>>3UON:HELIX   20  20 LYS A  383  CYS A  413  1                                  31    
KKVTRTILAILLAFIITWAPYNVMVLINTFC
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 20 LYS A 383 CYS A 413 1 31 ATOM 2861 N LYS A 383 3.390 10.137 25.135 1.00 53.16 N ATOM 2862 CA LYS A 383 4.664 9.426 25.150 1.00 59.98 C ATOM 2863 C LYS A 383 5.539 9.807 23.960 1.00 63.06 C ATOM 2864 O LYS A 383 5.032 10.138 22.887 1.00 62.42 O ATOM 2865 CB LYS A 383 4.435 7.914 25.142 1.00 60.15 C ATOM 2866 CG LYS A 383 3.927 7.341 26.447 1.00 64.07 C ATOM 2867 CD LYS A 383 3.884 5.823 26.371 1.00 72.17 C ATOM 2868 CE LYS A 383 3.730 5.196 27.746 1.00 78.25 C ATOM 2869 NZ LYS A 383 3.834 3.712 27.680 1.00 71.54 N ATOM 2870 N LYS A 384 6.853 9.749 24.152 1.00 56.48 N ATOM 2871 CA LYS A 384 7.790 9.991 23.062 1.00 53.75 C ATOM 2872 C LYS A 384 7.631 8.924 21.984 1.00 56.71 C ATOM 2873 O LYS A 384 7.748 9.209 20.792 1.00 59.61 O ATOM 2874 CB LYS A 384 9.234 10.006 23.572 1.00 50.25 C ATOM 2875 CG LYS A 384 9.570 11.166 24.492 1.00 58.43 C ATOM 2876 CD LYS A 384 11.063 11.208 24.795 1.00 52.65 C ATOM 2877 CE LYS A 384 11.415 12.369 25.713 1.00 53.59 C ATOM 2878 NZ LYS A 384 10.992 13.679 25.143 1.00 56.46 N ATOM 2879 N VAL A 385 7.358 7.696 22.415 1.00 56.49 N ATOM 2880 CA VAL A 385 7.209 6.574 21.496 1.00 50.90 C ATOM 2881 C VAL A 385 5.982 6.725 20.595 1.00 53.05 C ATOM 2882 O VAL A 385 6.075 6.553 19.380 1.00 57.85 O ATOM 2883 CB VAL A 385 7.143 5.231 22.249 1.00 45.53 C ATOM 2884 CG1 VAL A 385 6.065 5.271 23.320 1.00 51.88 C ATOM 2885 CG2 VAL A 385 6.901 4.088 21.277 1.00 49.10 C ATOM 2886 N THR A 386 4.837 7.048 21.189 1.00 52.33 N ATOM 2887 CA THR A 386 3.609 7.228 20.419 1.00 53.15 C ATOM 2888 C THR A 386 3.715 8.479 19.562 1.00 53.38 C ATOM 2889 O THR A 386 3.251 8.513 18.423 1.00 51.90 O ATOM 2890 CB THR A 386 2.378 7.364 21.331 1.00 46.03 C ATOM 2891 OG1 THR A 386 2.448 8.600 22.052 1.00 56.30 O ATOM 2892 CG2 THR A 386 2.310 6.207 22.314 1.00 38.46 C ATOM 2893 N ARG A 387 4.335 9.509 20.125 1.00 50.77 N ATOM 2894 CA ARG A 387 4.514 10.778 19.436 1.00 50.58 C ATOM 2895 C ARG A 387 5.361 10.586 18.181 1.00 57.87 C ATOM 2896 O ARG A 387 5.039 11.108 17.114 1.00 54.91 O ATOM 2897 CB ARG A 387 5.177 11.783 20.377 1.00 49.71 C ATOM 2898 CG ARG A 387 4.701 13.211 20.213 1.00 60.32 C ATOM 2899 CD ARG A 387 4.948 13.986 21.493 