>>3W96:HELIX   20  20 GLN E   85  ALA E  114  1                                  30    
QSSAVMALQEACEAYLVGLFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 20 20 GLN E 85 ALA E 114 1 30 ATOM 3390 N GLN E 85 6.119 32.588 -37.850 1.00 74.20 N ATOM 3391 CA GLN E 85 6.985 31.434 -37.692 1.00 76.45 C ATOM 3392 C GLN E 85 7.241 30.860 -39.063 1.00 77.99 C ATOM 3393 O GLN E 85 6.332 30.791 -39.876 1.00 81.15 O ATOM 3394 CB GLN E 85 6.329 30.359 -36.822 1.00 69.02 C ATOM 3395 CG GLN E 85 5.770 30.861 -35.515 1.00 68.94 C ATOM 3396 CD GLN E 85 5.710 29.775 -34.475 1.00 72.16 C ATOM 3397 OE1 GLN E 85 5.299 28.655 -34.763 1.00 79.19 O ATOM 3398 NE2 GLN E 85 6.111 30.100 -33.253 1.00 67.18 N ATOM 3399 N SER E 86 8.475 30.459 -39.330 1.00 81.69 N ATOM 3400 CA SER E 86 8.798 29.875 -40.624 1.00 84.23 C ATOM 3401 C SER E 86 7.633 29.000 -41.057 1.00 82.67 C ATOM 3402 O SER E 86 7.164 29.078 -42.189 1.00 73.68 O ATOM 3403 CB SER E 86 10.068 29.014 -40.521 1.00 90.87 C ATOM 3404 OG SER E 86 9.864 27.864 -39.704 1.00 90.61 O ATOM 3405 N SER E 87 7.165 28.180 -40.121 1.00 85.64 N ATOM 3406 CA SER E 87 6.059 27.255 -40.357 1.00 83.99 C ATOM 3407 C SER E 87 4.675 27.892 -40.521 1.00 78.02 C ATOM 3408 O SER E 87 3.903 27.426 -41.337 1.00 78.89 O ATOM 3409 CB SER E 87 6.002 26.215 -39.234 1.00 86.08 C ATOM 3410 OG SER E 87 6.055 26.837 -37.956 1.00 91.42 O ATOM 3411 N ALA E 88 4.352 28.936 -39.762 1.00 72.97 N ATOM 3412 CA ALA E 88 3.042 29.550 -39.887 1.00 66.91 C ATOM 3413 C ALA E 88 2.752 29.922 -41.313 1.00 70.41 C ATOM 3414 O ALA E 88 1.652 29.693 -41.800 1.00 74.09 O ATOM 3415 CB ALA E 88 2.936 30.758 -39.032 1.00 61.17 C ATOM 3416 N VAL E 89 3.719 30.511 -41.996 1.00 65.34 N ATOM 3417 CA VAL E 89 3.473 30.857 -43.376 1.00 65.15 C ATOM 3418 C VAL E 89 3.287 29.558 -44.163 1.00 72.59 C ATOM 3419 O VAL E 89 2.315 29.420 -44.905 1.00 77.82 O ATOM 3420 CB VAL E 89 4.619 31.658 -43.968 1.00 61.02 C ATOM 3421 CG1 VAL E 89 4.444 31.778 -45.454 1.00 59.16 C ATOM 3422 CG2 VAL E 89 4.653 33.009 -43.345 1.00 57.29 C ATOM 3423 N MET E 90 4.188 28.588 -43.997 1.00 72.93 N ATOM 3424 CA MET E 90 4.043 27.339 -44.739 1.00 71.96 C ATOM 3425 C MET E 90 2.639 26.814 -44.587 1.00 69.57 C ATOM 3426 O MET E 90 2.030 26.444 -45.573 1.00 72.58 O ATOM 3427 CB MET E 90 5.047 26.272 -44.292 1.00 76.61 C ATOM 3428 CG MET E 90 6.387 26.347 -45.000 1.00 77.48 C ATOM 3429 SD MET E 90 6.197 26.767 -46.757 1.00 89.45 S ATOM 3430 CE MET E 90 6.792 28.508 -46.753 1.00 78.73 C ATOM 3431 N ALA E 91 2.123 26.796 -43.359 1.00 65.06 N ATOM 3432 CA ALA E 91 0.754 26.332 -43.066 1.00 