>>4DJH:HELIX   25  25 PHE B  126  HIS B  162  1                                  37    
FGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCH
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 25 25 PHE B 126 HIS B 162 1 37 ATOM 4022 N PHE B 126 -6.561 -52.521 68.023 1.00106.04 N ANISOU 4022 N PHE B 126 19155 12812 8322 3060 1260 -2163 N ATOM 4023 CA PHE B 126 -7.608 -52.859 67.070 1.00114.53 C ANISOU 4023 CA PHE B 126 19884 14042 9590 3121 1549 -2075 C ATOM 4024 C PHE B 126 -8.487 -54.031 67.509 1.00116.34 C ANISOU 4024 C PHE B 126 19928 14578 9698 3096 1924 -1911 C ATOM 4025 O PHE B 126 -9.435 -54.394 66.812 1.00120.31 O ANISOU 4025 O PHE B 126 20117 15232 10364 3141 2186 -1822 O ATOM 4026 CB PHE B 126 -6.977 -53.154 65.712 1.00115.74 C ANISOU 4026 CB PHE B 126 19886 14098 9994 2965 1354 -1972 C ATOM 4027 CG PHE B 126 -5.982 -52.116 65.272 1.00112.10 C ANISOU 4027 CG PHE B 126 19599 13329 9665 2938 958 -2100 C ATOM 4028 CD1 PHE B 126 -6.406 -50.883 64.812 1.00109.49 C ANISOU 4028 CD1 PHE B 126 19256 12844 9503 3117 920 -2255 C ATOM 4029 CD2 PHE B 126 -4.622 -52.373 65.324 1.00110.06 C ANISOU 4029 CD2 PHE B 126 19501 12930 9388 2726 615 -2052 C ATOM 4030 CE1 PHE B 126 -5.496 -49.928 64.410 1.00106.93 C ANISOU 4030 CE1 PHE B 126 19082 12226 9322 3073 550 -2352 C ATOM 4031 CE2 PHE B 126 -3.708 -51.421 64.922 1.00106.10 C ANISOU 4031 CE2 PHE B 126 19131 12144 9037 2681 250 -2151 C ATOM 4032 CZ PHE B 126 -4.145 -50.198 64.465 1.00107.63 C ANISOU 4032 CZ PHE B 126 19317 12182 9395 2849 218 -2296 C ATOM 4033 N GLY B 127 -8.176 -54.621 68.659 1.00112.53 N ANISOU 4033 N GLY B 127 19629 14182 8946 3020 1940 -1863 N ATOM 4034 CA GLY B 127 -8.971 -55.723 69.174 1.00115.76 C ANISOU 4034 CA GLY B 127 19882 14869 9231 2980 2280 -1699 C ATOM 4035 C GLY B 127 -8.763 -57.007 68.396 1.00118.09 C ANISOU 4035 C GLY B 127 19947 15264 9657 2764 2298 -1456 C ATOM 4036 O GLY B 127 -8.002 -57.041 67.430 1.00122.59 O ANISOU 4036 O GLY B 127 20478 15696 10403 2653 2055 -1423 O ATOM 4037 N ASP B 128 -9.455 -58.065 68.807 1.00122.38 N ANISOU 4037 N ASP B 128 20332 16045 10120 2702 2587 -1283 N ATOM 4038 CA ASP B 128 -9.233 -59.397 68.245 1.00126.41 C ANISOU 4038 CA ASP B 128 20649 16652 10729 2481 2599 -1039 C ATOM 4039 C ASP B 128 -9.651 -59.525 66.787 1.00121.12 C ANISOU 4039 C ASP B 128 19646 15996 10378 2468 2663 -967 C ATOM 4040 O ASP B 128 -8.910 -60.064 65.961 1.00107.61 O ANISOU 4040 O ASP B 128 17878 14215 8794 2304 2473 -863 O ATOM 4041 CB ASP B 128 -9.980 -60.440 69.068 1.00122.85 C ANISOU 4041 CB ASP B 128 20099 16446 10133 2423 2903 -869 C ATOM 4042 CG ASP B 128 -9.513 -60.478 70.495 1.00128.21 C ANISOU 4042 CG ASP B 128 21108 17127 10479 2414 2836 -910 C ATOM 4043 OD1 ASP B 128 -9.352 -59.390 71.085 1.00127.40 O ANISOU 4043 OD1 ASP B 128 21251 16915 10241 2571 2745 -1124 O ATOM 4044 OD2 ASP B 128 -9.290 -61.587 71.020 1.00136.79 O1+ ANISOU 4044 OD2 ASP B 128 22215 18314 11444 2251 2860 -727 O1+ ATOM 4045 N VAL B 129 -10.847 -59.041 66.482 1.00124.49 N ANISOU 4045 N VAL B 129 19848 16517 10936 2643 2929 -1021 N ATOM 4046 CA VAL B 129 -11.394 -59.168 65.143 1.00128.56 C ANISOU 4046 CA VAL B 129 20019 17066 11760 2649 3016 -947 C ATOM 4047 C VAL B 129 -10.380 -58.687 64.109 1.00113.13 C ANISOU 4047 C VAL B 129 18107 