1.00 66.02 C ATOM 2900 NE ARG A 387 6.269 13.695 22.040 1.00 62.15 N ATOM 2901 CZ ARG A 387 6.715 14.154 23.203 1.00 66.61 C ATOM 2902 NH1 ARG A 387 5.944 14.931 23.951 1.00 74.63 N ATOM 2903 NH2 ARG A 387 7.933 13.835 23.618 1.00 61.09 N ATOM 2904 N THR A 388 6.445 9.830 18.321 1.00 52.70 N ATOM 2905 CA THR A 388 7.328 9.527 17.201 1.00 44.10 C ATOM 2906 C THR A 388 6.636 8.641 16.171 1.00 50.75 C ATOM 2907 O THR A 388 6.622 8.946 14.977 1.00 54.34 O ATOM 2908 CB THR A 388 8.611 8.822 17.676 1.00 43.08 C ATOM 2909 OG1 THR A 388 9.388 9.726 18.470 1.00 51.61 O ATOM 2910 CG2 THR A 388 9.439 8.364 16.487 1.00 49.30 C ATOM 2911 N ILE A 389 6.061 7.543 16.646 1.00 48.54 N ATOM 2912 CA ILE A 389 5.380 6.591 15.778 1.00 48.82 C ATOM 2913 C ILE A 389 4.382 7.262 14.839 1.00 45.23 C ATOM 2914 O ILE A 389 4.342 6.963 13.647 1.00 46.93 O ATOM 2915 CB ILE A 389 4.665 5.504 16.603 1.00 48.89 C ATOM 2916 CG1 ILE A 389 5.692 4.534 17.190 1.00 50.73 C ATOM 2917 CG2 ILE A 389 3.652 4.761 15.750 1.00 44.75 C ATOM 2918 CD1 ILE A 389 5.104 3.530 18.152 1.00 57.41 C ATOM 2919 N LEU A 390 3.583 8.176 15.378 1.00 41.76 N ATOM 2920 CA LEU A 390 2.574 8.864 14.580 1.00 48.79 C ATOM 2921 C LEU A 390 3.208 9.613 13.410 1.00 49.21 C ATOM 2922 O LEU A 390 2.771 9.482 12.265 1.00 44.77 O ATOM 2923 CB LEU A 390 1.761 9.830 15.446 1.00 46.64 C ATOM 2924 CG LEU A 390 0.626 10.567 14.726 1.00 44.58 C ATOM 2925 CD1 LEU A 390 -0.357 9.574 14.109 1.00 26.05 C ATOM 2926 CD2 LEU A 390 -0.087 11.536 15.664 1.00 28.97 C ATOM 2927 N ALA A 391 4.240 10.396 13.707 1.00 47.56 N ATOM 2928 CA ALA A 391 4.935 11.174 12.688 1.00 42.84 C ATOM 2929 C ALA A 391 5.526 10.263 11.617 1.00 52.53 C ATOM 2930 O ALA A 391 5.450 10.558 10.421 1.00 47.67 O ATOM 2931 CB ALA A 391 6.024 12.024 13.321 1.00 37.78 C ATOM 2932 N ILE A 392 6.117 9.156 12.056 1.00 49.67 N ATOM 2933 CA ILE A 392 6.697 8.183 11.141 1.00 42.99 C ATOM 2934 C ILE A 392 5.657 7.687 10.145 1.00 41.94 C ATOM 2935 O ILE A 392 5.905 7.654 8.941 1.00 48.65 O ATOM 2936 CB ILE A 392 7.287 6.978 11.896 1.00 45.09 C ATOM 2937 CG1 ILE A 392 8.459 7.423 12.772 1.00 43.64 C ATOM 2938 CG2 ILE A 392 7.739 5.910 10.915 1.00 47.09 C ATOM 2939 CD1 ILE A 392 9.586 8.063 11.994 1.00 53.13 C ATOM 2940 N LEU A 393 4.492 7.306 10.657 1.00 41.62 N ATOM 2941 CA LEU A 393 3.409 6.814 9.814 1.00 41.66 C ATOM 