>>4DJH:HELIX    5   5 PHE A  126  VAL A  160  1                                  35    
FGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 5 5 PHE A 126 VAL A 160 1 35 ATOM 542 N PHE A 126 15.023 -32.164 66.571 1.00 92.78 N ANISOU 542 N PHE A 126 15830 10266 9157 2981 -2754 6 N ATOM 543 CA PHE A 126 15.918 -31.859 65.464 1.00 83.00 C ANISOU 543 CA PHE A 126 14247 9011 8278 2997 -2773 -216 C ATOM 544 C PHE A 126 16.960 -30.771 65.748 1.00 86.09 C ANISOU 544 C PHE A 126 14382 9537 8791 3126 -2971 -462 C ATOM 545 O PHE A 126 17.827 -30.505 64.914 1.00 86.58 O ANISOU 545 O PHE A 126 14149 9585 9162 3153 -2997 -652 O ATOM 546 CB PHE A 126 15.073 -31.495 64.249 1.00 82.89 C ANISOU 546 CB PHE A 126 14077 9029 8387 2742 -2454 -229 C ATOM 547 CG PHE A 126 14.155 -32.601 63.811 1.00 98.66 C ANISOU 547 CG PHE A 126 16271 10874 10339 2624 -2272 -36 C ATOM 548 CD1 PHE A 126 14.667 -33.835 63.438 1.00105.90 C ANISOU 548 CD1 PHE A 126 17246 11591 11398 2727 -2356 2 C ATOM 549 CD2 PHE A 126 12.782 -32.414 63.783 1.00 96.68 C ANISOU 549 CD2 PHE A 126 16134 10669 9932 2413 -2025 90 C ATOM 550 CE1 PHE A 126 13.830 -34.859 63.042 1.00 97.86 C ANISOU 550 CE1 PHE A 126 16394 10417 10372 2621 -2198 164 C ATOM 551 CE2 PHE A 126 11.942 -33.434 63.385 1.00106.44 C ANISOU 551 CE2 PHE A 126 17531 11750 11159 2305 -1862 249 C ATOM 552 CZ PHE A 126 12.470 -34.658 63.014 1.00105.53 C ANISOU 552 CZ PHE A 126 17472 11432 11192 2409 -1950 288 C ATOM 553 N GLY A 127 16.885 -30.153 66.923 1.00 88.50 N ANISOU 553 N GLY A 127 14790 9973 8862 3206 -3106 -470 N ATOM 554 CA GLY A 127 17.863 -29.153 67.311 1.00 76.81 C ANISOU 554 CA GLY A 127 13074 8610 7502 3344 -3322 -717 C ATOM 555 C GLY A 127 17.630 -27.823 66.621 1.00 80.88 C ANISOU 555 C GLY A 127 13275 9258 8200 3165 -3141 -876 C ATOM 556 O GLY A 127 16.672 -27.665 65.871 1.00 76.96 O ANISOU 556 O GLY A 127 12761 8773 7707 2939 -2857 -789 O ATOM 557 N ASP A 128 18.517 -26.867 66.876 1.00 99.39 N ANISOU 557 N ASP A 128 15364 11688 10711 3272 -3317 -1113 N ATOM 558 CA ASP A 128 18.357 -25.493 66.400 1.00102.65 C ANISOU 558 CA ASP A 128 15478 12219 11304 3120 -3183 -1266 C ATOM 559 C ASP A 128 18.383 -25.388 64.882 1.00 99.42 C ANISOU 559 C ASP A 128 14831 11752 11191 2944 -2942 -1284 C ATOM 560 O ASP A 128 17.452 -24.860 64.271 1.00 91.86 O ANISOU 560 O ASP A 128 13831 10846 10226 2726 -2692 -1218 O ATOM 561 CB ASP A 128 19.475 -24.612 66.961 1.00111.69 C ANISOU 561 CB ASP A 128 16376 13432 12629 3294 -3449 -1533 C ATOM 562 CG ASP A 128 18.951 -23.441 67.763 1.00121.35 C ANISOU 562 CG ASP A 128 17567 14821 13720 3257 -3473 -1621 C ATOM 563 OD1 ASP A 128 19.500 -22.326 67.620 1.00114.25 O ANISOU 563 OD1 ASP A 128 16345 13974 13091 3254 -3527 -1843 O ATOM 564 OD2 ASP A 128 17.997 -23.636 68.545 1.00137.04 O ANISOU 564 OD2 ASP A 128 19842 16882 15345 3230 -3434 -1477 O ATOM 565 N VAL A 129 19.473 -25.865 64.286 1.00107.40 N ANISOU 565 N VAL A 129 15682 12663 12462 3049 -3025 -1386 N ATOM 566 CA VAL A 129 19.664 -25.786 62.839 1.00107.48 C ANISOU 566 CA VAL A 129 15455 12636 12748 2905 -2806 -1425 C ATOM 567 C VAL A 129 18.422 -26.201 62.053 1.00 84.21 C ANISOU 567 C VAL A 129 12660 9672 9664 2690 -2515 -1225 C ATOM 568 O VAL A 129 17.925 -25.437 61.225 1.00 66.77 O ANISOU 568 O VAL A 129 10298 7527 7543 2498 -2298 -1225 O ATOM 569 CB VAL A 129 20.885 -26.617 62.365 1.00109.90 C ANISOU 569 CB VAL A 129 15641 12821 13295 3059 -2925 -1537 C ATOM 570 CG1 VAL A 129 22.174 -25.827 62.576 1.00 94.82 C ANISOU 570 CG1 VAL A 129 13413 10939 11676 3193 -3114 -1799 C ATOM 571 CG2 VAL A 129 20.944 -27.994 63.062 1.00119.87 C ANISOU 571 CG2 VAL A 129 17214 13959 14371 3235 -3111 -1418 C ATOM 572 N LEU A 130 17.903 -27.393 62.323 1.00 72.47 N ANISOU 572 N LEU A 130 11473 8091 7971 2723 -2518 -1054 N ATOM 573 CA LEU A 130 16.756 -27.879 61.573 1.00 84.28 C ANISOU 573 CA LEU A 130 13101 9553 9369 2531 -2258 -886 C ATOM 574 C LEU A 130 15.536 -27.004 61.841 1.00 97.64 C ANISOU 574 C LEU