14885 9991 2574 2652 -1003 C ATOM 4048 O VAL B 129 -10.081 -59.397 63.148 1.00109.64 O ANISOU 4048 O VAL B 129 17402 14441 9817 2365 2523 -840 O ATOM 4049 CB VAL B 129 -12.709 -58.379 65.004 1.00158.18 C ANISOU 4049 CB VAL B 129 23561 20893 15647 2884 3277 -1052 C ATOM 4050 CG1 VAL B 129 -13.224 -58.443 63.572 1.00162.44 C ANISOU 4050 CG1 VAL B 129 23744 21450 16527 2899 3327 -980 C ATOM 4051 CG2 VAL B 129 -13.759 -58.917 65.980 1.00174.15 C ANISOU 4051 CG2 VAL B 129 25467 23150 17551 2913 3625 -972 C ATOM 4052 N LEU B 130 -9.841 -57.489 64.311 1.00102.82 N ANISOU 4052 N LEU B 130 17083 13378 8607 2703 2446 -1219 N ATOM 4053 CA LEU B 130 -8.839 -56.955 63.396 1.00 93.98 C ANISOU 4053 CA LEU B 130 15959 12024 7723 2587 2057 -1253 C ATOM 4054 C LEU B 130 -7.529 -57.718 63.565 1.00 99.07 C ANISOU 4054 C LEU B 130 16746 12601 8295 2336 1783 -1147 C ATOM 4055 O LEU B 130 -6.772 -57.883 62.606 1.00107.25 O ANISOU 4055 O LEU B 130 17634 13530 9586 2155 1529 -1064 O ATOM 4056 CB LEU B 130 -8.634 -55.451 63.623 1.00 87.13 C ANISOU 4056 CB LEU B 130 15363 10943 6801 2789 1904 -1509 C ATOM 4057 CG LEU B 130 -9.646 -54.548 62.901 1.00 93.43 C ANISOU 4057 CG LEU B 130 15942 11719 7837 2990 2030 -1600 C ATOM 4058 CD1 LEU B 130 -9.593 -53.104 63.403 1.00100.51 C ANISOU 4058 CD1 LEU B 130 17154 12417 8619 3233 1934 -1872 C ATOM 4059 CD2 LEU B 130 -9.437 -54.587 61.387 1.00 81.98 C ANISOU 4059 CD2 LEU B 130 14162 10194 6791 2832 1842 -1474 C ATOM 4060 N CYS B 131 -7.277 -58.199 64.780 1.00 84.93 N ANISOU 4060 N CYS B 131 15237 10877 6154 2333 1842 -1143 N ATOM 4061 CA CYS B 131 -6.067 -58.963 65.062 1.00 83.66 C ANISOU 4061 CA CYS B 131 15223 10656 5908 2111 1585 -1039 C ATOM 4062 C CYS B 131 -6.061 -60.278 64.288 1.00 89.72 C ANISOU 4062 C CYS B 131 15645 11539 6905 1884 1619 -789 C ATOM 4063 O CYS B 131 -5.063 -60.640 63.661 1.00 74.54 O ANISOU 4063 O CYS B 131 13651 9507 5162 1690 1339 -710 O ATOM 4064 CB CYS B 131 -5.941 -59.249 66.563 1.00 79.69 C ANISOU 4064 CB CYS B 131 15001 10216 5062 2127 1633 -1051 C ATOM 4065 SG CYS B 131 -4.475 -60.208 67.016 1.00 93.88 S ANISOU 4065 SG CYS B 131 16976 11934 6760 1869 1304 -917 S ATOM 4066 N LYS B 132 -7.178 -60.994 64.343 1.00 93.04 N ANISOU 4066 N LYS B 132 15848 12177 7325 1912 1963 -668 N ATOM 4067 CA LYS B 132 -7.296 -62.271 63.656 1.00 87.94 C ANISOU 4067 CA LYS B 132 14878 11640 6894 1708 2010 -438 C ATOM 4068 C LYS B 132 -7.242 -62.068 62.139 1.00 89.99 C ANISOU 4068 C LYS B 132 14810 11822 7560 1634 1869 -416 C ATOM 4069 O LYS B 132 -6.711 -62.908 61.408 1.00 90.29 O ANISOU 4069 O LYS B 132 14666 11846 7794 1433 1726 -275 O ATOM 4070 CB LYS B 132 -8.595 -62.970 64.062 1.00 69.07 C ANISOU 4070 CB LYS B 132 12321 9491 4432 1764 2417 -319 C ATOM 4071 N ILE B 133 -7.792 -60.950 61.671 1.00 90.73 N ANISOU 4071 N ILE B 133 14840 11864 7770 1805 1907 -556 N ATOM 4072 CA ILE B 133 -7.766 -60.618 60.249 1.00 88.34 C ANISOU 4072 CA ILE B 133 14261 11481 7824 1754 1768 -543 C ATOM 4073 C ILE B 133 -6.350 -60.251 59.793 1.00 80.84 C ANISOU 4073 C ILE B 133 13439 10320 6958 1624 1387 -579 C ATOM 4074 O ILE B 133 -5.798 -60.884 58.887 1.00 65.42 O ANISOU 4074 O ILE B 133 11294 8347 5217 1439 1240 -459 O ATOM 4075 CB ILE B 133 -8.740 -59.457 59.926 1.00 85.89 C ANISOU 4075 CB ILE B 133 