2942 C LEU A 393 2.931 7.879 8.834 1.00 44.99 C ATOM 2943 O LEU A 393 2.871 7.639 7.628 1.00 47.49 O ATOM 2944 CB LEU A 393 2.246 6.311 10.669 1.00 39.43 C ATOM 2945 CG LEU A 393 2.511 4.997 11.406 1.00 48.12 C ATOM 2946 CD1 LEU A 393 1.312 4.598 12.256 1.00 48.94 C ATOM 2947 CD2 LEU A 393 2.864 3.894 10.415 1.00 38.91 C ATOM 2948 N LEU A 394 2.590 9.053 9.356 1.00 44.69 N ATOM 2949 CA LEU A 394 2.181 10.170 8.511 1.00 40.71 C ATOM 2950 C LEU A 394 3.163 10.362 7.362 1.00 48.53 C ATOM 2951 O LEU A 394 2.780 10.330 6.191 1.00 44.21 O ATOM 2952 CB LEU A 394 2.066 11.457 9.331 1.00 41.14 C ATOM 2953 CG LEU A 394 0.749 11.649 10.086 1.00 56.59 C ATOM 2954 CD1 LEU A 394 0.893 12.692 11.190 1.00 50.79 C ATOM 2955 CD2 LEU A 394 -0.361 12.027 9.114 1.00 48.01 C ATOM 2956 N ALA A 395 4.433 10.551 7.705 1.00 46.98 N ATOM 2957 CA ALA A 395 5.477 10.741 6.707 1.00 42.58 C ATOM 2958 C ALA A 395 5.491 9.597 5.698 1.00 49.02 C ATOM 2959 O ALA A 395 5.532 9.825 4.489 1.00 50.31 O ATOM 2960 CB ALA A 395 6.834 10.877 7.380 1.00 43.51 C ATOM 2961 N PHE A 396 5.447 8.366 6.201 1.00 47.08 N ATOM 2962 CA PHE A 396 5.463 7.190 5.338 1.00 44.88 C ATOM 2963 C PHE A 396 4.319 7.194 4.330 1.00 49.46 C ATOM 2964 O PHE A 396 4.542 7.064 3.126 1.00 44.19 O ATOM 2965 CB PHE A 396 5.420 5.904 6.166 1.00 40.59 C ATOM 2966 CG PHE A 396 5.162 4.671 5.351 1.00 45.22 C ATOM 2967 CD1 PHE A 396 3.928 4.043 5.390 1.00 39.16 C ATOM 2968 CD2 PHE A 396 6.151 4.150 4.533 1.00 48.41 C ATOM 2969 CE1 PHE A 396 3.690 2.910 4.636 1.00 47.54 C ATOM 2970 CE2 PHE A 396 5.919 3.019 3.776 1.00 44.82 C ATOM 2971 CZ PHE A 396 4.688 2.398 3.828 1.00 47.86 C ATOM 2972 N ILE A 397 3.096 7.343 4.827 1.00 52.14 N ATOM 2973 CA ILE A 397 1.914 7.289 3.970 1.00 49.88 C ATOM 2974 C ILE A 397 1.835 8.462 2.989 1.00 49.23 C ATOM 2975 O ILE A 397 1.536 8.272 1.812 1.00 46.96 O ATOM 2976 CB ILE A 397 0.607 7.203 4.792 1.00 45.79 C ATOM 2977 CG1 ILE A 397 -0.598 7.043 3.862 1.00 50.73 C ATOM 2978 CG2 ILE A 397 0.446 8.424 5.680 1.00 46.17 C ATOM 2979 CD1 ILE A 397 -1.924 7.007 4.588 1.00 62.58 C ATOM 2980 N ILE A 398 2.119 9.669 3.469 1.00 52.65 N ATOM 2981 CA ILE A 398 2.033 10.860 2.626 1.00 49.87 C ATOM 2982 C ILE A 398 3.057 10.853 1.491 1.00 51.73 C ATOM 2983 O ILE A 398 2.809 11.404 0.419 1.00 54.10 O ATOM 2984 CB ILE A 398 2.212 12.155 3.439 1.00 53.02 C ATOM 