>>3W96:HELIX   15  15 SER D   55  ASN D   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 15 15 SER D 55 ASN D 84 1 30 ATOM 2444 N SER D 55 8.192 8.871 -42.189 1.00 69.83 N ATOM 2445 CA SER D 55 8.936 10.131 -42.083 1.00 75.23 C ATOM 2446 C SER D 55 8.371 11.098 -41.038 1.00 79.82 C ATOM 2447 O SER D 55 7.238 10.940 -40.585 1.00 84.12 O ATOM 2448 CB SER D 55 8.998 10.835 -43.442 1.00 77.58 C ATOM 2449 OG SER D 55 7.841 11.599 -43.697 1.00 77.79 O ATOM 2450 N SER D 56 9.164 12.105 -40.663 1.00 84.43 N ATOM 2451 CA SER D 56 8.779 13.100 -39.645 1.00 85.10 C ATOM 2452 C SER D 56 7.449 13.734 -39.948 1.00 82.77 C ATOM 2453 O SER D 56 6.548 13.764 -39.096 1.00 77.14 O ATOM 2454 CB SER D 56 9.818 14.207 -39.568 1.00 84.52 C ATOM 2455 OG SER D 56 11.106 13.661 -39.648 1.00 89.62 O ATOM 2456 N LYS D 57 7.364 14.274 -41.162 1.00 80.64 N ATOM 2457 CA LYS D 57 6.153 14.904 -41.642 1.00 81.37 C ATOM 2458 C LYS D 57 4.985 13.926 -41.501 1.00 80.21 C ATOM 2459 O LYS D 57 3.938 14.274 -40.942 1.00 79.10 O ATOM 2460 CB LYS D 57 6.319 15.313 -43.105 1.00 87.93 C ATOM 2461 CG LYS D 57 7.295 16.472 -43.337 1.00 98.67 C ATOM 2462 CD LYS D 57 7.172 17.080 -44.763 1.00107.30 C ATOM 2463 CE LYS D 57 8.072 18.325 -44.960 1.00107.69 C ATOM 2464 NZ LYS D 57 9.554 18.060 -44.865 1.00 99.87 N ATOM 2465 N ALA D 58 5.166 12.702 -41.999 1.00 72.65 N ATOM 2466 CA ALA D 58 4.121 11.703 -41.907 1.00 62.12 C ATOM 2467 C ALA D 58 3.876 11.369 -40.468 1.00 62.79 C ATOM 2468 O ALA D 58 2.773 11.026 -40.093 1.00 73.78 O ATOM 2469 CB ALA D 58 4.488 10.480 -42.653 1.00 64.11 C ATOM 2470 N MET D 59 4.889 11.447 -39.633 1.00 60.23 N ATOM 2471 CA MET D 59 4.627 11.157 -38.246 1.00 66.76 C ATOM 2472 C MET D 59 3.747 12.300 -37.715 1.00 73.74 C ATOM 2473 O MET D 59 2.887 12.100 -36.852 1.00 71.99 O ATOM 2474 CB MET D 59 5.942 11.055 -37.479 1.00 67.06 C ATOM 2475 CG MET D 59 5.795 10.473 -36.083 1.00 74.40 C ATOM 2476 SD MET D 59 4.769 8.991 -36.025 1.00 83.06 S ATOM 2477 CE MET D 59 5.988 7.701 -36.144 1.00 75.20 C ATOM 2478 N GLY D 60 3.961 13.500 -38.259 1.00 77.10 N ATOM 2479 CA GLY D 60 3.196 14.674 -37.850 1.00 75.31 C ATOM 2480 C GLY D 60 1.739 14.515 -38.227 1.00 75.33 C ATOM 2481 O GLY D 60 0.835 14.708 -37.406 1.00 