A 130 14853 11360 10886 2354 -2105 -809 C ATOM 575 O LEU A 130 14.790 -26.664 60.920 1.00112.24 O ANISOU 575 O LEU A 130 16628 13238 12782 2161 -1877 -772 O ATOM 576 CB LEU A 130 16.478 -29.345 61.897 1.00 86.37 C ANISOU 576 CB LEU A 130 13666 9668 9481 2608 -2305 -722 C ATOM 577 CG LEU A 130 17.613 -30.298 61.484 1.00 96.03 C ANISOU 577 CG LEU A 130 14818 10754 10913 2773 -2445 -808 C ATOM 578 CD1 LEU A 130 17.137 -31.741 61.366 1.00101.63 C ANISOU 578 CD1 LEU A 130 15779 11292 11543 2784 -2412 -640 C ATOM 579 CD2 LEU A 130 18.257 -29.871 60.167 1.00 84.81 C ANISOU 579 CD2 LEU A 130 13060 9369 9793 2707 -2321 -983 C ATOM 580 N CYS A 131 15.354 -26.617 63.100 1.00 82.19 N ANISOU 580 N CYS A 131 13022 9475 8731 2429 -2242 -801 N ATOM 581 CA CYS A 131 14.274 -25.711 63.475 1.00 70.55 C ANISOU 581 CA CYS A 131 11579 8121 7107 2280 -2120 -769 C ATOM 582 C CYS A 131 14.313 -24.443 62.622 1.00 78.66 C ANISOU 582 C CYS A 131 12287 9226 8375 2143 -2006 -899 C ATOM 583 O CYS A 131 13.310 -24.064 62.009 1.00 80.91 O ANISOU 583 O CYS A 131 12554 9538 8650 1947 -1795 -834 O ATOM 584 CB CYS A 131 14.376 -25.366 64.963 1.00 74.23 C ANISOU 584 CB CYS A 131 12170 8679 7355 2420 -2322 -806 C ATOM 585 SG CYS A 131 13.208 -24.111 65.539 1.00105.70 S ANISOU 585 SG CYS A 131 16142 12832 11186 2265 -2205 -836 S ATOM 586 N LYS A 132 15.479 -23.805 62.571 1.00 83.27 N ANISOU 586 N LYS A 132 12614 9832 9192 2247 -2150 -1079 N ATOM 587 CA LYS A 132 15.664 -22.586 61.789 1.00 78.85 C ANISOU 587 CA LYS A 132 11739 9327 8893 2127 -2054 -1193 C ATOM 588 C LYS A 132 15.381 -22.831 60.306 1.00 80.96 C ANISOU 588 C LYS A 132 11929 9549 9284 1965 -1814 -1114 C ATOM 589 O LYS A 132 14.876 -21.952 59.608 1.00 86.20 O ANISOU 589 O LYS A 132 12449 10258 10044 1797 -1658 -1107 O ATOM 590 CB LYS A 132 17.094 -22.060 61.970 1.00 82.87 C ANISOU 590 CB LYS A 132 11985 9838 9665 2280 -2250 -1400 C ATOM 591 CG LYS A 132 17.381 -21.472 63.353 1.00 93.03 C ANISOU 591 CG LYS A 132 13278 11198 10871 2429 -2495 -1530 C ATOM 592 CD LYS A 132 18.779 -20.859 63.438 1.00 96.13 C ANISOU 592 CD LYS A 132 13363 11582 11581 2568 -2685 -1764 C ATOM 593 CE LYS A 132 18.874 -19.827 64.559 1.00 93.10 C ANISOU 593 CE LYS A 132 12894 11293 11187 2653 -2878 -1931 C ATOM 594 NZ LYS A 132 20.090 -18.968 64.444 1.00101.13 N ANISOU 594 NZ LYS A 132 13541 12292 12592 2731 -3011 -2175 N ATOM 595 N ILE A 133 15.693 -24.030 59.830 1.00 82.73 N ANISOU 595 N ILE A 133 12251 9682 9501 2023 -1797 -1059 N ATOM 596 CA ILE A 133 15.574 -24.330 58.410 1.00 83.62 C ANISOU 596 CA ILE A 133 12279 9766 9728 1899 -1591 -1020 C ATOM 597 C ILE A 133 14.135 -24.601 58.002 1.00 83.34 C ANISOU 597 C ILE A 133 12425 9729 9513 1727 -1397 -862 C ATOM 598 O ILE A 133 13.644 -24.008 57.043 1.00 87.02 O ANISOU 598 O ILE A 133 12777 10240 10049 1567 -1224 -841 O ATOM 599 CB ILE A 133 16.447 -25.537 58.008 1.00 88.68 C ANISOU 599 CB ILE A 133 12935 10308 10452 2030 -1647 -1054 C ATOM 600 CG1 ILE A 133 17.921 -25.131 57.991 1.00 75.04 C ANISOU 600 CG1 ILE A 133 10937 8585 8988 2162 -1783 -1245 C ATOM 601 CG2 ILE A 133 16.043 -26.058 56.632 1.00 86.89 C ANISOU 601 CG2 ILE A 133 12693 10061 10260 1902 -1424 -998 C ATOM 602 CD1 ILE A 133 18.864 -26.270 57.702 1.00 58.75 C ANISOU 602 CD1 ILE A 133 8862 6423 7036 2312 -1868 -1315 C ATOM 603 N VAL A 134 13.459 -25.500 58.713 1.00 77.52 N ANISOU 603 N VAL A 134 11967 8933 8553 1760 -1426 -748 N ATOM 604 CA VAL A 134 12.102 -25.865 58.314 1.00 89.56 C ANISOU 604 CA VAL A 134 13653 10437 9940 1599 -1239 -614 C ATOM 605 C VAL A 134 11.175 -24.672 58.503 1.00 76.09 C ANISOU 605 C VAL A 134 11895 8830 8187 1452 -1156 -610 C ATOM 606 O VAL A 134 10.173 -24.543 57.800 1.00 83.76 O ANISOU 606 O VAL A 134 12879 9806 9140 1291 -987 -550 O ATOM 607 CB VAL A 134 11.524 -27.048 59.100 1.00 53.10 C ANISOU 607 CB VAL A 134 9343 5722 5112 1648 -1269 -481 C ATOM 608 CG1 VAL A 134 12.551 -28.163 59.245 1.00 57.53 C ANISOU 608 CG1 VAL A 134 9967 6170 5723 