2985 CG1 ILE A 398 2.022 13.376 2.537 1.00 54.77 C ATOM 2986 CG2 ILE A 398 3.580 12.195 4.088 1.00 60.84 C ATOM 2987 CD1 ILE A 398 2.357 14.688 3.203 1.00 59.22 C ATOM 2988 N THR A 399 4.203 10.223 1.725 1.00 48.72 N ATOM 2989 CA THR A 399 5.285 10.208 0.740 1.00 49.45 C ATOM 2990 C THR A 399 5.209 9.022 -0.220 1.00 44.12 C ATOM 2991 O THR A 399 5.668 9.110 -1.358 1.00 45.39 O ATOM 2992 CB THR A 399 6.666 10.188 1.420 1.00 49.07 C ATOM 2993 OG1 THR A 399 6.749 9.057 2.296 1.00 51.47 O ATOM 2994 CG2 THR A 399 6.888 11.464 2.214 1.00 39.49 C ATOM 2995 N TRP A 400 4.638 7.915 0.244 1.00 40.27 N ATOM 2996 CA TRP A 400 4.552 6.699 -0.557 1.00 36.64 C ATOM 2997 C TRP A 400 3.237 6.584 -1.330 1.00 37.77 C ATOM 2998 O TRP A 400 3.189 5.941 -2.375 1.00 41.38 O ATOM 2999 CB TRP A 400 4.742 5.465 0.327 1.00 39.93 C ATOM 3000 CG TRP A 400 6.150 5.253 0.810 1.00 40.81 C ATOM 3001 CD1 TRP A 400 6.948 6.159 1.447 1.00 45.46 C ATOM 3002 CD2 TRP A 400 6.909 4.044 0.714 1.00 44.58 C ATOM 3003 NE1 TRP A 400 8.165 5.590 1.744 1.00 44.14 N ATOM 3004 CE2 TRP A 400 8.167 4.292 1.307 1.00 44.50 C ATOM 3005 CE3 TRP A 400 6.654 2.777 0.183 1.00 40.08 C ATOM 3006 CZ2 TRP A 400 9.162 3.320 1.378 1.00 46.78 C ATOM 3007 CZ3 TRP A 400 7.642 1.814 0.254 1.00 39.01 C ATOM 3008 CH2 TRP A 400 8.882 2.090 0.847 1.00 46.24 C ATOM 3009 N ALA A 401 2.173 7.194 -0.815 1.00 34.20 N ATOM 3010 CA ALA A 401 0.868 7.123 -1.472 1.00 32.85 C ATOM 3011 C ALA A 401 0.891 7.673 -2.898 1.00 41.16 C ATOM 3012 O ALA A 401 0.374 7.031 -3.817 1.00 38.36 O ATOM 3013 CB ALA A 401 -0.199 7.830 -0.641 1.00 36.34 C ATOM 3014 N PRO A 402 1.486 8.865 -3.089 1.00 47.32 N ATOM 3015 CA PRO A 402 1.569 9.450 -4.432 1.00 47.03 C ATOM 3016 C PRO A 402 2.065 8.442 -5.463 1.00 42.66 C ATOM 3017 O PRO A 402 1.409 8.223 -6.481 1.00 38.74 O ATOM 3018 CB PRO A 402 2.602 10.567 -4.258 1.00 40.09 C ATOM 3019 CG PRO A 402 2.461 10.980 -2.834 1.00 40.83 C ATOM 3020 CD PRO A 402 2.134 9.720 -2.076 1.00 43.79 C ATOM 3021 N TYR A 403 3.215 7.835 -5.192 1.00 45.31 N ATOM 3022 CA TYR A 403 3.801 6.870 -6.111 1.00 42.00 C ATOM 3023 C TYR A 403 2.888 5.672 -6.357 1.00 40.20 C ATOM 3024 O TYR A 403 2.662 5.274 -7.495 1.00 43.37 O ATOM 3025 CB TYR A 403 5.155 6.386 -5.596 1.00 37.95 C ATOM 3026 CG TYR A 403 5.837 5.445 -6.555 1.00 40.56 C ATOM 3027 CD1 TYR A 403 6.777 5.910 -7.465 