75.73 O ATOM 2482 N ILE D 61 1.516 14.176 -39.491 1.00 70.99 N ATOM 2483 CA ILE D 61 0.177 13.930 -40.001 1.00 70.93 C ATOM 2484 C ILE D 61 -0.522 12.960 -39.025 1.00 74.97 C ATOM 2485 O ILE D 61 -1.605 13.245 -38.507 1.00 79.57 O ATOM 2486 CB ILE D 61 0.255 13.264 -41.373 1.00 66.67 C ATOM 2487 CG1 ILE D 61 1.154 14.091 -42.288 1.00 64.10 C ATOM 2488 CG2 ILE D 61 -1.116 13.031 -41.908 1.00 57.57 C ATOM 2489 CD1 ILE D 61 0.641 15.409 -42.640 1.00 69.02 C ATOM 2490 N MET D 62 0.116 11.820 -38.772 1.00 66.70 N ATOM 2491 CA MET D 62 -0.438 10.821 -37.881 1.00 67.55 C ATOM 2492 C MET D 62 -0.740 11.378 -36.502 1.00 72.31 C ATOM 2493 O MET D 62 -1.691 10.958 -35.841 1.00 69.55 O ATOM 2494 CB MET D 62 0.523 9.654 -37.743 1.00 69.23 C ATOM 2495 CG MET D 62 0.670 8.827 -38.987 1.00 72.82 C ATOM 2496 SD MET D 62 -0.899 8.149 -39.515 1.00 71.55 S ATOM 2497 CE MET D 62 -1.363 7.337 -38.050 1.00 70.13 C ATOM 2498 N ASN D 63 0.074 12.322 -36.049 1.00 77.10 N ATOM 2499 CA ASN D 63 -0.148 12.897 -34.730 1.00 80.83 C ATOM 2500 C ASN D 63 -1.390 13.758 -34.720 1.00 79.30 C ATOM 2501 O ASN D 63 -2.176 13.718 -33.778 1.00 76.96 O ATOM 2502 CB ASN D 63 1.064 13.699 -34.300 1.00 85.08 C ATOM 2503 CG ASN D 63 1.837 13.014 -33.201 1.00 89.81 C ATOM 2504 OD1 ASN D 63 2.965 13.392 -32.900 1.00102.86 O ATOM 2505 ND2 ASN D 63 1.232 12.007 -32.582 1.00 88.75 N ATOM 2506 N SER D 64 -1.563 14.549 -35.768 1.00 74.74 N ATOM 2507 CA SER D 64 -2.752 15.367 -35.875 1.00 79.18 C ATOM 2508 C SER D 64 -3.964 14.427 -35.884 1.00 83.56 C ATOM 2509 O SER D 64 -4.927 14.622 -35.132 1.00 83.61 O ATOM 2510 CB SER D 64 -2.707 16.150 -37.171 1.00 81.03 C ATOM 2511 OG SER D 64 -1.565 16.989 -37.178 1.00 86.95 O ATOM 2512 N PHE D 65 -3.901 13.395 -36.728 1.00 82.67 N ATOM 2513 CA PHE D 65 -4.985 12.435 -36.844 1.00 73.20 C ATOM 2514 C PHE D 65 -5.495 11.946 -35.504 1.00 72.98 C ATOM 2515 O PHE D 65 -6.661 12.122 -35.177 1.00 76.64 O ATOM 2516 CB PHE D 65 -4.562 11.231 -37.661 1.00 71.27 C ATOM 2517 CG PHE D 65 -5.635 10.193 -37.770 1.00 76.37 C ATOM 2518 CD1 PHE D 65 -6.836 10.489 -38.411 1.00 73.49 C ATOM 2519 CD2 PHE D 65 -5.490 8.948 -37.151 1.00 76.82 C ATOM 2520 CE1 PHE D 65 -7.875 9.559 -38.436 1.00 75.87 C ATOM 2521 CE2 PHE D 