61.24 C ATOM 3433 C ALA E 91 -0.249 27.023 -43.974 1.00 61.88 C ATOM 3434 O ALA E 91 -0.979 26.386 -44.727 1.00 62.32 O ATOM 3435 CB ALA E 91 0.393 26.628 -41.613 1.00 52.27 C ATOM 3436 N LEU E 92 -0.287 28.342 -43.880 1.00 59.13 N ATOM 3437 CA LEU E 92 -1.174 29.116 -44.694 1.00 59.20 C ATOM 3438 C LEU E 92 -1.076 28.705 -46.148 1.00 67.11 C ATOM 3439 O LEU E 92 -2.094 28.467 -46.785 1.00 74.36 O ATOM 3440 CB LEU E 92 -0.859 30.592 -44.548 1.00 55.27 C ATOM 3441 CG LEU E 92 -1.379 31.238 -43.273 1.00 55.38 C ATOM 3442 CD1 LEU E 92 -1.138 32.712 -43.337 1.00 59.54 C ATOM 3443 CD2 LEU E 92 -2.851 31.002 -43.153 1.00 56.81 C ATOM 3444 N GLN E 93 0.136 28.601 -46.686 1.00 70.27 N ATOM 3445 CA GLN E 93 0.297 28.222 -48.097 1.00 70.90 C ATOM 3446 C GLN E 93 -0.222 26.804 -48.424 1.00 70.56 C ATOM 3447 O GLN E 93 -0.605 26.517 -49.559 1.00 64.32 O ATOM 3448 CB GLN E 93 1.768 28.340 -48.512 1.00 66.39 C ATOM 3449 CG GLN E 93 1.939 28.813 -49.946 1.00 65.40 C ATOM 3450 CD GLN E 93 3.285 28.453 -50.539 1.00 70.41 C ATOM 3451 OE1 GLN E 93 4.323 28.617 -49.902 1.00 73.26 O ATOM 3452 NE2 GLN E 93 3.273 27.964 -51.777 1.00 74.29 N ATOM 3453 N GLU E 94 -0.219 25.927 -47.422 1.00 70.51 N ATOM 3454 CA GLU E 94 -0.685 24.561 -47.588 1.00 70.10 C ATOM 3455 C GLU E 94 -2.181 24.575 -47.700 1.00 70.52 C ATOM 3456 O GLU E 94 -2.754 23.900 -48.548 1.00 68.96 O ATOM 3457 CB GLU E 94 -0.304 23.708 -46.390 1.00 73.05 C ATOM 3458 CG GLU E 94 1.088 23.156 -46.447 1.00 82.43 C ATOM 3459 CD GLU E 94 1.306 22.246 -47.645 1.00 90.11 C ATOM 3460 OE1 GLU E 94 0.596 21.220 -47.758 1.00 92.14 O ATOM 3461 OE2 GLU E 94 2.189 22.550 -48.484 1.00 91.48 O ATOM 3462 N ALA E 95 -2.802 25.347 -46.814 1.00 71.02 N ATOM 3463 CA ALA E 95 -4.249 25.500 -46.766 1.00 68.15 C ATOM 3464 C ALA E 95 -4.751 26.145 -48.044 1.00 71.87 C ATOM 3465 O ALA E 95 -5.664 25.631 -48.673 1.00 73.24 O ATOM 3466 CB ALA E 95 -4.626 26.353 -45.591 1.00 66.47 C ATOM 3467 N CYS E 96 -4.150 27.279 -48.405 1.00 76.36 N ATOM 3468 CA CYS E 96 -4.494 28.031 -49.607 1.00 72.58 C ATOM 3469 C CYS E 96 -4.471 27.213 -50.863 1.00 73.27 C ATOM 3470 O CYS E 96 -5.463 27.127 -51.581 1.00 72.80 O ATOM 3471 CB CYS E 96 -3.538 29.182 -49.804 1.00 66.37 C ATOM 3472 SG CYS E 96 -4.029 30.593 -48.885 1.00 88.12 S ATOM 3473 N GLU E 97 -3.320 26.634 -51.157 1.00 74.78 N ATOM 3474 CA GLU E 97 -3.226 25.838 -52.351 1.00 74.34 C ATOM 3475 C GLU E 97 -4.295 24.776 -52.275 1.00 71.25 C ATOM 3476 O GLU E 97 -5.111 24.652 -53.180 1.00 74.62 O ATOM 3477 CB GLU E 97 -1.832 25.251 -52.475 1.00 76.91 C ATOM 3478 CG GLU E 97 -0.809 