13868 11156 7609 1985 1898 -681 C ATOM 4076 CG1 ILE B 133 -10.190 -59.930 60.041 1.00 78.09 C ANISOU 4076 CG1 ILE B 133 12632 10391 6649 2084 2271 -608 C ATOM 4077 CG2 ILE B 133 -8.496 -58.913 58.519 1.00 80.24 C ANISOU 4077 CG2 ILE B 133 12953 10314 7222 1935 1688 -682 C ATOM 4078 CD1 ILE B 133 -11.216 -58.820 59.865 1.00 72.94 C ANISOU 4078 CD1 ILE B 133 11898 9736 6081 2338 2423 -749 C ATOM 4079 N VAL B 134 -5.770 -59.231 60.424 1.00 63.90 N ANISOU 4079 N VAL B 134 11613 8015 4650 1724 1231 -748 N ATOM 4080 CA VAL B 134 -4.445 -58.743 60.047 1.00 68.65 C ANISOU 4080 CA VAL B 134 12336 8402 5345 1610 868 -790 C ATOM 4081 C VAL B 134 -3.410 -59.871 60.031 1.00 82.15 C ANISOU 4081 C VAL B 134 14028 10118 7069 1374 702 -642 C ATOM 4082 O VAL B 134 -2.424 -59.811 59.293 1.00 87.75 O ANISOU 4082 O VAL B 134 14673 10700 7966 1232 445 -607 O ATOM 4083 CB VAL B 134 -3.945 -57.683 61.030 1.00 74.17 C ANISOU 4083 CB VAL B 134 13431 8937 5812 1736 722 -986 C ATOM 4084 CG1 VAL B 134 -3.666 -58.337 62.367 1.00105.69 C ANISOU 4084 CG1 VAL B 134 17696 12999 9463 1722 762 -978 C ATOM 4085 CG2 VAL B 134 -2.691 -57.025 60.502 1.00 66.52 C ANISOU 4085 CG2 VAL B 134 12538 7734 5002 1623 351 -1027 C ATOM 4086 N LEU B 135 -3.623 -60.882 60.871 1.00 79.37 N ANISOU 4086 N LEU B 135 13736 9906 6515 1338 851 -552 N ATOM 4087 CA LEU B 135 -2.724 -62.028 60.940 1.00 57.44 C ANISOU 4087 CA LEU B 135 10945 7135 3746 1130 707 -406 C ATOM 4088 C LEU B 135 -2.923 -62.980 59.771 1.00 68.55 C ANISOU 4088 C LEU B 135 11976 8629 5442 985 755 -242 C ATOM 4089 O LEU B 135 -1.948 -63.452 59.187 1.00 75.40 O ANISOU 4089 O LEU B 135 12760 9421 6468 820 539 -170 O ATOM 4090 CB LEU B 135 -2.910 -62.789 62.252 1.00 76.41 C ANISOU 4090 CB LEU B 135 13557 9649 5827 1140 844 -352 C ATOM 4091 CG LEU B 135 -2.062 -62.331 63.442 1.00 82.66 C ANISOU 4091 CG LEU B 135 14766 10321 6319 1177 650 -463 C ATOM 4092 CD1 LEU B 135 -2.392 -63.167 64.664 1.00 92.81 C ANISOU 4092 CD1 LEU B 135 16240 11747 7277 1188 824 -382 C ATOM 4093 CD2 LEU B 135 -0.562 -62.398 63.138 1.00 72.74 C ANISOU 4093 CD2 LEU B 135 13558 8884 5194 1007 261 -445 C ATOM 4094 N SER B 136 -4.172 -63.285 59.437 1.00 54.94 N ANISOU 4094 N SER B 136 10023 7061 3789 1048 1034 -187 N ATOM 4095 CA SER B 136 -4.422 -64.189 58.329 1.00 59.56 C ANISOU 4095 CA SER B 136 10263 7724 4644 915 1068 -44 C ATOM 4096 C SER B 136 -3.833 -63.597 57.055 1.00 64.67 C ANISOU 4096 C SER B 136 10773 8247 5552 865 856 -81 C ATOM 4097 O SER B 136 -3.340 -64.335 56.190 1.00 61.31 O ANISOU 4097 O SER B 136 10160 7817 5318 710 748 19 O ATOM 4098 CB SER B 136 -5.911 -64.491 58.164 1.00 53.59 C ANISOU 4098 CB SER B 136 9274 7144 3942 997 1385 12 C ATOM 4099 OG SER B 136 -6.632 -63.345 57.787 1.00 80.62 O ANISOU 4099 OG SER B 136 12644 10551 7435 1171 1464 -109 O ATOM 4100 N ILE B 137 -3.875 -62.273 56.952 1.00 71.87 N ANISOU 4100 N ILE B 137 11787 9054 6465 997 798 -223 N ATOM 4101 CA ILE B 137 -3.300 -61.585 55.812 1.00 69.48 C ANISOU 4101 CA ILE B 137 11386 8623 6389 953 596 -251 C ATOM 4102 C ILE B 137 -1.792 -61.729 55.828 1.00 73.07 C ANISOU 4102 C ILE B 137 11959 8942 6860 800 313 -233 C ATOM 4103 O ILE B 137 -1.144 -61.780 54.773 1.00 64.51 O ANISOU 4103 O ILE B 137 10720 7801 5988 684 164 -181 O ATOM 4104 CB ILE B 137 -3.653 -60.080 55.834 1.00 68.02 C ANISOU 4104 CB ILE B 137 11322 8329 6192 1134 581 -406 C ATOM 4105 CG1 ILE B 137 -5.161 -59.870 55.631 1.00 75.30 C ANISOU 4105 CG1 ILE B 137 12073 9379 7157 1296 851 -423 C ATOM 4106 CG2 ILE B 137 -2.862 -59.336 54.756 1.00 54.32 C ANISOU 4106 CG2 ILE B 137 9530 6436 4672 1064 340 -418 C ATOM 4107 CD1 ILE B 137 -5.597 -58.408 55.710 1.00 71.97 C ANISOU 4107 CD1 ILE B 137 11771 8847 6727 1501 850 -583 C ATOM 4108 N ASP B 138 -1.227 -61.700 57.028 1.00 76.89 N ANISOU 4108 N ASP B 138 12728 9371 7117 809 233 -284 N ATOM 4109 CA ASP B 138 0.221 -61.849 57.190 1.00 67.75 C ANISOU 4109 CA ASP B 138 11691 8080 5972 668 -51 -268 C ATOM 4110 C ASP B 138 0.702 -63.188 56.598 1.00 65.75 C ANISOU 4110 C ASP B 138 11219 7895 5867 489 -85 -111 C ATOM 4111 O ASP B 138 1.662 -63.270 55.820 1.00 67.06 O ANISOU 4111 O ASP B 138 11276 7981 6224 366 -273 -71 O ATOM 4112 CB ASP B 138 0.614 -61.777 58.670 1.00 78.58 C ANISOU 4112 CB ASP B 138 13407 9403 7047 711 -120 -336 C ATOM 4113 CG ASP B 138 2.114 -61.627 58.875 1.00 84.84 C ANISOU 4113 CG ASP B 138 14344 10023 7867 590 -456 -350 C ATOM 4114 OD1 ASP B 138 2.635 -62.313 59.769 1.00 71.95 O ANISOU 4114 OD1 ASP B 138 12834 8403 6101 514 -535 -292 O ATOM 4115 OD2 ASP B 138 2.754 -60.808 58.173 1.00 86.97 O1+ ANISOU 4115 OD2 ASP B 138 14606 10142 8295 570 -643 -411 O1+ ATOM 4116 N TYR B 139 -0.037 -64.225 56.970 1.00 65.52 N ANISOU 4116 N TYR B 139 11123 8019 5753 484 116 -22 N ATOM 4117 CA TYR B 139 0.246 -65.587 56.527 1.00 55.60 C ANISOU 4117 CA TYR B 139 9675 6828 4621 332 107 123 C ATOM 4118 C TYR B 139 -0.171 -65.865 55.082 1.00 65.65 C ANISOU 4118 C TYR B 139 10622 8161 6161 285 170 178 C ATOM 4119 O TYR B 139 0.634 -66.333 54.266 1.00 68.69 O ANISOU 4119 O TYR B 139 10869 8505 6725 163 28 231 O ATOM 4120 CB TYR B 139 -0.409 -66.604 57.468 1.00 54.86 C ANISOU 4120 CB TYR B 139 9636 6862 4346 332 291 212 C ATOM 4121 CG TYR B 139 0.373 -66.777 58.736 1.00 59.67 C ANISOU 4121 CG TYR B 139 10546 7407 4720 310 158 208 C ATOM 4122 CD1 TYR B 139 0.025 -66.089 59.882 1.00 76.84 C ANISOU 4122 CD1 TYR B 139 13004 9583 6607 443 229 115 C ATOM 4123 CD2 TYR B 139 1.486 -67.596 58.771 1.00 61.75 C ANISOU 4123 CD2 TYR B 139 10816 7600 5046 166 -53 290 C ATOM 4124 CE1 TYR B 139 0.756 -66.230 61.052 1.00 80.82 C ANISOU 4124 CE1 TYR B 139 13809 10025 6873 425 85 107 C ATOM 4125 CE2 TYR B 139 2.226 -67.746 59.924 1.00 68.68 C ANISOU 4125 CE2 TYR B 139 11973 8410 5713 145 -205 291 C ATOM 4126 CZ TYR B 139 1.857 -67.061 61.061 1.00 73.24 C ANISOU 4126 CZ TYR B 139 12846 8993 5989 271 -142 201 C ATOM 4127 OH TYR B 139 2.595 -67.225 62.200 1.00 80.38 O ANISOU 4127 OH TYR B 139 14044 9830 6665 250 -311 203 O ATOM 4128 N TYR B 140 -1.415 -65.528 54.761 1.00 69.94 N ANISOU 4128 N TYR B 140 11048 8799 6728 392 377 158 N ATOM 4129 CA TYR B 140 -1.885 -65.629 53.388 1.00 56.86 C ANISOU 4129 CA TYR B 140 9106 7192 5307 367 419 195 C ATOM 4130 C TYR B 140 -0.840 -65.032 52.480 1.00 61.05 C ANISOU 4130 C TYR B 140 9610 7597 5988 304 199 164 C ATOM 4131 O TYR B 140 -0.297 -65.715 51.613 1.00 65.22 O ANISOU 4131 O TYR B 140 9976 8130 6673 184 117 232 O ATOM 4132 CB TYR B 140 -3.224 -64.919 53.168 1.00 45.89 C ANISOU 4132 CB TYR B 140 7627 5876 3933 519 612 145 C ATOM 4133 