1.00 44.64 C ATOM 3028 CD2 TYR A 403 5.525 4.092 -6.566 1.00 44.18 C ATOM 3029 CE1 TYR A 403 7.396 5.052 -8.350 1.00 49.21 C ATOM 3030 CE2 TYR A 403 6.139 3.226 -7.448 1.00 50.17 C ATOM 3031 CZ TYR A 403 7.075 3.711 -8.338 1.00 49.34 C ATOM 3032 OH TYR A 403 7.691 2.853 -9.220 1.00 42.01 O ATOM 3033 N ASN A 404 2.366 5.099 -5.280 1.00 42.44 N ATOM 3034 CA ASN A 404 1.542 3.901 -5.378 1.00 41.05 C ATOM 3035 C ASN A 404 0.180 4.146 -6.023 1.00 44.08 C ATOM 3036 O ASN A 404 -0.322 3.293 -6.755 1.00 46.41 O ATOM 3037 CB ASN A 404 1.381 3.237 -4.008 1.00 45.25 C ATOM 3038 CG ASN A 404 2.655 2.574 -3.531 1.00 41.40 C ATOM 3039 OD1 ASN A 404 2.870 1.382 -3.760 1.00 36.85 O ATOM 3040 ND2 ASN A 404 3.511 3.342 -2.864 1.00 37.04 N ATOM 3041 N VAL A 405 -0.423 5.300 -5.756 1.00 46.41 N ATOM 3042 CA VAL A 405 -1.664 5.646 -6.440 1.00 53.93 C ATOM 3043 C VAL A 405 -1.346 5.964 -7.899 1.00 50.59 C ATOM 3044 O VAL A 405 -2.217 5.914 -8.770 1.00 54.36 O ATOM 3045 CB VAL A 405 -2.398 6.832 -5.779 1.00 43.19 C ATOM 3046 CG1 VAL A 405 -1.594 8.111 -5.920 1.00 41.90 C ATOM 3047 CG2 VAL A 405 -3.786 7.006 -6.390 1.00 35.63 C ATOM 3048 N MET A 406 -0.082 6.284 -8.155 1.00 41.20 N ATOM 3049 CA MET A 406 0.396 6.511 -9.513 1.00 43.15 C ATOM 3050 C MET A 406 0.393 5.187 -10.264 1.00 49.06 C ATOM 3051 O MET A 406 0.028 5.122 -11.437 1.00 48.47 O ATOM 3052 CB MET A 406 1.809 7.095 -9.486 1.00 38.64 C ATOM 3053 CG MET A 406 1.976 8.391 -10.263 1.00 34.72 C ATOM 3054 SD MET A 406 3.231 9.447 -9.519 1.00 47.21 S ATOM 3055 CE MET A 406 4.608 8.314 -9.378 1.00 43.43 C ATOM 3056 N VAL A 407 0.800 4.130 -9.568 1.00 42.65 N ATOM 3057 CA VAL A 407 0.785 2.787 -10.127 1.00 40.89 C ATOM 3058 C VAL A 407 -0.650 2.368 -10.433 1.00 45.37 C ATOM 3059 O VAL A 407 -0.951 1.907 -11.531 1.00 49.66 O ATOM 3060 CB VAL A 407 1.423 1.775 -9.160 1.00 34.58 C ATOM 3061 CG1 VAL A 407 1.201 0.351 -9.650 1.00 37.47 C ATOM 3062 CG2 VAL A 407 2.906 2.071 -8.987 1.00 33.30 C ATOM 3063 N LEU A 408 -1.530 2.533 -9.451 1.00 51.01 N ATOM 3064 CA LEU A 408 -2.949 2.233 -9.618 1.00 53.97 C ATOM 3065 C LEU A 408 -3.501 2.868 -10.892 1.00 52.91 C ATOM 3066 O LEU A 408 -4.025 2.179 -11.767 1.00 50.98 O ATOM 3067 CB LEU A 408 -3.736 2.721 -8.398 1.00 51.19 C ATOM 3068 CG LEU A 408 -5.256 2.802 -8.551 1.00 55.21 C ATOM 3069 CD1 LEU A 408 -5.829 1.482 -9.053 1.00 