26.325 -52.785 1.00 88.63 C ATOM 3479 CD GLU E 97 0.192 25.897 -53.843 1.00 95.17 C ATOM 3480 OE1 GLU E 97 0.067 24.757 -54.336 1.00 97.85 O ATOM 3481 OE2 GLU E 97 1.100 26.695 -54.185 1.00 96.10 O ATOM 3482 N ALA E 98 -4.330 24.041 -51.179 1.00 61.11 N ATOM 3483 CA ALA E 98 -5.347 23.018 -51.034 1.00 63.70 C ATOM 3484 C ALA E 98 -6.745 23.542 -51.391 1.00 65.61 C ATOM 3485 O ALA E 98 -7.411 22.983 -52.253 1.00 68.17 O ATOM 3486 CB ALA E 98 -5.339 22.482 -49.617 1.00 57.96 C ATOM 3487 N TYR E 99 -7.183 24.611 -50.728 1.00 66.11 N ATOM 3488 CA TYR E 99 -8.497 25.209 -50.963 1.00 62.67 C ATOM 3489 C TYR E 99 -8.765 25.474 -52.427 1.00 66.07 C ATOM 3490 O TYR E 99 -9.781 25.033 -52.968 1.00 64.98 O ATOM 3491 CB TYR E 99 -8.615 26.521 -50.202 1.00 59.38 C ATOM 3492 CG TYR E 99 -9.794 27.359 -50.606 1.00 64.92 C ATOM 3493 CD1 TYR E 99 -11.102 26.942 -50.342 1.00 66.07 C ATOM 3494 CD2 TYR E 99 -9.610 28.563 -51.278 1.00 68.36 C ATOM 3495 CE1 TYR E 99 -12.198 27.707 -50.742 1.00 62.16 C ATOM 3496 CE2 TYR E 99 -10.697 29.337 -51.683 1.00 70.67 C ATOM 3497 CZ TYR E 99 -11.983 28.900 -51.414 1.00 70.44 C ATOM 3498 OH TYR E 99 -13.047 29.651 -51.839 1.00 75.69 O ATOM 3499 N LEU E 100 -7.839 26.194 -53.062 1.00 68.27 N ATOM 3500 CA LEU E 100 -7.951 26.556 -54.480 1.00 65.13 C ATOM 3501 C LEU E 100 -7.973 25.355 -55.414 1.00 60.76 C ATOM 3502 O LEU E 100 -8.791 25.288 -56.317 1.00 60.59 O ATOM 3503 CB LEU E 100 -6.816 27.514 -54.895 1.00 60.36 C ATOM 3504 CG LEU E 100 -6.762 28.954 -54.336 1.00 60.83 C ATOM 3505 CD1 LEU E 100 -5.665 29.716 -55.042 1.00 59.00 C ATOM 3506 CD2 LEU E 100 -8.066 29.678 -54.555 1.00 57.60 C ATOM 3507 N VAL E 101 -7.074 24.402 -55.219 1.00 62.42 N ATOM 3508 CA VAL E 101 -7.082 23.235 -56.094 1.00 60.02 C ATOM 3509 C VAL E 101 -8.445 22.597 -56.013 1.00 56.57 C ATOM 3510 O VAL E 101 -9.007 22.223 -57.018 1.00 59.67 O ATOM 3511 CB VAL E 101 -6.035 22.182 -55.699 1.00 54.98 C ATOM 3512 CG1 VAL E 101 -6.221 20.951 -56.551 1.00 57.36 C ATOM 3513 CG2 VAL E 101 -4.642 22.729 -55.927 1.00 56.68 C ATOM 3514 N GLY E 102 -8.970 22.502 -54.799 1.00 61.01 N ATOM 3515 CA GLY E 102 -10.275 21.915 -54.574 1.00 59.15 C ATOM 3516 C GLY E 102 -11.392 22.702 -55.218 1.00 61.39 C ATOM 3517 O GLY E 102 -12.360 22.130 -55.693 1.00 60.08 O ATOM 3518 N LEU E 103 -11.269 24.022 -55.233 1.00 63.06 N ATOM 3519 CA LEU E 103 -12.289 24.863 -55.847 1.00 60.42 C ATOM 3520 C LEU E 103 -12.299 24.633 -57.345 1.00 64.58 C ATOM 3521 O LEU E 103 -13.354 24.514 -57.945 1.00 70.39 O ATOM 3522 CB LEU E 103 -11.997 26.329 -55.571 1.00 61.65 C ATOM 3523 CG LEU