CG TYR B 140 -4.413 -65.845 53.282 1.00 58.86 C ANISOU 4133 CG TYR B 140 9098 7682 5585 525 847 232 C ATOM 4134 CD1 TYR B 140 -5.404 -65.623 54.227 1.00 71.61 C ANISOU 4134 CD1 TYR B 140 10785 9383 7041 657 1067 206 C ATOM 4135 CD2 TYR B 140 -4.529 -66.956 52.460 1.00 64.34 C ANISOU 4135 CD2 TYR B 140 9555 8440 6450 399 849 340 C ATOM 4136 CE1 TYR B 140 -6.491 -66.474 54.341 1.00 73.37 C ANISOU 4136 CE1 TYR B 140 10828 9757 7291 650 1290 303 C ATOM 4137 CE2 TYR B 140 -5.610 -67.817 52.562 1.00 67.66 C ANISOU 4137 CE2 TYR B 140 9809 8996 6904 388 1046 429 C ATOM 4138 CZ TYR B 140 -6.588 -67.575 53.510 1.00 70.56 C ANISOU 4138 CZ TYR B 140 10232 9452 7127 507 1269 419 C ATOM 4139 OH TYR B 140 -7.677 -68.414 53.621 1.00 59.44 O ANISOU 4139 OH TYR B 140 8636 8179 5768 487 1476 522 O ATOM 4140 N ASN B 141 -0.538 -63.758 52.696 1.00 53.12 N ANISOU 4140 N ASN B 141 8771 6477 4935 385 104 61 N ATOM 4141 CA ASN B 141 0.441 -63.087 51.864 1.00 60.98 C ANISOU 4141 CA ASN B 141 9744 7347 6078 321 -98 45 C ATOM 4142 C ASN B 141 1.719 -63.899 51.732 1.00 59.73 C ANISOU 4142 C ASN B 141 9556 7147 5990 159 -264 114 C ATOM 4143 O ASN B 141 2.250 -64.065 50.634 1.00 60.36 O ANISOU 4143 O ASN B 141 9466 7218 6249 70 -338 162 O ATOM 4144 CB ASN B 141 0.802 -61.717 52.418 1.00 57.17 C ANISOU 4144 CB ASN B 141 9497 6712 5514 406 -219 -70 C ATOM 4145 CG ASN B 141 2.019 -61.137 51.738 1.00 67.89 C ANISOU 4145 CG ASN B 141 10847 7927 7023 304 -450 -63 C ATOM 4146 OD1 ASN B 141 3.160 -61.447 52.099 1.00 51.56 O ANISOU 4146 OD1 ASN B 141 8851 5785 4955 196 -618 -42 O ATOM 4147 ND2 ASN B 141 1.785 -60.318 50.718 1.00 68.71 N ANISOU 4147 ND2 ASN B 141 10847 7992 7268 332 -460 -67 N ATOM 4148 N MET B 142 2.215 -64.394 52.860 1.00 55.14 N ANISOU 4148 N MET B 142 9145 6542 5263 129 -322 117 N ATOM 4149 CA MET B 142 3.470 -65.126 52.878 1.00 57.47 C ANISOU 4149 CA MET B 142 9426 6782 5627 -9 -500 176 C ATOM 4150 C MET B 142 3.404 -66.374 51.991 1.00 64.01 C ANISOU 4150 C MET B 142 10000 7710 6609 -101 -434 277 C ATOM 4151 O MET B 142 4.196 -66.526 51.056 1.00 56.37 O ANISOU 4151 O MET B 142 8889 6711 5819 -188 -537 307 O ATOM 4152 CB MET B 142 3.847 -65.506 54.311 1.00 48.72 C ANISOU 4152 CB MET B 142 8557 5640 4315 -12 -568 171 C ATOM 4153 CG MET B 142 5.053 -66.424 54.392 1.00 65.48 C ANISOU 4153 CG MET B 142 10648 7712 6518 -147 -749 245 C ATOM 4154 SD MET B 142 5.848 -66.452 56.007 1.00 69.42 S ANISOU 4154 SD MET B 142 11471 8110 6796 -155 -938 222 S ATOM 4155 CE MET B 142 4.438 -66.764 57.063 1.00148.12 C ANISOU 4155 CE MET B 142 21596 18211 16472 -39 -678 224 C ATOM 4156 N PHE B 143 2.458 -67.262 52.282 1.00 61.92 N ANISOU 4156 N PHE B 143 9684 7565 6279 -82 -260 327 N ATOM 4157 CA PHE B 143 2.325 -68.508 51.529 1.00 63.44 C ANISOU 4157 CA PHE B 143 9654 7837 6612 -168 -208 414 C ATOM 4158 C PHE B 143 1.821 -68.312 50.102 1.00 58.31 C ANISOU 4158 C PHE B 143 8779 7243 6132 -160 -142 411 C ATOM 4159 O PHE B 143 2.339 -68.922 49.169 1.00 58.94 O ANISOU 4159 O PHE B 143 8702 7328 6366 -242 -202 445 O ATOM 4160 CB PHE B 143 1.406 -69.474 52.269 1.00 65.67 C ANISOU 4160 CB PHE B 143 9945 8219 6789 -159 -45 481 C ATOM 4161 CG PHE B 143 2.051 -70.118 53.448 1.00 69.24 C ANISOU 4161 CG PHE B 143 10577 8626 7106 -208 -131 527 C ATOM 4162 CD1 PHE