>>3X1T:HELIX   34  34 SER H   55  ASN H   84  1                                  30    
SSKAMSIMNSFVTDIFERIASEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 34 34 SER H 55 ASN H 84 1 30 ATOM 11500 N SER H 55 -46.416 34.205 -36.285 1.00 47.43 N ATOM 11501 CA SER H 55 -47.123 32.931 -36.333 1.00 46.84 C ATOM 11502 C SER H 55 -46.350 31.870 -35.559 1.00 47.43 C ATOM 11503 O SER H 55 -45.171 32.050 -35.255 1.00 47.50 O ATOM 11504 CB SER H 55 -47.349 32.489 -37.779 1.00 51.20 C ATOM 11505 OG SER H 55 -46.153 32.013 -38.369 1.00 52.54 O ATOM 11506 N SER H 56 -47.017 30.769 -35.232 1.00 48.61 N ATOM 11507 CA SER H 56 -46.409 29.744 -34.393 1.00 49.41 C ATOM 11508 C SER H 56 -45.261 29.052 -35.116 1.00 50.82 C ATOM 11509 O SER H 56 -44.207 28.815 -34.521 1.00 51.40 O ATOM 11510 CB SER H 56 -47.453 28.720 -33.944 1.00 48.07 C ATOM 11511 OG SER H 56 -48.019 28.058 -35.057 1.00 64.34 O ATOM 11512 N LYS H 57 -45.462 28.741 -36.394 1.00 47.41 N ATOM 11513 CA LYS H 57 -44.406 28.134 -37.198 1.00 49.28 C ATOM 11514 C LYS H 57 -43.185 29.050 -37.241 1.00 50.52 C ATOM 11515 O LYS H 57 -42.035 28.601 -37.107 1.00 58.80 O ATOM 11516 CB LYS H 57 -44.905 27.834 -38.613 1.00 43.58 C ATOM 11517 CG LYS H 57 -45.889 26.675 -38.696 1.00 41.82 C ATOM 11518 CD LYS H 57 -46.124 26.253 -40.137 1.00 45.38 C ATOM 11519 CE LYS H 57 -46.856 24.922 -40.210 1.00 66.44 C ATOM 11520 NZ LYS H 57 -46.708 24.277 -41.549 1.00 76.43 N ATOM 11521 N ALA H 58 -43.445 30.342 -37.406 1.00 42.64 N ATOM 11522 CA ALA H 58 -42.383 31.332 -37.410 1.00 44.59 C ATOM 11523 C ALA H 58 -41.665 31.360 -36.066 1.00 43.37 C ATOM 11524 O ALA H 58 -40.443 31.517 -36.005 1.00 48.77 O ATOM 11525 CB ALA H 58 -42.939 32.697 -37.745 1.00 48.96 C ATOM 11526 N MET H 59 -42.426 31.198 -34.989 1.00 41.20 N ATOM 11527 CA MET H 59 -41.844 31.199 -33.652 1.00 44.92 C ATOM 11528 C MET H 59 -40.924 29.994 -33.472 1.00 43.58 C ATOM 11529 O MET H 59 -39.863 30.093 -32.848 1.00 44.50 O ATOM 11530 CB MET H 59 -42.938 31.203 -32.582 1.00 41.53 C ATOM 11531 CG MET H 59 -42.399 31.255 -31.165 1.00 35.47 C ATOM 11532 SD MET H 59 -41.268 32.636 -30.913 1.00 52.22 S ATOM 11533 CE MET H 59 -42.407 33.935 -30.436 1.00 45.84 C ATOM 11534 N SER H 60 -41.334 28.857 -34.026 1.00 44.17 N ATOM 11535 CA SER H 60 -40.494 27.669 -34.021 1.00 44.16 C ATOM 11536 C SER H 60 -39.184 