 CG GLN C 267 24467 18446 19047 -1139 -3385 -1015 C ATOM 21991 CD GLN C 267 -18.707 -75.777 3.709 1.00181.28 C ANISOU21991 CD GLN C 267 26883 20663 21332 -1231 -3548 -1078 C ATOM 21992 OE1 GLN C 267 -18.466 -76.982 3.514 1.00175.51 O ANISOU21992 OE1 GLN C 267 26328 19791 20568 -1217 -3646 -1143 O ATOM 21993 NE2 GLN C 267 -19.837 -75.221 3.289 1.00172.09 N ANISOU21993 NE2 GLN C 267 25621 19582 20184 -1319 -3584 -1063 N ATOM 21994 N ASP C 268 -15.439 -76.315 7.047 1.00148.04 N ATOM 21995 CA ASP C 268 -14.151 -77.032 7.005 1.00175.06 C ATOM 21996 C ASP C 268 -13.152 -76.475 8.021 1.00191.26 C ATOM 21997 O ASP C 268 -13.027 -77.011 9.124 1.00147.34 O ATOM 21998 CB ASP C 268 -13.547 -77.085 5.581 1.00177.43 C ATOM 21999 CG ASP C 268 -13.733 -78.425 4.874 1.00185.95 C ATOM 22000 OD1 ASP C 268 -13.015 -79.386 5.227 1.00186.40 O ATOM 22001 OD2 ASP C 268 -14.582 -78.503 3.951 1.00190.36 O