1834 -1420 -492 C ATOM 609 CG2 VAL A 134 11.023 -26.584 60.441 1.00123.87 C ANISOU 609 CG2 VAL A 134 18442 14750 13873 1664 -1340 -444 C ATOM 610 N LEU A 135 11.504 -23.805 59.456 1.00 61.74 N ANISOU 610 N LEU A 135 10010 7085 6361 1517 -1291 -690 N ATOM 611 CA LEU A 135 10.749 -22.573 59.634 1.00 63.35 C ANISOU 611 CA LEU A 135 10121 7380 6570 1391 -1234 -723 C ATOM 612 C LEU A 135 10.899 -21.680 58.406 1.00 48.93 C ANISOU 612 C LEU A 135 8037 5577 4977 1273 -1129 -766 C ATOM 613 O LEU A 135 9.910 -21.163 57.886 1.00 49.48 O ANISOU 613 O LEU A 135 8084 5667 5047 1113 -994 -721 O ATOM 614 CB LEU A 135 11.190 -21.829 60.900 1.00 51.48 C ANISOU 614 CB LEU A 135 8576 5954 5031 1505 -1420 -835 C ATOM 615 CG LEU A 135 10.577 -22.362 62.202 1.00 73.16 C ANISOU 615 CG LEU A 135 11598 8723 7476 1566 -1477 -770 C ATOM 616 CD1 LEU A 135 11.244 -21.735 63.411 1.00 62.51 C ANISOU 616 CD1 LEU A 135 10205 7463 6085 1721 -1696 -906 C ATOM 617 CD2 LEU A 135 9.059 -22.134 62.258 1.00 62.91 C ANISOU 617 CD2 LEU A 135 10404 7458 6041 1385 -1296 -695 C ATOM 618 N SER A 136 12.131 -21.513 57.932 1.00 60.49 N ANISOU 618 N SER A 136 9307 7034 6644 1351 -1188 -851 N ATOM 619 CA SER A 136 12.370 -20.683 56.759 1.00 65.68 C ANISOU 619 CA SER A 136 9725 7715 7517 1239 -1074 -871 C ATOM 620 C SER A 136 11.700 -21.319 55.538 1.00 67.42 C ANISOU 620 C SER A 136 10025 7912 7680 1122 -885 -762 C ATOM 621 O SER A 136 11.240 -20.617 54.643 1.00 72.86 O ANISOU 621 O SER A 136 10610 8631 8441 982 -761 -723 O ATOM 622 CB SER A 136 13.867 -20.453 56.529 1.00 52.55 C ANISOU 622 CB SER A 136 7833 6046 6087 1346 -1155 -990 C ATOM 623 OG SER A 136 14.531 -21.657 56.213 1.00 80.26 O ANISOU 623 OG SER A 136 11409 9503 9582 1451 -1167 -995 O ATOM 624 N ILE A 137 11.610 -22.646 55.524 1.00 59.53 N ANISOU 624 N ILE A 137 9216 6852 6552 1184 -876 -714 N ATOM 625 CA ILE A 137 10.876 -23.341 54.472 1.00 57.20 C ANISOU 625 CA ILE A 137 9011 6530 6193 1085 -716 -633 C ATOM 626 C ILE A 137 9.399 -23.037 54.635 1.00 65.13 C ANISOU 626 C ILE A 137 10134 7542 7070 946 -635 -556 C ATOM 627 O ILE A 137 8.736 -22.565 53.712 1.00 64.47 O ANISOU 627 O ILE A 137 9990 7488 7017 812 -516 -522 O ATOM 628 CB ILE A 137 11.089 -24.865 54.541 1.00 68.63 C ANISOU 628 CB ILE A 137 10631 7884 7560 1190 -744 -613 C ATOM 629 CG1 ILE A 137 12.539 -25.187 54.187 1.00 72.66 C ANISOU 629 CG1 ILE A 137 10994 8384 8228 1322 -812 -715 C ATOM 630 CG2 ILE A 137 10.132 -25.595 53.591 1.00 47.27 C ANISOU 630 CG2 ILE A 137 8033 5143 4784 1085 -591 -546 C ATOM 631 CD1 ILE A 137 12.898 -26.635 54.278 1.00 78.12 C ANISOU 631 CD1 ILE A 137 11825 8969 8888 1446 -872 -717 C ATOM 632 N ASP A 138 8.900 -23.295 55.838 1.00 68.13 N ANISOU 632 N ASP A 138 10681 7899 7307 982 -705 -531 N ATOM 633 CA ASP A 138 7.506 -23.056 56.160 1.00 62.79 C ANISOU 633 CA ASP A 138 10114 7230 6514 856 -625 -478 C ATOM 634 C ASP A 138 7.086 -21.703 55.620 1.00 63.83 C ANISOU 634 C ASP A 138 10060 7427 6765 730 -575 -509 C ATOM 635 O ASP A 138 6.089 -21.590 54.913 1.00 86.55 O ANISOU 635 O ASP A 138 12952 10298 9636 600 -463 -468 O ATOM 636 CB ASP A 138 7.308 -23.095 57.672 1.00 68.45 C ANISOU 636 CB ASP A 138 10971 7958 7078 924 -720 -478 C ATOM 637 CG ASP A 138 5.862 -22.899 58.076 1.00 72.16 C ANISOU 637 CG ASP A 138 11549 8439 7429 791 -618 -438 C ATOM 638 OD1 ASP A 138 4.967 -23.386 57.358 1.00 80.81 O ANISOU 638 OD1 ASP A 138 12710 9481 8514 681 -484 -381 O ATOM 639 OD2 ASP A 138 5.618 -22.264 59.121 1.00 76.43 O ANISOU 639 OD2 ASP A 138 12100 9046 7893 801 -674 -483 O ATOM 640 N TYR A 139 7.866 -20.678 55.941 1.00 61.26 N ANISOU 640 N TYR A 139 9553 7154 6569 774 -672 -587 N ATOM 641 CA TYR A 139 7.535 -19.316 55.540 1.00 64.72 C ANISOU 641 CA TYR A 139 9804 7633 7152 661 -647 -613 C ATOM 642 C TYR A 139 7.818 -19.033 54.061 1.00 62.68 C ANISOU 642 C TYR A 139 9409 7378 7030 587 -548 -568 C ATOM 643 O TYR A 139 7.068 -18.300 53.414 1.00 63.21 O ANISOU 643 O TYR A 139 9411 7453 7151 460 -481 -528 O ATOM 644 CB TYR A 139 8.269 -18.309 56.420 1.00 55.59 C ANISOU 644 CB TYR A 139 8488 6517 6116 734 -790 -723 C ATOM 645 CG TYR A 139 7.542 -18.039 57.713 1.00 59.76 C ANISOU 645 CG TYR A 139 9110 7080 6516 743 -857 -777 C ATOM 646 CD1 TYR A 139 7.862 -18.729 58.878 1.00 65.17 C ANISOU 646 CD1 TYR A 139 9951 7781 7029 880 -958 -805 C ATOM 647 CD2 TYR A 139 6.510 -17.115 57.765 1.00 65.89 C ANISOU 647 CD2 TYR A 139 9826 7877 7332 619 -817 -800 C ATOM 648 CE1 TYR A 139 7.181 -18.492 60.065 1.00 56.54 C ANISOU 648 CE1 TYR A 139 8956 6743 5781 887 -1000 -853 C ATOM 649 CE2 TYR A 139 5.825 -16.873 58.945 1.00 72.27 C ANISOU 649 CE2 TYR A 139 10710 8733 8016 624 -860 -871 C ATOM 650 CZ TYR A 139 6.164 -17.564 60.089 1.00 63.67 C ANISOU 650 CZ TYR A 139 9782 7679 6731 756 -942 -895 C ATOM 651 OH TYR A 139 5.485 -17.320 61.261 1.00 63.20 O ANISOU 651 OH TYR A 139 9807 7691 6517 761 -968 -964 O ATOM 652 N TYR A 140 8.895 -19.607 53.528 1.00 63.58 N ANISOU 652 N TYR A 140 9476 7488 7194 668 -541 -576 N ATOM 653 CA TYR A 140 9.214 -19.458 52.104 1.00 68.24 C ANISOU 653 CA TYR A 140 9954 8102 7874 604 -424 -533 C ATOM 654 C TYR A 140 8.108 -20.045 51.246 1.00 60.83 C ANISOU 654 C TYR A 140 9155 7156 6801 510 -307 -455 C ATOM 655 O TYR A 140 7.605 -19.390 50.336 1.00 60.71 O ANISOU 655 O TYR A 140 9076 7169 6821 398 -231 -399 O ATOM 656 CB TYR A 140 10.542 -20.141 51.755 1.00 45.03 C ANISOU 656 CB TYR A 140 6949 5164 4998 718 -426 -583 C ATOM 657 CG TYR A 140 11.742 -19.214 51.767 1.00 76.35 C ANISOU 657 CG TYR A 140 10667 9154 9190 752 -468 -650 C ATOM 658 CD1 TYR A 140 12.920 -19.576 52.410 1.00 74.26 C ANISOU 658 CD1 TYR A 140 10336 8868 9011 902 -582 -758 C ATOM 659 CD2 TYR A 140 11.698 -17.978 51.131 1.00 70.30 C ANISOU 659 CD2 TYR A 140 9726 8415 8570 634 -400 -605 C ATOM 660 CE1 TYR A 140 14.016 -18.731 52.426 1.00 78.14 C ANISOU 660 CE1 TYR A 140 10577 9369 9742 931 -619 -840 C ATOM 661 CE2 TYR A 140 12.789 -17.130 51.140 1.00 79.92 C ANISOU 661 CE2 TYR A 140 10702 9636 10028 653 -425 -663 C ATOM 662 CZ TYR A 140 13.943 -17.511 51.787 1.00 88.20 C ANISOU 662 CZ TYR A 140 11673 10666 11172 800 -530 -791 C ATOM 663 OH TYR A 140 15.034 -16.675 51.799 1.00 83.95 O ANISOU 663 OH TYR A 140 10873 10118 10904 818 -555 -870 O ATOM 664 N ASN A 141 7.729 -21.282 51.533 1.00 61.41 N ANISOU 664 N ASN A 141 9420 7182 6732 558 -303 -453 N ATOM 665 CA ASN A 141 6.638 -21.901 50.808 1.00 67.95 C ANISOU 665 CA ASN A 141 10375 7989 7455 476 -207 -406 C ATOM 666 C ASN A 141 5.424 -20.986 50.817 1.00 53.84 C ANISOU 666 C ASN A 141 8578 6209 5669 345 -187 -376 C ATOM 667 O ASN A 141 4.867 -20.676 49.767 1.00 48.83 O ANISOU 667 O ASN A 141 7912 5600 5043 255 -119 -340 O ATOM 668 CB ASN A 141 6.297 -23.264 51.415 1.00 63.17 C ANISOU 668 CB ASN A 141 9973 7300 6728 539 -219 -407 C ATOM 669 CG ASN A 141 4.887 -23.704 51.095 1.00 62.85 C ANISOU 669 CG ASN A 141 10061 7214 6604 436 -138 -375 C ATOM 670 OD1 ASN A 141 3.961 -23.465 51.868 1.00 61.29 O ANISOU 670 OD1 ASN A 141 9936 6990 6360 376 -141 -361 O ATOM 671 ND2 ASN A 141 4.713 -24.343 49.946 1.00 77.77 N ANISOU 671 ND2 ASN A 141 11967 9100 8482 417 -64 -382 N ATOM 672 N MET A 142 5.043 -20.532 52.007 1.00 46.48 N ANISOU 672 N MET A 142 7669 5264 4730 342 -256 -401 N ATOM 673 CA MET A 142 3.816 -19.767 52.183 1.00 54.38 C ANISOU 673 CA MET A 142 8662 6260 5739 226 -244 -401 C ATOM 674 C MET A 142 3.788 -18.510 51.314 1.00 57.84 C ANISOU 674 C MET A 142 8922 6733 6321 141 -240 -377 C ATOM 675 O MET A 142 2.812 -18.257 50.606 1.00 66.17 O ANISOU 675 O MET A 142 9986 7777 7376 43 -197 -347 O ATOM 676 CB MET A 142 3.650 -19.388 53.651 1.00 56.18 C ANISOU 676 CB MET A 142 8912 6493 5941 254 -321 -458 C ATOM 677 CG MET A 142 2.473 -18.476 53.929 1.00 65.24 C ANISOU 677 CG MET A 142 10015 7644 7129 141 -316 -493 C ATOM 678 SD MET A 142 2.095 -18.424 55.683 1.00 76.13 S ANISOU 678 SD MET A 142 11480 9047 8400 178 -367 -572 S ATOM 679 CE MET A 142 3.713 -17.989 56.314 