27.962 -34.740 1.00 43.35 C ATOM 11537 O SER H 60 -38.098 27.716 -34.210 1.00 42.75 O ATOM 11538 CB SER H 60 -41.211 26.492 -34.682 1.00 39.59 C ATOM 11539 OG SER H 60 -42.273 26.026 -33.873 1.00 56.39 O ATOM 11540 N ILE H 61 -39.295 28.506 -35.946 1.00 42.15 N ATOM 11541 CA ILE H 61 -38.113 28.853 -36.726 1.00 42.39 C ATOM 11542 C ILE H 61 -37.160 29.770 -35.952 1.00 42.16 C ATOM 11543 O ILE H 61 -35.943 29.554 -35.968 1.00 39.75 O ATOM 11544 CB ILE H 61 -38.522 29.501 -38.057 1.00 46.65 C ATOM 11545 CG1 ILE H 61 -39.087 28.417 -38.980 1.00 43.40 C ATOM 11546 CG2 ILE H 61 -37.336 30.201 -38.703 1.00 36.82 C ATOM 11547 CD1 ILE H 61 -39.832 28.936 -40.170 1.00 43.30 C ATOM 11548 N MET H 62 -37.707 30.762 -35.248 1.00 41.08 N ATOM 11549 CA MET H 62 -36.881 31.640 -34.416 1.00 38.07 C ATOM 11550 C MET H 62 -36.211 30.875 -33.270 1.00 39.07 C ATOM 11551 O MET H 62 -35.042 31.114 -32.956 1.00 44.99 O ATOM 11552 CB MET H 62 -37.708 32.798 -33.856 1.00 40.56 C ATOM 11553 CG MET H 62 -38.163 33.816 -34.888 1.00 36.95 C ATOM 11554 SD MET H 62 -36.812 34.604 -35.792 1.00 45.01 S ATOM 11555 CE MET H 62 -35.922 35.448 -34.484 1.00 32.36 C ATOM 11556 N ASN H 63 -36.944 29.958 -32.647 1.00 39.04 N ATOM 11557 CA ASN H 63 -36.355 29.105 -31.613 1.00 49.39 C ATOM 11558 C ASN H 63 -35.165 28.296 -32.131 1.00 45.94 C ATOM 11559 O ASN H 63 -34.112 28.232 -31.487 1.00 40.18 O ATOM 11560 CB ASN H 63 -37.405 28.152 -31.038 1.00 48.09 C ATOM 11561 CG ASN H 63 -37.973 28.642 -29.726 1.00 57.37 C ATOM 11562 OD1 ASN H 63 -37.274 28.686 -28.711 1.00 59.71 O ATOM 11563 ND2 ASN H 63 -39.248 29.012 -29.736 1.00 56.90 N ATOM 11564 N SER H 64 -35.346 27.674 -33.292 1.00 42.07 N ATOM 11565 CA SER H 64 -34.269 26.938 -33.935 1.00 42.16 C ATOM 11566 C SER H 64 -33.096 27.866 -34.221 1.00 39.95 C ATOM 11567 O SER H 64 -31.941 27.473 -34.085 1.00 44.03 O ATOM 11568 CB SER H 64 -34.752 26.276 -35.230 1.00 43.88 C ATOM 11569 OG SER H 64 -35.749 25.301 -34.975 1.00 45.43 O ATOM 11570 N PHE H 65 -33.395 29.102 -34.605 1.00 39.49 N ATOM 11571 CA PHE H 65 -32.347 30.091 -34.851 1.00 43.01 C ATOM 11572 C PHE H 65 -31.504 30.372 -33.600 1.00 37.98 C ATOM 11573 O PHE H 65 -30.269 30.281 -33.635 1.00 38.50 O ATOM 11574 CB PHE H 65 -32.960 31.391 -35.374 1.00 36.75 C ATOM 11575 CG PHE H 65 -31.962 32.494 -35.572 1.00 38.11 C ATOM 11576 