E 103 -12.998 27.343 -56.112 1.00 64.89 C ATOM 3524 CD1 LEU E 103 -14.368 26.997 -55.574 1.00 65.69 C ATOM 3525 CD2 LEU E 103 -12.590 28.763 -55.689 1.00 67.70 C ATOM 3526 N PHE E 104 -11.113 24.578 -57.946 1.00 64.73 N ATOM 3527 CA PHE E 104 -10.990 24.356 -59.372 1.00 64.62 C ATOM 3528 C PHE E 104 -11.661 23.064 -59.829 1.00 71.79 C ATOM 3529 O PHE E 104 -12.183 23.024 -60.936 1.00 72.11 O ATOM 3530 CB PHE E 104 -9.519 24.364 -59.789 1.00 68.44 C ATOM 3531 CG PHE E 104 -8.940 25.751 -59.991 1.00 74.51 C ATOM 3532 CD1 PHE E 104 -9.679 26.736 -60.632 1.00 71.74 C ATOM 3533 CD2 PHE E 104 -7.664 26.078 -59.537 1.00 68.39 C ATOM 3534 CE1 PHE E 104 -9.145 27.986 -60.861 1.00 66.02 C ATOM 3535 CE2 PHE E 104 -7.132 27.334 -59.766 1.00 59.04 C ATOM 3536 CZ PHE E 104 -7.880 28.294 -60.407 1.00 63.04 C ATOM 3537 N GLU E 105 -11.643 22.014 -58.997 1.00 76.19 N ATOM 3538 CA GLU E 105 -12.296 20.735 -59.336 1.00 75.58 C ATOM 3539 C GLU E 105 -13.796 21.002 -59.484 1.00 78.36 C ATOM 3540 O GLU E 105 -14.378 20.782 -60.551 1.00 81.83 O ATOM 3541 CB GLU E 105 -12.073 19.678 -58.239 1.00 70.71 C ATOM 3542 CG GLU E 105 -10.663 19.068 -58.218 1.00 86.82 C ATOM 3543 CD GLU E 105 -10.361 18.197 -56.972 1.00 95.29 C ATOM 3544 OE1 GLU E 105 -11.313 17.877 -56.215 1.00 97.19 O ATOM 3545 OE2 GLU E 105 -9.166 17.829 -56.760 1.00 95.56 O ATOM 3546 N ASP E 106 -14.416 21.507 -58.421 1.00 77.94 N ATOM 3547 CA ASP E 106 -15.837 21.811 -58.456 1.00 76.88 C ATOM 3548 C ASP E 106 -16.071 22.801 -59.585 1.00 73.88 C ATOM 3549 O ASP E 106 -17.064 22.745 -60.294 1.00 73.30 O ATOM 3550 CB ASP E 106 -16.276 22.382 -57.109 1.00 78.19 C ATOM 3551 CG ASP E 106 -15.868 21.483 -55.932 1.00 93.13 C ATOM 3552 OD1 ASP E 106 -16.130 20.257 -55.978 1.00 97.74 O ATOM 3553 OD2 ASP E 106 -15.281 21.997 -54.950 1.00 95.41 O ATOM 3554 N THR E 107 -15.125 23.699 -59.765 1.00 70.50 N ATOM 3555 CA THR E 107 -15.235 24.669 -60.825 1.00 72.02 C ATOM 3556 C THR E 107 -15.408 23.921 -62.144 1.00 73.36 C ATOM 3557 O THR E 107 -16.378 24.115 -62.867 1.00 79.65 O ATOM 3558 CB THR E 107 -13.961 25.520 -60.916 1.00 70.59 C ATOM 3559 OG1 THR E 107 -13.708 26.130 -59.651 1.00 66.92 O ATOM 3560 CG2 THR E 107 -14.112 26.597 -61.961 1.00 68.72 C ATOM 3561 N ASN E 108 -14.453 23.053 -62.440 1.00 68.89 N ATOM 3562 CA ASN E 108 -14.441 22.288 -63.676 1.00 68.60 C ATOM 3563 C ASN E 108 -15.667 21.407 -63.877 1.00 71.64 C ATOM 3564 O ASN E 108 -16.075 21.169 -65.011 1.00 73.98 O ATOM 3565 CB ASN E 108 -13.182 21.429 -63.726 1.00 68.30 C ATOM 3566 CG ASN E 108 -12.759 21.089 -65.132 1.00 68.30 C ATOM 3567 