56.04 C ATOM 3070 CD2 LEU A 408 -5.898 3.209 -7.234 1.00 60.61 C ATOM 3071 N ILE A 409 -3.376 4.188 -10.989 1.00 50.30 N ATOM 3072 CA ILE A 409 -3.859 4.920 -12.155 1.00 54.20 C ATOM 3073 C ILE A 409 -3.213 4.414 -13.444 1.00 54.73 C ATOM 3074 O ILE A 409 -3.865 4.323 -14.487 1.00 49.46 O ATOM 3075 CB ILE A 409 -3.608 6.434 -12.012 1.00 50.52 C ATOM 3076 CG1 ILE A 409 -4.428 6.994 -10.848 1.00 53.24 C ATOM 3077 CG2 ILE A 409 -3.946 7.160 -13.308 1.00 42.56 C ATOM 3078 CD1 ILE A 409 -4.287 8.489 -10.659 1.00 52.05 C ATOM 3079 N ASN A 410 -1.931 4.076 -13.358 1.00 52.78 N ATOM 3080 CA ASN A 410 -1.190 3.571 -14.508 1.00 50.85 C ATOM 3081 C ASN A 410 -1.764 2.273 -15.063 1.00 52.23 C ATOM 3082 O ASN A 410 -1.481 1.893 -16.198 1.00 47.83 O ATOM 3083 CB ASN A 410 0.280 3.359 -14.144 1.00 52.67 C ATOM 3084 CG ASN A 410 1.081 2.765 -15.285 1.00 48.44 C ATOM 3085 OD1 ASN A 410 1.585 3.486 -16.146 1.00 57.87 O ATOM 3086 ND2 ASN A 410 1.202 1.443 -15.298 1.00 45.87 N ATOM 3087 N THR A 411 -2.573 1.594 -14.256 1.00 55.60 N ATOM 3088 CA THR A 411 -3.100 0.292 -14.635 1.00 49.25 C ATOM 3089 C THR A 411 -4.080 0.403 -15.801 1.00 48.32 C ATOM 3090 O THR A 411 -4.058 -0.423 -16.716 1.00 44.86 O ATOM 3091 CB THR A 411 -3.755 -0.433 -13.436 1.00 48.28 C ATOM 3092 OG1 THR A 411 -3.669 -1.850 -13.626 1.00 48.07 O ATOM 3093 CG2 THR A 411 -5.217 -0.020 -13.271 1.00 48.13 C ATOM 3094 N PHE A 412 -4.925 1.429 -15.778 1.00 52.33 N ATOM 3095 CA PHE A 412 -5.916 1.603 -16.832 1.00 54.75 C ATOM 3096 C PHE A 412 -5.508 2.677 -17.836 1.00 62.23 C ATOM 3097 O PHE A 412 -5.993 2.695 -18.968 1.00 67.97 O ATOM 3098 CB PHE A 412 -7.306 1.902 -16.249 1.00 58.09 C ATOM 3099 CG PHE A 412 -7.334 3.049 -15.270 1.00 59.54 C ATOM 3100 CD1 PHE A 412 -7.240 4.361 -15.710 1.00 61.98 C ATOM 3101 CD2 PHE A 412 -7.489 2.814 -13.910 1.00 54.96 C ATOM 3102 CE1 PHE A 412 -7.279 5.415 -14.812 1.00 62.43 C ATOM 3103 CE2 PHE A 412 -7.530 3.864 -13.008 1.00 51.95 C ATOM 3104 CZ PHE A 412 -7.425 5.165 -13.460 1.00 59.61 C ATOM 3105 N CYS A 413 -4.612 3.567 -17.423 1.00 58.47 N ATOM 3106 CA CYS A 413 -4.184 4.660 -18.287 1.00 56.94 C ATOM 3107 C CYS A 413 -2.725 5.035 -18.056 1.00 57.56 C ATOM 3108 O CYS A 413 -2.396 5.739 -17.102 1.00 55.85 O ATOM 3109 CB CYS A 413 -5.084 5.881 -18.090 1.00 53.40 C ATOM 3110 SG CYS A 413 -4.602 7.314 -19.076 1.00 83.02 S