1.00144.64 C ANISOU 679 CE MET A 142 20042 17773 17142 328 -510 -624 C ATOM 680 N PHE A 143 4.855 -17.724 51.372 1.00 49.30 N ANISOU 680 N PHE A 143 7678 5681 5373 182 -292 -388 N ATOM 681 CA PHE A 143 4.947 -16.502 50.587 1.00 56.04 C ANISOU 681 CA PHE A 143 8357 6549 6386 101 -286 -341 C ATOM 682 C PHE A 143 5.250 -16.775 49.116 1.00 67.63 C ANISOU 682 C PHE A 143 9816 8052 7828 73 -184 -253 C ATOM 683 O PHE A 143 4.626 -16.191 48.228 1.00 64.13 O ANISOU 683 O PHE A 143 9346 7614 7407 -20 -151 -179 O ATOM 684 CB PHE A 143 6.029 -15.595 51.165 1.00 61.35 C ANISOU 684 CB PHE A 143 8842 7227 7240 151 -366 -389 C ATOM 685 CG PHE A 143 5.538 -14.685 52.247 1.00 69.93 C ANISOU 685 CG PHE A 143 9862 8294 8415 132 -469 -471 C ATOM 686 CD1 PHE A 143 5.417 -15.136 53.554 1.00 68.37 C ANISOU 686 CD1 PHE A 143 9762 8107 8109 210 -539 -567 C ATOM 687 CD2 PHE A 143 5.200 -13.372 51.959 1.00 62.05 C ANISOU 687 CD2 PHE A 143 8703 7266 7605 40 -500 -454 C ATOM 688 CE1 PHE A 143 4.964 -14.292 54.556 1.00 64.14 C ANISOU 688 CE1 PHE A 143 9158 7574 7636 198 -628 -666 C ATOM 689 CE2 PHE A 143 4.749 -12.525 52.952 1.00 67.88 C ANISOU 689 CE2 PHE A 143 9361 7986 8444 28 -601 -559 C ATOM 690 CZ PHE A 143 4.630 -12.983 54.255 1.00 62.92 C ANISOU 690 CZ PHE A 143 8825 7391 7692 108 -661 -677 C ATOM 691 N THR A 144 6.218 -17.648 48.859 1.00 57.23 N ANISOU 691 N THR A 144 8520 6762 6462 161 -142 -267 N ATOM 692 CA THR A 144 6.650 -17.922 47.496 1.00 42.95 C ANISOU 692 CA THR A 144 6689 5011 4619 146 -34 -208 C ATOM 693 C THR A 144 5.497 -18.390 46.613 1.00 61.01 C ANISOU 693 C THR A 144 9110 7309 6761 81 22 -167 C ATOM 694 O THR A 144 5.314 -17.891 45.497 1.00 63.86 O ANISOU 694 O THR A 144 9435 7720 7111 14 78 -86 O ATOM 695 CB THR A 144 7.758 -18.981 47.472 1.00 44.80 C ANISOU 695 CB THR A 144 6936 5267 4821 263 -5 -270 C ATOM 696 OG1 THR A 144 9.020 -18.359 47.724 1.00 53.59 O ANISOU 696 OG1 THR A 144 7865 6393 6104 307 -25 -298 O ATOM 697 CG2 THR A 144 7.822 -19.650 46.129 1.00104.14 C ANISOU 697 CG2 THR A 144 14493 12847 12230 254 114 -245 C ATOM 698 N SER A 145 4.719 -19.349 47.107 1.00 65.19 N ANISOU 698 N SER A 145 9797 7789 7182 103 3 -221 N ATOM 699 CA SER A 145 3.690 -19.963 46.279 1.00 65.41 C ANISOU 699 CA SER A 145 9943 7817 7094 58 50 -216 C ATOM 700 C SER A 145 2.538 -18.996 45.997 1.00 60.23 C ANISOU 700 C SER A 145 9265 7146 6472 -52 18 -173 C ATOM 701 O SER A 145 1.992 -18.984 44.891 1.00 57.96 O ANISOU 701 O SER A 145 9007 6894 6123 -95 46 -139 O ATOM 702 CB SER A 145 3.191 -21.280 46.892 1.00 51.83 C ANISOU 702 CB SER A 145 8382 6023 5287 104 48 -285 C ATOM 703 OG SER A 145 2.576 -21.072 48.142 1.00 69.81 O ANISOU 703 OG SER A 145 10703 8235 7588 82 -6 -305 O ATOM 704 N ILE A 146 2.186 -18.163 46.970 1.00 50.78 N ANISOU 704 N ILE A 146 8013 5902 5379 -89 -53 -186 N ATOM 705 CA ILE A 146 1.091 -17.219 46.767 1.00 42.74 C ANISOU 705 CA ILE A 146 6956 4853 4428 -188 -100 -165 C ATOM 706 C ILE A 146 1.491 -16.103 45.790 1.00 56.32 C ANISOU 706 C ILE A 146 8553 6614 6233 -233 -104 -54 C ATOM 707 O ILE A 146 0.684 -15.697 44.957 1.00 75.68 O ANISOU 707 O ILE A 146 11018 9063 8673 -296 -124 -3 O ATOM 708 CB ILE A 146 0.587 -16.629 48.101 1.00 48.26 C ANISOU 708 CB ILE A 146 7617 5496 5223 -213 -171 -235 C ATOM 709 CG1 ILE A 146 -0.616 -15.714 47.867 1.00 52.94 C ANISOU 709 CG1 ILE A 146 8160 6047 5910 -311 -227 -240 C ATOM 710 CG2 ILE A 146 1.688 -15.850 48.796 1.00 48.12 C ANISOU 710 CG2 ILE A 146 7462 5494 5328 -170 -219 -237 C ATOM 711 CD1 ILE A 146 -1.778 -16.377 47.192 1.00 48.10 C ANISOU 711 CD1 ILE A 146 7658 5410 5209 -352 -202 -264 C ATOM 712 N PHE A 147 2.730 -15.619 45.887 1.00 62.00 N ANISOU 712 N PHE A 147 9151 7362 7043 -201 -89 -13 N ATOM 713 CA PHE A 147 3.236 -14.576 44.982 1.00 61.14 C ANISOU 713 CA PHE A 147 8920 7282 7029 -252 -66 115 C ATOM 714 C PHE A 147 3.356 -15.083 43.553 1.00 67.54 C ANISOU 714 C PHE A 147 9805 8182 7676 -254 31 197 C ATOM 715 O PHE A 147 3.076 -14.355 