B 143 2.127 -69.458 54.658 1.00 78.48 C ANISOU 4162 CD1 PHE B 143 12012 9756 8052 -139 -151 478 C ATOM 4163 CD2 PHE B 143 2.599 -71.381 53.346 1.00 74.70 C ANISOU 4163 CD2 PHE B 143 11186 9307 7891 -317 -206 614 C ATOM 4164 CE1 PHE B 143 2.727 -70.054 55.752 1.00 80.88 C ANISOU 4164 CE1 PHE B 143 12500 10018 8213 -184 -249 527 C ATOM 4165 CE2 PHE B 143 3.200 -71.978 54.435 1.00 70.61 C ANISOU 4165 CE2 PHE B 143 10839 8738 7251 -360 -304 668 C ATOM 4166 CZ PHE B 143 3.263 -71.314 55.639 1.00 64.05 C ANISOU 4166 CZ PHE B 143 10278 7875 6184 -297 -329 629 C ATOM 4167 N THR B 144 0.800 -67.479 49.937 1.00 66.23 N ANISOU 4167 N THR B 144 9772 8288 7103 -54 -21 367 N ATOM 4168 CA THR B 144 0.247 -67.217 48.614 1.00 57.88 C ANISOU 4168 CA THR B 144 8520 7280 6191 -38 27 366 C ATOM 4169 C THR B 144 1.328 -66.712 47.667 1.00 49.43 C ANISOU 4169 C THR B 144 7411 6130 5241 -98 -131 356 C ATOM 4170 O THR B 144 1.518 -67.262 46.587 1.00 53.71 O ANISOU 4170 O THR B 144 7784 6712 5910 -162 -147 392 O ATOM 4171 CB THR B 144 -0.922 -66.208 48.680 1.00 57.41 C ANISOU 4171 CB THR B 144 8478 7252 6082 103 151 314 C ATOM 4172 OG1 THR B 144 -2.148 -66.904 48.931 1.00 53.89 O ANISOU 4172 OG1 THR B 144 7930 6929 5618 139 336 353 O ATOM 4173 CG2 THR B 144 -1.067 -65.458 47.378 1.00 73.19 C ANISOU 4173 CG2 THR B 144 10355 9239 8216 125 113 299 C ATOM 4174 N SER B 145 2.054 -65.684 48.083 1.00 46.89 N ANISOU 4174 N SER B 145 7250 5692 4875 -80 -248 308 N ATOM 4175 CA SER B 145 2.998 -65.031 47.191 1.00 52.94 C ANISOU 4175 CA SER B 145 7974 6380 5762 -136 -382 311 C ATOM 4176 C SER B 145 4.097 -65.994 46.744 1.00 55.17 C ANISOU 4176 C SER B 145 8148 6664 6150 -261 -469 365 C ATOM 4177 O SER B 145 4.364 -66.123 45.542 1.00 51.11 O ANISOU 4177 O SER B 145 7478 6184 5758 -307 -473 395 O ATOM 4178 CB SER B 145 3.604 -63.790 47.856 1.00 51.79 C ANISOU 4178 CB SER B 145 8028 6088 5561 -106 -511 253 C ATOM 4179 OG SER B 145 4.218 -64.126 49.082 1.00 80.52 O ANISOU 4179 OG SER B 145 11829 9670 9095 -132 -595 236 O ATOM 4180 N ILE B 146 4.732 -66.665 47.703 1.00 40.53 N ANISOU 4180 N ILE B 146 6382 4773 4245 -307 -540 375 N ATOM 4181 CA ILE B 146 5.818 -67.593 47.386 1.00 51.37 C ANISOU 4181 CA ILE B 146 7653 6133 5731 -411 -634 420 C ATOM 4182 C ILE B 146 5.363 -68.756 46.493 1.00 57.79 C ANISOU 4182 C ILE B 146 8271 7057 6631 -438 -532 456 C ATOM 4183 O ILE B 146 6.095 -69.174 45.591 1.00 56.60 O ANISOU 4183 O ILE B 146 7982 6914 6609 -497 -574 475 O ATOM 4184 CB ILE B 146 6.457 -68.185 48.653 1.00 40.24 C ANISOU 4184 CB ILE B 146 6381 4663 4248 -445 -738 431 C ATOM 4185 CG1 ILE B 146 7.645 -69.070 48.283 1.00 42.52 C ANISOU 4185 CG1 ILE B 146 6548 4923 4684 -541 -850 474 C ATOM 4186 CG2 ILE B 146 5.449 -69.023 49.430 1.00 41.94 C ANISOU 4186 CG2 ILE B 146 6648 4953 4333 -407 -612 453 C ATOM 4187 CD1 ILE B 146 8.700 -68.382 47.480 1.00 39.54 C ANISOU 4187 CD1 ILE B 146 6084 4486 4453 -591 -953 472 C ATOM 4188 N PHE B 147 4.171 -69.288 46.751 1.00 40.94 N ANISOU 4188 N PHE B 147 6122 5005 4428 -393 -398 465 N ATOM 4189 CA PHE B 147 3.647 -70.389 45.951 1.00 45.53 C ANISOU 4189 CA PHE B 147 6526 5676 5095 -421 -318 494 C ATOM 4190 C PHE B 147 3.345 -69.938 44.527 1.00 52.03 C ANISOU 4190 C PHE B 147 7212 6553 6005 -405 -282 478 C ATOM 4191 O