65 -6.522 8.008 -37.168 1.00 74.59 C ATOM 2522 CZ PHE D 65 -7.720 8.315 -37.805 1.00 77.38 C ATOM 2523 N VAL D 66 -4.626 11.318 -34.727 1.00 71.37 N ATOM 2524 CA VAL D 66 -5.031 10.808 -33.425 1.00 68.42 C ATOM 2525 C VAL D 66 -5.658 11.851 -32.520 1.00 67.54 C ATOM 2526 O VAL D 66 -6.573 11.533 -31.772 1.00 66.58 O ATOM 2527 CB VAL D 66 -3.850 10.200 -32.677 1.00 69.83 C ATOM 2528 CG1 VAL D 66 -4.269 9.808 -31.260 1.00 60.29 C ATOM 2529 CG2 VAL D 66 -3.344 9.002 -33.448 1.00 67.31 C ATOM 2530 N ASN D 67 -5.167 13.087 -32.560 1.00 71.97 N ATOM 2531 CA ASN D 67 -5.731 14.126 -31.690 1.00 73.67 C ATOM 2532 C ASN D 67 -7.094 14.531 -32.182 1.00 70.38 C ATOM 2533 O ASN D 67 -8.059 14.592 -31.403 1.00 67.72 O ATOM 2534 CB ASN D 67 -4.821 15.353 -31.614 1.00 72.11 C ATOM 2535 CG ASN D 67 -3.500 15.031 -30.972 1.00 76.61 C ATOM 2536 OD1 ASN D 67 -2.988 15.777 -30.149 1.00 82.05 O ATOM 2537 ND2 ASN D 67 -2.933 13.897 -31.352 1.00 88.66 N ATOM 2538 N ASP D 68 -7.166 14.817 -33.476 1.00 64.25 N ATOM 2539 CA ASP D 68 -8.432 15.187 -34.071 1.00 62.55 C ATOM 2540 C ASP D 68 -9.435 14.178 -33.523 1.00 59.29 C ATOM 2541 O ASP D 68 -10.260 14.510 -32.671 1.00 49.18 O ATOM 2542 CB ASP D 68 -8.346 15.082 -35.594 1.00 65.14 C ATOM 2543 CG ASP D 68 -9.553 15.664 -36.281 1.00 70.06 C ATOM 2544 OD1 ASP D 68 -10.548 15.950 -35.581 1.00 74.38 O ATOM 2545 OD2 ASP D 68 -9.516 15.829 -37.520 1.00 71.14 O ATOM 2546 N ILE D 69 -9.306 12.936 -33.992 1.00 57.97 N ATOM 2547 CA ILE D 69 -10.164 11.847 -33.572 1.00 59.60 C ATOM 2548 C ILE D 69 -10.357 11.891 -32.063 1.00 64.91 C ATOM 2549 O ILE D 69 -11.488 11.942 -31.591 1.00 67.56 O ATOM 2550 CB ILE D 69 -9.586 10.503 -33.972 1.00 61.08 C ATOM 2551 CG1 ILE D 69 -9.447 10.431 -35.496 1.00 62.21 C ATOM 2552 CG2 ILE D 69 -10.488 9.401 -33.499 1.00 60.73 C ATOM 2553 CD1 ILE D 69 -10.729 10.608 -36.261 1.00 57.26 C ATOM 2554 N PHE D 70 -9.278 11.890 -31.288 1.00 66.48 N ATOM 2555 CA PHE D 70 -9.446 11.953 -29.835 1.00 66.99 C ATOM 2556 C PHE D 70 -10.461 13.021 -29.399 1.00 67.70 C ATOM 2557 O PHE D 70 -11.408 12.723 -28.671 1.00 63.47 O ATOM 2558 CB PHE D 70 -8.115 12.213 -29.125 1.00 63.95 C ATOM 2559 CG PHE D 70 -8.228 12.232 -27.618 1.00 71.36 C ATOM 2560 CD1 PHE D 70 -8.169 13.417 -26.913 1.00 75.81 C ATOM 2561 CD2 PHE D 70 -8.463 11.063 -26.910 1.00 80.94 C ATOM 2562 CE1 PHE D 70 -8.323 13.438 -25.527 1.00 79.53 C ATOM 2563 CE2 PHE D 70 -8.618 11.078 -25.525 1.00 85.53 C ATOM 2564 CZ PHE D 70 -8.557 12.274 -24.835 1.00 81.14 C ATOM 2565 N GLU D 71 -10.270 14.258 -29.856 1.00 67.73 N ATOM 2566 CA GLU D 71 -11.167 15.342 -29.487 1.00 66.56 C ATOM 2567 C GLU D 71 -12.554 15.103 -30.034 1.00 65.68 C ATOM 2568 O GLU D 71 -13.534 15.437 -29.397 1.00 70.55 O ATOM 2569 CB GLU D 71 -10.645 16.678 -30.000 1.00 66.96 C ATOM 2570 CG GLU D 71 -10.646 17.821 -28.957 1.00 96.32 C ATOM 2571 CD GLU D 71 -12.060 18.272 -28.437 1.00112.10 C ATOM 2572 OE1 GLU D 71 -12.188 19.460 -28.003 1.00116.69 O ATOM 2573 OE2 GLU D 71 -13.032 17.462 -28.437 1.00114.31 O ATOM 2574 N ARG D 72 -12.661 14.530 -31.217 1.00 61.02 N ATOM 2575 CA ARG D 72 -13.987 14.298 -31.731 1.00 63.07 C ATOM 2576 C ARG D 72 -14.726 13.310 -30.834 1.00 71.14 C ATOM 2577 O ARG D 72 -15.850 13.561 -30.370 1.00 71.92 O ATOM 2578 CB ARG D 72 -13.931 13.713 -33.114 1.00 59.56 C ATOM 2579 CG ARG D 72 -13.140 14.483 -34.097 1.00 60.60 C ATOM 2580 CD ARG D 72 -13.397 13.870 -35.446 1.00 68.06 C ATOM 2581 NE ARG D 72 -12.676 14.552 -36.501 1.00 67.54 N ATOM 2582 CZ ARG D 72 -12.788 14.242 -37.779 1.00 67.37 C ATOM 2583 NH1 ARG D 72 -13.595 13.258 -38.150 1.00 60.97 N ATOM 2584 NH2 ARG D 72 -12.101 14.930 -38.678 1.00 69.91 N ATOM 2585 N ILE D 73 -14.093 12.166 -30.599 1.00 72.50 N ATOM 2586 CA ILE D 73 -14.703 11.129 -29.781 1.00 71.61 C ATOM 2587 C ILE D 73 -15.086 11.675 -28.413 1.00 74.28 C ATOM 2588 O ILE D 73 -16.254 11.607 -28.026 1.00 80.69 O ATOM 2589 CB ILE D 73 -13.759 9.926 -29.578 1.00 68.85 C ATOM 2590 CG1 ILE D 73 -13.325 9.344 -30.934 1.00 65.46 C ATOM 2591 CG2 ILE D 73 -14.446 8.887 -28.725 1.00 65.66 C ATOM 2592 CD1 ILE D 73 -14.171 8.230 -31.449 1.00 61.84 C ATOM 2593 N ALA D 74 -14.119 12.240 -27.689 1.00 76.18 N ATOM 2594 CA ALA D 74 -14.370 12.766 -26.332 1.00 75.40 C ATOM 2595 C ALA D 74 -15.378 13.904 -26.284 1.00 70.21 C ATOM 2596 O ALA D 74 -16.199 13.981 -25.381 1.00 68.50 O ATOM 2597 CB ALA D 74 -13.045 13.196 -25.676 1.00 72.92 C ATOM 2598 N GLY D 75 -15.304 14.788 -27.263 1.00 69.26 N