42.591 1.00 55.13 O ANISOU 715 O PHE A 147 8213 6632 6102 -317 38 320 O ATOM 716 CB PHE A 147 4.618 -14.098 45.420 1.00 59.09 C ANISOU 716 CB PHE A 147 8503 7029 6921 -215 -51 118 C ATOM 717 CG PHE A 147 4.606 -13.213 46.631 1.00 63.97 C ANISOU 717 CG PHE A 147 9002 7570 7735 -221 -162 50 C ATOM 718 CD1 PHE A 147 5.798 -12.797 47.201 1.00 65.95 C ANISOU 718 CD1 PHE A 147 9098 7813 8148 -174 -178 12 C ATOM 719 CD2 PHE A 147 3.415 -12.797 47.200 1.00 65.41 C ANISOU 719 CD2 PHE A 147 9210 7691 7952 -268 -253 0 C ATOM 720 CE1 PHE A 147 5.804 -11.981 48.310 1.00 61.83 C ANISOU 720 CE1 PHE A 147 8458 7231 7806 -168 -292 -76 C ATOM 721 CE2 PHE A 147 3.414 -11.982 48.316 1.00 56.22 C ANISOU 721 CE2 PHE A 147 7926 6473 6962 -267 -353 -88 C ATOM 722 CZ PHE A 147 4.611 -11.575 48.871 1.00 58.69 C ANISOU 722 CZ PHE A 147 8093 6785 7422 -213 -378 -128 C ATOM 723 N THR A 148 3.804 -16.330 43.429 1.00 59.25 N ANISOU 723 N THR A 148 8839 7185 6487 -177 101 126 N ATOM 724 CA THR A 148 3.936 -16.962 42.129 1.00 54.24 C ANISOU 724 CA THR A 148 8276 6653 5680 -161 195 159 C ATOM 725 C THR A 148 2.560 -17.012 41.466 1.00 52.51 C ANISOU 725 C THR A 148 8170 6428 5353 -208 146 172 C ATOM 726 O THR A 148 2.403 -16.623 40.308 1.00 54.95 O ANISOU 726 O THR A 148 8495 6811 5573 -241 172 271 O ATOM 727 CB THR A 148 4.525 -18.386 42.246 1.00 59.45 C ANISOU 727 CB THR A 148 9002 7344 6240 -61 254 41 C ATOM 728 OG1 THR A 148 5.826 -18.335 42.848 1.00 53.13 O ANISOU 728 OG1 THR A 148 8087 6544 5554 -6 279 15 O ATOM 729 CG2 THR A 148 4.633 -19.042 40.875 1.00 59.94 C ANISOU 729 CG2 THR A 148 9126 7525 6123 -39 349 43 C ATOM 730 N LEU A 149 1.559 -17.471 42.211 1.00 44.10 N ANISOU 730 N LEU A 149 7182 5276 4299 -210 73 70 N ATOM 731 CA LEU A 149 0.218 -17.639 41.663 1.00 48.83 C ANISOU 731 CA LEU A 149 7874 5855 4826 -246 18 41 C ATOM 732 C LEU A 149 -0.388 -16.315 41.238 1.00 59.14 C ANISOU 732 C LEU A 149 9121 7138 6211 -324 -64 149 C ATOM 733 O LEU A 149 -1.158 -16.255 40.281 1.00 74.73 O ANISOU 733 O LEU A 149 11158 9140 8097 -342 -105 175 O ATOM 734 CB LEU A 149 -0.697 -18.292 42.689 1.00 61.73 C ANISOU 734 CB LEU A 149 9574 7383 6499 -248 -25 -89 C ATOM 735 CG LEU A 149 -0.414 -19.764 42.956 1.00 65.94 C ANISOU 735 CG LEU A 149 10201 7909 6945 -174 38 -189 C ATOM 736 CD1 LEU A 149 -1.326 -20.253 44.048 1.00 69.61 C ANISOU 736 CD1 LEU A 149 10727 8258 7462 -197 11 -282 C ATOM 737 CD2 LEU A 149 -0.594 -20.586 41.696 1.00 55.71 C ANISOU 737 CD2 LEU A 149 8981 6682 5504 -140 74 -226 C ATOM 738 N THR A 150 -0.044 -15.258 41.961 1.00 59.73 N ANISOU 738 N THR A 150 9073 7156 6466 -363 -103 203 N ATOM 739 CA THR A 150 -0.513 -13.922 41.630 1.00 64.65 C ANISOU 739 CA THR A 150 9619 7731 7212 -436 -191 312 C ATOM 740 C THR A 150 0.141 -13.472 40.319 1.00 71.17 C ANISOU 740 C THR A 150 10440 8651 7952 -447 -129 492 C ATOM 741 O THR A 150 -0.542 -12.980 39.419 1.00 57.71 O ANISOU 741 O THR A 150 8779 6953 6197 -481 -192 586 O ATOM 742 CB THR A 150 -0.213 -12.931 42.778 1.00 57.41 C ANISOU 742 CB THR A 150 8553 6725 6537 -467 -248 302 C ATOM 743 OG1 THR A 150 -0.728 -13.460 44.007 1.00 56.54 O ANISOU 743 OG1 THR A 150 8467 6560 6456 -448 -278 136 O ATOM 744 CG2 THR A 150 -0.860 -11.583 42.517 1.00 51.34 C ANISOU 744 CG2 THR A 150 7697 5873 5935 -541 -363 391 C ATOM 745 N MET A 151 1.451 -13.684 40.194 1.00 66.44 N ANISOU 745 N MET A 151 9791 8129 7323 -416 -4 535 N ATOM 746 CA MET A 151 2.163 -13.326 38.967 1.00 60.11 C ANISOU 746 CA MET A 151 8982 7434 6423 -433 96 704 C ATOM 747 C MET A 151 1.703 -14.157 37.765 1.00 68.37 C ANISOU 747 C MET A 151 10185 8605 7189 -395 131 697 C ATOM 748 O MET A 151 1.708 -13.671 36.628 1.00 48.66 O ANISOU 748 O MET A 151 7727 6189 4571 -422 159 854 O ATOM 749 CB MET A 151 3.671 -13.473 39.155 1.00 46.60 C ANISOU 749 CB MET A 151 7164 5779 4762 -405 236 711 C ATOM 750 CG MET A 151 4.232 -12.508 40.171 1.00182.43 C ANISOU 750 CG MET A 151 24192 22871 22251 -438 194 726 C ATOM 751 SD MET A 