CD1 PHE H 65 -31.045 32.437 -36.604 1.00 36.38 C ATOM 11577 CD2 PHE H 65 -31.947 33.592 -34.729 1.00 34.53 C ATOM 11578 CE1 PHE H 65 -30.127 33.454 -36.787 1.00 34.77 C ATOM 11579 CE2 PHE H 65 -31.035 34.609 -34.910 1.00 30.55 C ATOM 11580 CZ PHE H 65 -30.124 34.540 -35.938 1.00 33.01 C ATOM 11581 N VAL H 66 -32.172 30.705 -32.499 1.00 37.87 N ATOM 11582 CA VAL H 66 -31.476 31.008 -31.250 1.00 37.38 C ATOM 11583 C VAL H 66 -30.682 29.804 -30.746 1.00 41.67 C ATOM 11584 O VAL H 66 -29.520 29.939 -30.351 1.00 42.85 O ATOM 11585 CB VAL H 66 -32.452 31.459 -30.150 1.00 38.77 C ATOM 11586 CG1 VAL H 66 -31.693 31.781 -28.875 1.00 37.56 C ATOM 11587 CG2 VAL H 66 -33.250 32.663 -30.615 1.00 36.82 C ATOM 11588 N THR H 67 -31.311 28.631 -30.770 1.00 38.26 N ATOM 11589 CA THR H 67 -30.643 27.393 -30.377 1.00 39.45 C ATOM 11590 C THR H 67 -29.381 27.145 -31.218 1.00 44.05 C ATOM 11591 O THR H 67 -28.307 26.838 -30.677 1.00 41.10 O ATOM 11592 CB THR H 67 -31.597 26.186 -30.500 1.00 40.42 C ATOM 11593 OG1 THR H 67 -32.631 26.285 -29.512 1.00 46.19 O ATOM 11594 CG2 THR H 67 -30.855 24.893 -30.290 1.00 39.04 C ATOM 11595 N ASP H 68 -29.517 27.300 -32.535 1.00 36.20 N ATOM 11596 CA ASP H 68 -28.405 27.105 -33.463 1.00 35.08 C ATOM 11597 C ASP H 68 -27.244 28.026 -33.122 1.00 36.19 C ATOM 11598 O ASP H 68 -26.141 27.559 -32.819 1.00 35.66 O ATOM 11599 CB ASP H 68 -28.859 27.347 -34.910 1.00 38.24 C ATOM 11600 CG ASP H 68 -27.783 27.003 -35.941 1.00 38.79 C ATOM 11601 OD1 ASP H 68 -26.648 26.656 -35.548 1.00 41.97 O ATOM 11602 OD2 ASP H 68 -28.068 27.095 -37.156 1.00 31.57 O ATOM 11603 N ILE H 69 -27.492 29.332 -33.171 1.00 38.46 N ATOM 11604 CA ILE H 69 -26.426 30.304 -32.942 1.00 37.92 C ATOM 11605 C ILE H 69 -25.799 30.101 -31.562 1.00 35.72 C ATOM 11606 O ILE H 69 -24.578 30.248 -31.389 1.00 32.85 O ATOM 11607 CB ILE H 69 -26.942 31.751 -33.083 1.00 35.74 C ATOM 11608 CG1 ILE H 69 -27.646 31.927 -34.431 1.00 32.76 C ATOM 11609 CG2 ILE H 69 -25.804 32.742 -32.953 1.00 28.94 C ATOM 11610 CD1 ILE H 69 -26.788 31.565 -35.624 1.00 32.05 C ATOM 11611 N PHE H 70 -26.633 29.735 -30.591 1.00 35.73 N ATOM 11612 CA PHE H 70 -26.131 29.372 -29.272 1.00 37.97 C ATOM 11613 C PHE H 70 -25.083 28.273 -29.399 1.00 40.43 C ATOM 11614 O PHE H 70 -23.962 28.418 -28.905 1.00 36.87 O ATOM 11615 CB PHE H 70 -27.262 28.913 -28.346 