PHE B 147 3.410 -70.730 43.580 1.00 46.53 O ANISOU 4191 O PHE B 147 6372 5905 5403 -444 -273 485 O ATOM 4192 CB PHE B 147 2.372 -70.955 46.576 1.00 41.44 C ANISOU 4192 CB PHE B 147 6016 5230 4500 -385 -183 519 C ATOM 4193 CG PHE B 147 2.608 -71.765 47.812 1.00 58.63 C ANISOU 4193 CG PHE B 147 8303 7376 6597 -420 -204 563 C ATOM 4194 CD1 PHE B 147 1.544 -72.140 48.612 1.00 64.76 C ANISOU 4194 CD1 PHE B 147 9120 8212 7273 -390 -73 601 C ATOM 4195 CD2 PHE B 147 3.887 -72.149 48.183 1.00 59.15 C ANISOU 4195 CD2 PHE B 147 8429 7356 6690 -482 -355 576 C ATOM 4196 CE1 PHE B 147 1.744 -72.882 49.757 1.00 57.81 C ANISOU 4196 CE1 PHE B 147 8359 7307 6300 -426 -88 658 C ATOM 4197 CE2 PHE B 147 4.091 -72.888 49.331 1.00 57.84 C ANISOU 4197 CE2 PHE B 147 8379 7155 6440 -512 -392 626 C ATOM 4198 CZ PHE B 147 3.016 -73.256 50.117 1.00 51.23 C ANISOU 4198 CZ PHE B 147 7602 6379 5483 -486 -257 671 C ATOM 4199 N THR B 148 2.986 -68.669 44.384 1.00 49.84 N ANISOU 4199 N THR B 148 6991 6259 5687 -342 -266 452 N ATOM 4200 CA THR B 148 2.713 -68.122 43.072 1.00 44.03 C ANISOU 4200 CA THR B 148 6150 5564 5017 -325 -247 450 C ATOM 4201 C THR B 148 4.030 -68.088 42.306 1.00 48.87 C ANISOU 4201 C THR B 148 6712 6140 5715 -400 -341 464 C ATOM 4202 O THR B 148 4.150 -68.699 41.244 1.00 65.38 O ANISOU 4202 O THR B 148 8671 8295 7875 -432 -323 473 O ATOM 4203 CB THR B 148 2.089 -66.721 43.157 1.00 55.10 C ANISOU 4203 CB THR B 148 7636 6934 6366 -236 -227 427 C ATOM 4204 OG1 THR B 148 0.879 -66.783 43.914 1.00 60.13 O ANISOU 4204 OG1 THR B 148 8305 7615 6927 -154 -118 410 O ATOM 4205 CG2 THR B 148 1.760 -66.180 41.773 1.00 61.19 C ANISOU 4205 CG2 THR B 148 8305 7745 7199 -219 -218 441 C ATOM 4206 N LEU B 149 5.031 -67.410 42.859 1.00 45.49 N ANISOU 4206 N LEU B 149 6386 5611 5287 -428 -441 465 N ATOM 4207 CA LEU B 149 6.303 -67.264 42.158 1.00 48.73 C ANISOU 4207 CA LEU B 149 6730 5988 5798 -502 -520 491 C ATOM 4208 C LEU B 149 6.841 -68.616 41.721 1.00 52.96 C ANISOU 4208 C LEU B 149 7134 6577 6411 -554 -513 498 C ATOM 4209 O LEU B 149 7.407 -68.746 40.635 1.00 60.43 O ANISOU 4209 O LEU B 149 7964 7563 7433 -588 -502 512 O ATOM 4210 CB LEU B 149 7.337 -66.566 43.032 1.00 54.27 C ANISOU 4210 CB LEU B 149 7550 6560 6509 -539 -652 493 C ATOM 4211 CG LEU B 149 7.038 -65.087 43.258 1.00 65.58 C ANISOU 4211 CG LEU B 149 9112 7912 7895 -494 -687 479 C ATOM 4212 CD1 LEU B 149 8.076 -64.468 44.178 1.00 69.55 C ANISOU 4212 CD1 LEU B 149 9742 8272 8413 -538 -845 472 C ATOM 4213 CD2 LEU B 149 6.965 -64.336 41.935 1.00 38.49 C ANISOU 4213 CD2 LEU B 149 5595 4507 4524 -499 -655 518 C ATOM 4214 N THR B 150 6.661 -69.620 42.572 1.00 47.98 N ANISOU 4214 N THR B 150 6530 5945 5757 -557 -515 490 N ATOM 4215 CA THR B 150 7.103 -70.972 42.261 1.00 50.55 C ANISOU 4215 CA THR B 150 6742 6299 6164 -597 -520 490 C ATOM 4216 C THR B 150 6.395 -71.438 40.998 1.00 57.28 C ANISOU 4216 C THR B 150 7467 7254 7042 -578 -427 473 C ATOM 4217 O THR B 150 7.039 -71.811 40.017 1.00 61.25 O ANISOU 4217 O THR B 150 7862 7789 7621 -601 -426 461 O ATOM 4218 CB THR B 150 6.806 -71.950 43.426 1.00 49.20 C ANISOU 4218 CB THR B 150 6639 6103 5954 -601 -535 501 C ATOM 4219 OG1 THR B 150 7.576 -71.579 44.577 1.00 58.84 O ANISOU 4219 OG1 THR B 150 7992 7226 7140 -620 -646 514 O ATOM 4220 