151 3.535 -10.859 39.954 1.00 81.51 S ANISOU 751 SD MET A 151 11334 9974 9663 -545 79 901 S ATOM 752 CE MET A 151 3.958 -10.538 38.241 1.00 79.92 C ANISOU 752 CE MET A 151 11185 9895 9284 -589 213 1146 C ATOM 753 N MET A 152 1.313 -15.405 38.022 1.00 58.39 N ANISOU 753 N MET A 152 9012 7353 5822 -331 127 517 N ATOM 754 CA MET A 152 0.738 -16.255 36.987 1.00 55.60 C ANISOU 754 CA MET A 152 8796 7097 5231 -287 131 460 C ATOM 755 C MET A 152 -0.572 -15.689 36.489 1.00 62.08 C ANISOU 755 C MET A 152 9681 7875 6032 -324 -14 502 C ATOM 756 O MET A 152 -0.837 -15.670 35.292 1.00 78.86 O ANISOU 756 O MET A 152 11891 10106 7966 -308 -24 568 O ATOM 757 CB MET A 152 0.482 -17.663 37.514 1.00 66.43 C ANISOU 757 CB MET A 152 10233 8443 6565 -219 137 248 C ATOM 758 CG MET A 152 1.676 -18.586 37.408 1.00 75.03 C ANISOU 758 CG MET A 152 11309 9623 7577 -147 274 183 C ATOM 759 SD MET A 152 1.367 -20.217 38.108 1.00104.42 S ANISOU 759 SD MET A 152 15107 13270 11296 -69 263 -43 S ATOM 760 CE MET A 152 0.043 -20.786 37.058 1.00 50.23 C ANISOU 760 CE MET A 152 8368 6442 4274 -56 191 -133 C ATOM 761 N SER A 153 -1.408 -15.250 37.414 1.00 56.84 N ANISOU 761 N SER A 153 8975 7060 5561 -366 -135 449 N ATOM 762 CA SER A 153 -2.673 -14.660 37.033 1.00 67.34 C ANISOU 762 CA SER A 153 10340 8325 6919 -399 -292 467 C ATOM 763 C SER A 153 -2.423 -13.412 36.206 1.00 65.53 C ANISOU 763 C SER A 153 10086 8124 6687 -442 -323 703 C ATOM 764 O SER A 153 -3.046 -13.206 35.164 1.00 63.87 O ANISOU 764 O SER A 153 9966 7962 6339 -432 -406 773 O ATOM 765 CB SER A 153 -3.484 -14.331 38.274 1.00 73.27 C ANISOU 765 CB SER A 153 11019 8911 7907 -443 -392 357 C ATOM 766 OG SER A 153 -3.775 -15.522 38.976 1.00 85.05 O ANISOU 766 OG SER A 153 12556 10377 9383 -409 -351 165 O ATOM 767 N VAL A 154 -1.490 -12.588 36.670 1.00 60.07 N ANISOU 767 N VAL A 154 9274 7398 6152 -488 -260 827 N ATOM 768 CA VAL A 154 -1.149 -11.355 35.978 1.00 60.09 C ANISOU 768 CA VAL A 154 9237 7399 6196 -544 -270 1074 C ATOM 769 C VAL A 154 -0.629 -11.680 34.590 1.00 67.26 C ANISOU 769 C VAL A 154 10256 8494 6807 -514 -155 1205 C ATOM 770 O VAL A 154 -0.889 -10.955 33.626 1.00 74.60 O ANISOU 770 O VAL A 154 11246 9452 7646 -538 -206 1398 O ATOM 771 CB VAL A 154 -0.096 -10.553 36.768 1.00 57.26 C ANISOU 771 CB VAL A 154 8705 6967 6083 -595 -199 1154 C ATOM 772 CG1 VAL A 154 0.483 -9.435 35.922 1.00 51.15 C ANISOU 772 CG1 VAL A 154 7892 6204 5340 -657 -155 1431 C ATOM 773 CG2 VAL A 154 -0.712 -9.995 38.040 1.00 48.74 C ANISOU 773 CG2 VAL A 154 7514 5713 5291 -625 -337 1039 C ATOM 774 N ASP A 155 0.115 -12.773 34.489 1.00 69.17 N ANISOU 774 N ASP A 155 10527 8865 6890 -457 -2 1097 N ATOM 775 CA ASP A 155 0.630 -13.208 33.205 1.00 68.49 C ANISOU 775 CA ASP A 155 10538 8980 6503 -420 125 1174 C ATOM 776 C ASP A 155 -0.543 -13.550 32.276 1.00 65.55 C ANISOU 776 C ASP A 155 10329 8671 5907 -371 -9 1135 C ATOM 777 O ASP A 155 -0.605 -13.076 31.133 1.00 59.29 O ANISOU 777 O ASP A 155 9626 7986 4915 -374 -12 1312 O ATOM 778 CB ASP A 155 1.565 -14.399 33.394 1.00 70.70 C ANISOU 778 CB ASP A 155 10798 9366 6699 -358 291 1012 C ATOM 779 CG ASP A 155 2.081 -14.942 32.089 1.00 89.18 C ANISOU 779 CG ASP A 155 13228 11932 8723 -312 431 1044 C ATOM 780 OD1 ASP A 155 3.042 -14.347 31.557 1.00106.05 O ANISOU 780 OD1 ASP A 155 15315 14160 10819 -355 584 1225 O ATOM 781 OD2 ASP A 155 1.533 -15.957 31.600 1.00 84.41 O ANISOU 781 OD2 ASP A 155 12735 11415 7922 -233 395 879 O ATOM 782 N ARG A 156 -1.484 -14.340 32.786 1.00 55.52 N ANISOU 782 N ARG A 156 9093 7327 4676 -328 -124 906 N ATOM 783 CA ARG A 156 -2.669 -14.728 32.030 1.00 52.91 C ANISOU 783 CA ARG A 156 8890 7030 4185 -275 -273 816 C ATOM 784 C ARG A 156 -3.477 -13.511 31.630 1.00 64.87 C ANISOU 784 C ARG A 156 10428 8464 5757 -317 -452 987 C ATOM 785 O ARG A 156 -4.159 -13.511 30.608 1.00 66.51 O ANISOU 785 O ARG A 156 10756 8748 5765 -270 -565 1012 O ATOM 786 CB ARG A 156 -3.555 -15.650 32.868 1.00 65.09 C ANISOU 786 CB ARG