1.00 32.42 C ATOM 11616 CG PHE H 70 -26.788 28.501 -26.977 1.00 35.29 C ATOM 11617 CD1 PHE H 70 -26.462 27.181 -26.703 1.00 45.15 C ATOM 11618 CD2 PHE H 70 -26.652 29.436 -25.968 1.00 37.71 C ATOM 11619 CE1 PHE H 70 -26.015 26.805 -25.443 1.00 45.04 C ATOM 11620 CE2 PHE H 70 -26.208 29.065 -24.706 1.00 38.47 C ATOM 11621 CZ PHE H 70 -25.888 27.752 -24.445 1.00 44.03 C ATOM 11622 N GLU H 71 -25.452 27.185 -30.077 1.00 38.64 N ATOM 11623 CA GLU H 71 -24.571 26.026 -30.205 1.00 36.98 C ATOM 11624 C GLU H 71 -23.280 26.369 -30.950 1.00 35.77 C ATOM 11625 O GLU H 71 -22.210 25.875 -30.591 1.00 36.92 O ATOM 11626 CB GLU H 71 -25.300 24.865 -30.899 1.00 40.22 C ATOM 11627 CG GLU H 71 -26.300 24.129 -29.994 1.00 44.28 C ATOM 11628 CD GLU H 71 -27.328 23.297 -30.762 1.00 49.66 C ATOM 11629 OE1 GLU H 71 -27.337 23.341 -32.013 1.00 45.49 O ATOM 11630 OE2 GLU H 71 -28.140 22.603 -30.107 1.00 47.62 O ATOM 11631 N ARG H 72 -23.365 27.226 -31.966 1.00 31.97 N ATOM 11632 CA ARG H 72 -22.166 27.620 -32.713 1.00 29.27 C ATOM 11633 C ARG H 72 -21.196 28.411 -31.850 1.00 33.83 C ATOM 11634 O ARG H 72 -19.994 28.104 -31.773 1.00 38.13 O ATOM 11635 CB ARG H 72 -22.537 28.452 -33.935 1.00 29.01 C ATOM 11636 CG ARG H 72 -23.516 27.785 -34.866 1.00 29.73 C ATOM 11637 CD ARG H 72 -23.591 28.539 -36.168 1.00 27.78 C ATOM 11638 NE ARG H 72 -24.738 28.130 -36.964 1.00 29.39 N ATOM 11639 CZ ARG H 72 -25.019 28.629 -38.160 1.00 30.83 C ATOM 11640 NH1 ARG H 72 -24.222 29.545 -38.694 1.00 27.50 N ATOM 11641 NH2 ARG H 72 -26.084 28.204 -38.825 1.00 36.81 N ATOM 11642 N ILE H 73 -21.723 29.441 -31.201 1.00 32.88 N ATOM 11643 CA ILE H 73 -20.880 30.307 -30.395 1.00 36.27 C ATOM 11644 C ILE H 73 -20.275 29.519 -29.237 1.00 36.46 C ATOM 11645 O ILE H 73 -19.070 29.597 -28.990 1.00 37.74 O ATOM 11646 CB ILE H 73 -21.669 31.531 -29.885 1.00 33.16 C ATOM 11647 CG1 ILE H 73 -22.135 32.368 -31.078 1.00 26.26 C ATOM 11648 CG2 ILE H 73 -20.814 32.377 -28.956 1.00 32.42 C ATOM 11649 CD1 ILE H 73 -23.101 33.462 -30.724 1.00 30.18 C ATOM 11650 N ALA H 74 -21.102 28.731 -28.555 1.00 37.15 N ATOM 11651 CA ALA H 74 -20.627 27.952 -27.417 1.00 36.91 C ATOM 11652 C ALA H 74 -19.566 26.940 -27.845 1.00 38.16 C ATOM 11653 O ALA H 74 -18.509 26.849 -27.216 1.00 35.90 O ATOM 11654 CB ALA H 74 -21.784 27.253 -26.730 1.00 32.33 C ATOM 11655 N