ATOM 2599 CA GLY D 75 -16.241 15.888 -27.319 1.00 72.92 C ATOM 2600 C GLY D 75 -17.656 15.359 -27.452 1.00 72.63 C ATOM 2601 O GLY D 75 -18.559 15.819 -26.756 1.00 69.21 O ATOM 2602 N GLU D 76 -17.858 14.396 -28.349 1.00 74.54 N ATOM 2603 CA GLU D 76 -19.179 13.803 -28.509 1.00 79.77 C ATOM 2604 C GLU D 76 -19.558 13.125 -27.197 1.00 79.59 C ATOM 2605 O GLU D 76 -20.713 13.173 -26.761 1.00 75.80 O ATOM 2606 CB GLU D 76 -19.196 12.736 -29.592 1.00 86.93 C ATOM 2607 CG GLU D 76 -20.619 12.175 -29.837 1.00 91.68 C ATOM 2608 CD GLU D 76 -21.508 13.166 -30.572 1.00 88.35 C ATOM 2609 OE1 GLU D 76 -21.889 14.185 -29.961 1.00 89.71 O ATOM 2610 OE2 GLU D 76 -21.804 12.936 -31.766 1.00 86.70 O ATOM 2611 N ALA D 77 -18.580 12.462 -26.593 1.00 77.45 N ATOM 2612 CA ALA D 77 -18.811 11.803 -25.329 1.00 79.17 C ATOM 2613 C ALA D 77 -19.324 12.865 -24.364 1.00 80.13 C ATOM 2614 O ALA D 77 -20.363 12.715 -23.722 1.00 83.22 O ATOM 2615 CB ALA D 77 -17.530 11.208 -24.821 1.00 79.33 C ATOM 2616 N SER D 78 -18.593 13.962 -24.286 1.00 81.90 N ATOM 2617 CA SER D 78 -18.973 15.042 -23.406 1.00 78.87 C ATOM 2618 C SER D 78 -20.427 15.440 -23.606 1.00 76.89 C ATOM 2619 O SER D 78 -21.146 15.639 -22.630 1.00 76.49 O ATOM 2620 CB SER D 78 -18.071 16.247 -23.634 1.00 71.14 C ATOM 2621 OG SER D 78 -18.287 17.189 -22.614 1.00 69.28 O ATOM 2622 N ARG D 79 -20.870 15.541 -24.859 1.00 76.50 N ATOM 2623 CA ARG D 79 -22.258 15.943 -25.141 1.00 80.19 C ATOM 2624 C ARG D 79 -23.269 14.931 -24.630 1.00 79.88 C ATOM 2625 O ARG D 79 -24.207 15.279 -23.905 1.00 74.32 O ATOM 2626 CB ARG D 79 -22.461 16.157 -26.635 1.00 79.14 C ATOM 2627 CG ARG D 79 -22.916 17.568 -26.988 1.00 82.38 C ATOM 2628 CD ARG D 79 -22.412 17.975 -28.365 1.00 85.45 C ATOM 2629 NE ARG D 79 -20.955 18.088 -28.362 1.00 86.98 N ATOM 2630 CZ ARG D 79 -20.173 17.663 -29.348 1.00 91.67 C ATOM 2631 NH1 ARG D 79 -20.718 17.093 -30.427 1.00 80.01 N ATOM 2632 NH2 ARG D 79 -18.850 17.793 -29.241 1.00 92.31 N ATOM 2633 N LEU D 80 -23.075 13.681 -25.028 1.00 81.05 N ATOM 2634 CA LEU D 80 -23.937 12.599 -24.588 1.00 82.13 C ATOM 2635 C LEU D 80 -24.213 12.674 -23.085 1.00 83.02 C ATOM 2636 O LEU D 80 -25.370 12.783 -22.650 1.00 82.52 O ATOM 2637 CB LEU D 80 -23.283 11.262 -24.902 1.00 81.61 C ATOM 2638 CG LEU D 80 -23.622 10.634 -26.246 1.00 86.50 C ATOM 2639 CD1 LEU D 80 -22.594 9.543 -26.539 1.00 90.90 C ATOM 2640 CD2 LEU D 80 -25.059 10.074 -26.231 1.00 81.40 C ATOM 2641 N ALA D 81 -23.147 12.610 -22.290 1.00 81.61 N ATOM 2642 CA ALA D 81 -23.293 12.673 -20.843 1.00 82.41 C ATOM 2643 C ALA D 81 -24.180 13.861 -20.467 1.00 85.74 C ATOM 2644 O ALA D 81 -25.115 13.720 -19.676 1.00 85.18 O ATOM 2645 CB ALA D 81 -21.932 12.791 -20.183 1.00 73.64 C ATOM 2646 N HIS D 82 -23.920 15.018 -21.073 1.00 89.34 N ATOM 2647 CA HIS D 82 -24.696 16.210 -20.758 1.00 89.58 C ATOM 2648 C HIS D 82 -26.162 16.101 -21.144 1.00 85.80 C ATOM 2649 O HIS D 82 -27.026 16.264 -20.284 1.00 82.78 O ATOM 2650 CB HIS D 82 -24.061 17.454 -21.389 1.00 97.19 C ATOM 2651 CG HIS D 82 -24.636 18.755 -20.891 1.00108.65 C ATOM 2652 ND1 HIS D 82 -25.508 19.521 -21.640 1.00115.56 N ATOM 2653 CD2 HIS D 82 -24.440 19.438 -19.734 1.00106.84 C ATOM 2654 CE1 HIS D 82 -25.822 20.620 -20.973 1.00111.03 C ATOM 2655 NE2 HIS D 82 -25.187 20.593 -19.814 1.00113.66 N ATOM 2656 N TYR D 83 -26.457 15.813 -22.411 1.00 84.73 N ATOM 2657 CA TYR D 83 -27.852 15.691 -22.823 1.00 80.61 C ATOM 2658 C TYR D 83 -28.549 14.754 -21.869 1.00 86.47 C ATOM 2659 O TYR D 83 -29.781 14.745 -21.812 1.00 88.99 O ATOM 2660 CB TYR D 83 -28.013 15.063 -24.192 1.00 72.37 C ATOM 2661 CG TYR D 83 -27.383 15.760 -25.350 1.00 72.46 C ATOM 2662 CD1 TYR D 83 -27.169 17.126 -25.355 1.00 64.23 C ATOM 2663 CD2 TYR D 83 -27.081 15.041 -26.501 1.00 73.98 C ATOM 2664 CE1 TYR D 83 -26.671 17.756 -26.491 1.00 68.58 C ATOM 2665 CE2 TYR D 83 -26.594 15.652 -27.630 1.00 69.45 C ATOM 2666 CZ TYR D 83 -26.388 17.005 -27.629 1.00 69.41 C ATOM 2667 OH TYR D 83 -25.895 17.586 -28.782 1.00 73.09 O ATOM 2668 N ASN D 84 -27.771 13.945 -21.144 1.00 90.13 N ATOM 2669 CA ASN D 84 -28.353 12.988 -20.204 1.00 94.82 C ATOM 2670 C ASN D 84 -28.150 13.262 -18.719 1.00 94.22 C ATOM 2671 O ASN D 84 -28.225 12.351 -17.898 1.00 95.97 O ATOM 2672 CB ASN D 84 -27.880 11.568 -20.525 1.00 94.25 C ATOM 2673 CG ASN D 84 -28.620 10.966 -21.707 1.00 99.74 C ATOM 2674 OD1 ASN D 84 -29.852 10.796 -21.674 1.00 94.01 O ATOM 2675 ND2 ASN D 84 -27.874 10.655 -22.774 1.00102.56 N