A 156 10424 8455 5852 -247 -358 544 C ATOM 787 CG ARG A 156 -3.022 -17.046 33.066 1.00 65.60 C ANISOU 787 CG ARG A 156 10503 8588 5834 -184 -227 355 C ATOM 788 CD ARG A 156 -2.958 -17.782 31.759 1.00 69.38 C ANISOU 788 CD ARG A 156 11094 9261 6008 -101 -195 300 C ATOM 789 NE ARG A 156 -1.715 -17.508 31.049 1.00 81.64 N ANISOU 789 NE ARG A 156 12646 10990 7385 -98 -26 464 N ATOM 790 CZ ARG A 156 -1.516 -17.772 29.763 1.00 96.67 C ANISOU 790 CZ ARG A 156 14647 13102 8983 -40 22 487 C ATOM 791 NH1 ARG A 156 -2.486 -18.310 29.037 1.00 92.23 N ANISOU 791 NH1 ARG A 156 14191 12595 8259 32 -112 349 N ATOM 792 NH2 ARG A 156 -0.350 -17.493 29.198 1.00107.77 N ANISOU 792 NH2 ARG A 156 16036 14666 10245 -52 207 637 N ATOM 793 N TYR A 157 -3.405 -12.478 32.459 1.00 64.05 N ANISOU 793 N TYR A 157 10202 8198 5935 -397 -493 1091 N ATOM 794 CA TYR A 157 -4.166 -11.258 32.244 1.00 54.91 C ANISOU 794 CA TYR A 157 9039 6922 4904 -440 -679 1244 C ATOM 795 C TYR A 157 -3.706 -10.508 31.008 1.00 56.86 C ANISOU 795 C TYR A 157 9372 7278 4955 -450 -651 1541 C ATOM 796 O TYR A 157 -4.515 -10.006 30.230 1.00 78.22 O ANISOU 796 O TYR A 157 12173 9972 7574 -430 -825 1642 O ATOM 797 CB TYR A 157 -4.009 -10.342 33.439 1.00 52.66 C ANISOU 797 CB TYR A 157 8582 6446 4980 -521 -706 1275 C ATOM 798 CG TYR A 157 -4.877 -9.126 33.347 1.00 75.64 C ANISOU 798 CG TYR A 157 11461 9200 8079 -561 -921 1389 C ATOM 799 CD1 TYR A 157 -6.235 -9.218 33.587 1.00 71.27 C ANISOU 799 CD1 TYR A 157 10915 8540 7626 -539 -1123 1210 C ATOM 800 CD2 TYR A 157 -4.345 -7.887 33.014 1.00 67.96 C ANISOU 800 CD2 TYR A 157 10441 8174 7208 -622 -923 1671 C ATOM 801 CE1 TYR A 157 -7.043 -8.122 33.508 1.00 77.21 C ANISOU 801 CE1 TYR A 157 11626 9139 8573 -567 -1336 1292 C ATOM 802 CE2 TYR A 157 -5.149 -6.774 32.932 1.00 80.58 C ANISOU 802 CE2 TYR A 157 12006 9606 9004 -654 -1139 1775 C ATOM 803 CZ TYR A 157 -6.502 -6.900 33.180 1.00 89.27 C ANISOU 803 CZ TYR A 157 13113 10606 10199 -621 -1353 1577 C ATOM 804 OH TYR A 157 -7.329 -5.805 33.114 1.00 94.97 O ANISOU 804 OH TYR A 157 13788 11152 11144 -643 -1586 1655 O ATOM 805 N ILE A 158 -2.391 -10.404 30.854 1.00 57.54 N ANISOU 805 N ILE A 158 9417 7461 4984 -485 -431 1689 N ATOM 806 CA ILE A 158 -1.806 -9.699 29.723 1.00 79.58 C ANISOU 806 CA ILE A 158 12289 10371 7578 -509 -350 1991 C ATOM 807 C ILE A 158 -1.682 -10.643 28.537 1.00 83.63 C ANISOU 807 C ILE A 158 12970 11142 7663 -424 -261 1954 C ATOM 808 O ILE A 158 -1.308 -10.233 27.438 1.00 97.06 O ANISOU 808 O ILE A 158 14781 12986 9113 -427 -196 2189 O ATOM 809 CB ILE A 158 -0.417 -9.131 30.066 1.00 81.82 C ANISOU 809 CB ILE A 158 12432 10636 8019 -597 -138 2171 C ATOM 810 CG1 ILE A 158 0.628 -10.248 30.078 1.00 94.40 C ANISOU 810 CG1 ILE A 158 14002 12415 9452 -569 124 2071 C ATOM 811 CG2 ILE A 158 -0.452 -8.413 31.407 1.00 77.17 C ANISOU 811 CG2 ILE A 158 11640 9809 7871 -658 -205 2087 C ATOM 812 CD1 ILE A 158 1.809 -9.970 30.982 1.00 65.74 C ANISOU 812 CD1 ILE A 158 10146 8657 6175 -634 246 2040 C ATOM 813 N ALA A 159 -2.000 -11.912 28.769 1.00 72.07 N ANISOU 813 N ALA A 159 11528 9736 6118 -346 -262 1654 N ATOM 814 CA ALA A 159 -1.932 -12.906 27.720 1.00 71.51 C ANISOU 814 CA ALA A 159 11596 9904 5669 -252 -195 1557 C ATOM 815 C ALA A 159 -3.123 -12.789 26.775 1.00 72.46 C ANISOU 815 C ALA A 159 11879 10067 5585 -184 -424 1568 C ATOM 816 O ALA A 159 -2.998 -13.033 25.579 1.00 81.62 O ANISOU 816 O ALA A 159 13183 11446 6382 -121 -386 1630 O ATOM 817 CB ALA A 159 -1.866 -14.285 28.324 1.00 60.17 C ANISOU 817 CB ALA A 159 10116 8483 4261 -191 -136 1230 C ATOM 818 N VAL A 160 -4.272 -12.386 27.301 1.00 82.36 N ATOM 819 CA VAL A 160 -5.489 -12.367 26.497 1.00 98.94 C ATOM 820 C VAL A 160 -5.433 -11.316 25.389 1.00104.84 C ATOM 821 O VAL A 160 -6.142 -11.433 24.393 1.00122.46 O ATOM 822 CB VAL A 160 -6.755 -12.131 27.353 1.00102.10 C ATOM 823 CG1 VAL A 160 -6.853 -13.164 28.489 1.00 59.26 C ATOM 824 CG2 VAL A 160 -6.760 -10.728 27.892 1.00 91.67 C