SER H 75 -19.841 26.195 -28.915 1.00 36.54 N ATOM 11656 CA SER H 75 -18.884 25.209 -29.425 1.00 37.59 C ATOM 11657 C SER H 75 -17.536 25.837 -29.766 1.00 38.08 C ATOM 11658 O SER H 75 -16.480 25.315 -29.376 1.00 39.99 O ATOM 11659 CB SER H 75 -19.443 24.496 -30.657 1.00 35.60 C ATOM 11660 OG SER H 75 -20.511 23.632 -30.305 1.00 42.87 O ATOM 11661 N GLU H 76 -17.568 26.960 -30.481 1.00 34.51 N ATOM 11662 CA GLU H 76 -16.326 27.637 -30.835 1.00 32.10 C ATOM 11663 C GLU H 76 -15.586 28.147 -29.600 1.00 35.02 C ATOM 11664 O GLU H 76 -14.358 28.092 -29.543 1.00 37.24 O ATOM 11665 CB GLU H 76 -16.590 28.800 -31.785 1.00 37.47 C ATOM 11666 CG GLU H 76 -15.321 29.467 -32.279 1.00 36.77 C ATOM 11667 CD GLU H 76 -14.490 28.546 -33.154 1.00 43.34 C ATOM 11668 OE1 GLU H 76 -15.012 28.117 -34.208 1.00 44.62 O ATOM 11669 OE2 GLU H 76 -13.322 28.260 -32.799 1.00 35.57 O ATOM 11670 N ALA H 77 -16.330 28.645 -28.617 1.00 31.26 N ATOM 11671 CA ALA H 77 -15.708 29.150 -27.399 1.00 32.50 C ATOM 11672 C ALA H 77 -15.008 28.016 -26.679 1.00 36.06 C ATOM 11673 O ALA H 77 -13.901 28.182 -26.167 1.00 34.93 O ATOM 11674 CB ALA H 77 -16.734 29.797 -26.495 1.00 37.09 C ATOM 11675 N SER H 78 -15.672 26.863 -26.655 1.00 38.92 N ATOM 11676 CA SER H 78 -15.134 25.645 -26.059 1.00 35.55 C ATOM 11677 C SER H 78 -13.817 25.277 -26.714 1.00 36.20 C ATOM 11678 O SER H 78 -12.808 25.017 -26.042 1.00 30.71 O ATOM 11679 CB SER H 78 -16.135 24.498 -26.203 1.00 37.84 C ATOM 11680 OG SER H 78 -15.570 23.266 -25.789 1.00 43.31 O ATOM 11681 N ARG H 79 -13.839 25.269 -28.041 1.00 35.91 N ATOM 11682 CA ARG H 79 -12.643 24.989 -28.815 1.00 36.72 C ATOM 11683 C ARG H 79 -11.520 25.965 -28.461 1.00 40.75 C ATOM 11684 O ARG H 79 -10.389 25.557 -28.210 1.00 41.35 O ATOM 11685 CB ARG H 79 -12.966 25.046 -30.306 1.00 39.18 C ATOM 11686 CG ARG H 79 -12.678 23.751 -31.028 1.00 49.36 C ATOM 11687 CD ARG H 79 -13.259 23.742 -32.427 1.00 49.84 C ATOM 11688 NE ARG H 79 -14.700 23.509 -32.431 1.00 52.47 N ATOM 11689 CZ ARG H 79 -15.580 24.294 -33.044 1.00 52.46 C ATOM 11690 NH1 ARG H 79 -15.166 25.368 -33.705 1.00 44.14 N ATOM 11691 NH2 ARG H 79 -16.874 24.005 -32.998 1.00 48.71 N ATOM 11692 N LEU H 80 -11.850 27.252 -28.423 1.00 38.86 N ATOM 11693 CA LEU H 80 -10.898 28.297 -28.073 1.00 37.94 C ATOM 11694 C LEU H 80 -10.243 28.078 -26.715 1.00 36.12 