OD1 ASN E 108 -12.596 19.927 -65.460 1.00 77.88 O ATOM 3568 ND2 ASN E 108 -12.559 22.103 -65.967 1.00 68.88 N ATOM 3569 N LEU E 109 -16.254 20.895 -62.799 1.00 70.95 N ATOM 3570 CA LEU E 109 -17.444 20.064 -62.964 1.00 68.86 C ATOM 3571 C LEU E 109 -18.563 21.006 -63.391 1.00 73.08 C ATOM 3572 O LEU E 109 -19.513 20.602 -64.043 1.00 76.98 O ATOM 3573 CB LEU E 109 -17.832 19.359 -61.657 1.00 66.92 C ATOM 3574 CG LEU E 109 -16.891 18.348 -60.983 1.00 65.97 C ATOM 3575 CD1 LEU E 109 -17.552 17.853 -59.719 1.00 68.98 C ATOM 3576 CD2 LEU E 109 -16.592 17.171 -61.886 1.00 64.29 C ATOM 3577 N CYS E 110 -18.443 22.273 -63.027 1.00 70.47 N ATOM 3578 CA CYS E 110 -19.453 23.236 -63.399 1.00 70.36 C ATOM 3579 C CYS E 110 -19.348 23.646 -64.861 1.00 74.09 C ATOM 3580 O CYS E 110 -20.336 24.036 -65.491 1.00 74.39 O ATOM 3581 CB CYS E 110 -19.363 24.458 -62.503 1.00 68.65 C ATOM 3582 SG CYS E 110 -20.262 24.233 -60.988 1.00 72.32 S ATOM 3583 N ALA E 111 -18.149 23.587 -65.411 1.00 75.86 N ATOM 3584 CA ALA E 111 -18.016 23.950 -66.806 1.00 81.56 C ATOM 3585 C ALA E 111 -18.573 22.763 -67.608 1.00 84.75 C ATOM 3586 O ALA E 111 -19.382 22.937 -68.523 1.00 90.97 O ATOM 3587 CB ALA E 111 -16.555 24.212 -67.143 1.00 82.01 C ATOM 3588 N ILE E 112 -18.155 21.554 -67.237 1.00 80.84 N ATOM 3589 CA ILE E 112 -18.624 20.340 -67.891 1.00 71.20 C ATOM 3590 C ILE E 112 -20.134 20.264 -67.936 1.00 70.14 C ATOM 3591 O ILE E 112 -20.700 19.763 -68.886 1.00 67.77 O ATOM 3592 CB ILE E 112 -18.197 19.094 -67.152 1.00 69.60 C ATOM 3593 CG1 ILE E 112 -16.682 19.042 -67.039 1.00 66.83 C ATOM 3594 CG2 ILE E 112 -18.772 17.895 -67.839 1.00 66.76 C ATOM 3595 CD1 ILE E 112 -16.013 19.391 -68.280 1.00 68.24 C ATOM 3596 N HIS E 113 -20.787 20.751 -66.892 1.00 74.50 N ATOM 3597 CA HIS E 113 -22.244 20.706 -66.825 1.00 76.08 C ATOM 3598 C HIS E 113 -22.885 21.627 -67.846 1.00 77.38 C ATOM 3599 O HIS E 113 -24.015 21.395 -68.279 1.00 78.46 O ATOM 3600 CB HIS E 113 -22.709 21.076 -65.418 1.00 75.15 C ATOM 3601 CG HIS E 113 -24.119 20.669 -65.116 1.00 80.26 C ATOM 3602 ND1 HIS E 113 -25.195 21.502 -65.322 1.00 82.73 N ATOM 3603 CD2 HIS E 113 -24.620 19.517 -64.607 1.00 80.42 C ATOM 3604 CE1 HIS E 113 -26.307 20.885 -64.950 1.00 78.59 C ATOM 3605 NE2 HIS E 113 -25.985 19.682 -64.514 1.00 86.29 N ATOM 3606 N ALA E 114 -22.153 22.669 -68.230 1.00 79.30 N ATOM 3607 CA ALA E 114 -22.636 23.637 -69.205 1.00 82.58 C ATOM 3608 C ALA E 114 -22.141 23.235 -70.577 1.00 83.41 C ATOM 3609 O ALA E 114 -22.012 24.055 -71.485 1.00 82.13 O ATOM 3610 CB ALA E 114 -22.136 25.036 -68.862 1.00 88.84 C