C ATOM 11695 O LEU H 80 -9.024 28.146 -26.594 1.00 40.79 O ATOM 11696 CB LEU H 80 -11.592 29.654 -28.089 1.00 44.15 C ATOM 11697 CG LEU H 80 -11.737 30.293 -29.463 1.00 41.01 C ATOM 11698 CD1 LEU H 80 -12.725 31.434 -29.395 1.00 36.37 C ATOM 11699 CD2 LEU H 80 -10.379 30.776 -29.937 1.00 41.31 C ATOM 11700 N ALA H 81 -11.056 27.830 -25.694 1.00 33.69 N ATOM 11701 CA ALA H 81 -10.536 27.568 -24.359 1.00 36.33 C ATOM 11702 C ALA H 81 -9.632 26.336 -24.364 1.00 42.06 C ATOM 11703 O ALA H 81 -8.574 26.331 -23.735 1.00 41.23 O ATOM 11704 CB ALA H 81 -11.675 27.391 -23.373 1.00 34.87 C ATOM 11705 N HIS H 82 -10.046 25.300 -25.091 1.00 47.40 N ATOM 11706 CA HIS H 82 -9.270 24.064 -25.172 1.00 44.30 C ATOM 11707 C HIS H 82 -7.905 24.284 -25.833 1.00 46.03 C ATOM 11708 O HIS H 82 -6.896 23.754 -25.367 1.00 49.89 O ATOM 11709 CB HIS H 82 -10.057 22.987 -25.930 1.00 41.05 C ATOM 11710 CG HIS H 82 -9.490 21.607 -25.787 1.00 58.77 C ATOM 11711 ND1 HIS H 82 -8.758 20.994 -26.782 1.00 61.05 N ATOM 11712 CD2 HIS H 82 -9.557 20.717 -24.768 1.00 59.34 C ATOM 11713 CE1 HIS H 82 -8.392 19.790 -26.380 1.00 54.18 C ATOM 11714 NE2 HIS H 82 -8.865 19.597 -25.162 1.00 56.83 N ATOM 11715 N TYR H 83 -7.875 25.067 -26.908 1.00 39.55 N ATOM 11716 CA TYR H 83 -6.634 25.324 -27.641 1.00 43.04 C ATOM 11717 C TYR H 83 -5.561 25.953 -26.771 1.00 40.59 C ATOM 11718 O TYR H 83 -4.372 25.745 -26.992 1.00 42.37 O ATOM 11719 CB TYR H 83 -6.890 26.235 -28.843 1.00 41.09 C ATOM 11720 CG TYR H 83 -7.709 25.596 -29.936 1.00 53.99 C ATOM 11721 CD1 TYR H 83 -7.898 24.216 -29.976 1.00 49.33 C ATOM 11722 CD2 TYR H 83 -8.293 26.370 -30.932 1.00 47.93 C ATOM 11723 CE1 TYR H 83 -8.649 23.630 -30.972 1.00 41.39 C ATOM 11724 CE2 TYR H 83 -9.045 25.789 -31.935 1.00 46.40 C ATOM 11725 CZ TYR H 83 -9.217 24.420 -31.949 1.00 48.38 C ATOM 11726 OH TYR H 83 -9.963 23.842 -32.949 1.00 60.85 O ATOM 11727 N ASN H 84 -5.984 26.730 -25.784 1.00 41.93 N ATOM 11728 CA ASN H 84 -5.037 27.437 -24.944 1.00 43.98 C ATOM 11729 C ASN H 84 -4.961 26.858 -23.542 1.00 46.79 C ATOM 11730 O ASN H 84 -4.582 27.548 -22.597 1.00 54.01 O ATOM 11731 CB ASN H 84 -5.398 28.916 -24.898 1.00 44.57 C ATOM 11732 CG ASN H 84 -5.287 29.569 -26.255 1.00 47.34 C ATOM 11733 OD1 ASN H 84 -4.206 29.995 -26.663 1.00 43.58 O ATOM 11734 ND2 ASN H 84 -6.401 29.628 -26.978 1.00 38.23 N