CG2 THR B 150 7.163 -73.371 43.051 1.00 43.55 C ANISOU 4220 CG2 THR B 150 5808 5400 5339 -636 -548 499 C ATOM 4221 N MET B 151 5.067 -71.411 41.024 1.00 40.52 N ANISOU 4221 N MET B 151 5356 5184 4854 -533 -350 467 N ATOM 4222 CA MET B 151 4.281 -71.823 39.868 1.00 49.63 C ANISOU 4222 CA MET B 151 6398 6429 6030 -515 -286 448 C ATOM 4223 C MET B 151 4.595 -70.963 38.654 1.00 57.67 C ANISOU 4223 C MET B 151 7378 7482 7052 -506 -282 448 C ATOM 4224 O MET B 151 4.632 -71.454 37.528 1.00 56.39 O ANISOU 4224 O MET B 151 7123 7384 6917 -512 -263 427 O ATOM 4225 CB MET B 151 2.794 -71.771 40.192 1.00 47.30 C ANISOU 4225 CB MET B 151 6111 6178 5683 -467 -214 453 C ATOM 4226 CG MET B 151 2.388 -72.871 41.159 1.00 66.27 C ANISOU 4226 CG MET B 151 8521 8568 8090 -491 -196 470 C ATOM 4227 SD MET B 151 3.049 -74.505 40.708 1.00 59.29 S ANISOU 4227 SD MET B 151 7539 7671 7317 -556 -249 453 S ATOM 4228 CE MET B 151 2.447 -74.642 39.026 1.00 69.70 C ANISOU 4228 CE MET B 151 8729 9078 8676 -537 -225 406 C ATOM 4229 N MET B 152 4.824 -69.679 38.901 1.00 58.55 N ANISOU 4229 N MET B 152 7573 7546 7129 -493 -305 474 N ATOM 4230 CA MET B 152 5.237 -68.745 37.870 1.00 46.38 C ANISOU 4230 CA MET B 152 6012 6018 5592 -499 -309 500 C ATOM 4231 C MET B 152 6.510 -69.230 37.202 1.00 51.27 C ANISOU 4231 C MET B 152 6548 6652 6282 -557 -323 505 C ATOM 4232 O MET B 152 6.619 -69.226 35.980 1.00 49.33 O ANISOU 4232 O MET B 152 6233 6478 6031 -558 -282 511 O ATOM 4233 CB MET B 152 5.492 -67.392 38.510 1.00 58.78 C ANISOU 4233 CB MET B 152 7699 7494 7142 -491 -359 528 C ATOM 4234 CG MET B 152 5.474 -66.232 37.555 1.00 61.54 C ANISOU 4234 CG MET B 152 8054 7844 7484 -483 -359 572 C ATOM 4235 SD MET B 152 5.353 -64.691 38.481 1.00 67.63 S ANISOU 4235 SD MET B 152 8985 8480 8230 -448 -427 583 S ATOM 4236 CE MET B 152 5.308 -63.488 37.160 1.00195.56 C ANISOU 4236 CE MET B 152 25178 24684 24443 -449 -432 655 C ATOM 4237 N SER B 153 7.477 -69.641 38.017 1.00 56.38 N ANISOU 4237 N SER B 153 7201 7231 6990 -598 -380 504 N ATOM 4238 CA SER B 153 8.724 -70.205 37.511 1.00 51.20 C ANISOU 4238 CA SER B 153 6444 6585 6427 -643 -391 504 C ATOM 4239 C SER B 153 8.475 -71.531 36.812 1.00 47.87 C ANISOU 4239 C SER B 153 5926 6240 6021 -623 -339 449 C ATOM 4240 O SER B 153 8.986 -71.778 35.723 1.00 57.94 O ANISOU 4240 O SER B 153 7113 7581 7320 -624 -292 434 O ATOM 4241 CB SER B 153 9.719 -70.438 38.648 1.00 51.70 C ANISOU 4241 CB SER B 153 6531 6547 6566 -683 -488 514 C ATOM 4242 OG SER B 153 10.002 -69.244 39.350 1.00 58.22 O ANISOU 4242 OG SER B 153 7459 7283 7379 -705 -560 552 O ATOM 4243 N VAL B 154 7.702 -72.398 37.449 1.00 43.99 N ANISOU 4243 N VAL B 154 5459 5738 5519 -605 -349 418 N ATOM 4244 CA VAL B 154 7.385 -73.675 36.842 1.00 51.07 C ANISOU 4244 CA VAL B 154 6275 6684 6444 -590 -323 361 C ATOM 4245 C VAL B 154 6.738 -73.447 35.481 1.00 51.81 C ANISOU 4245 C VAL B 154 6331 6879 6477 -560 -261 337 C ATOM 4246 O VAL B 154 7.107 -74.084 34.493 1.00 63.00 O ANISOU 4246 O VAL B 154 7676 8349 7910 -549 -235 287 O ATOM 4247 CB VAL B 154 6.449 -74.500 37.726 1.00 48.99 C ANISOU 4247 CB VAL B 154 6046 6390 6177 -588 -339 354 C ATOM 4248 CG1 VAL B 154 5.962 -75.732 36.976 1.00 47.90 C ANISOU 4248 CG1 VAL B 154 5829 6293 6079 -578 -326 295 C ATOM 4249 CG2 VAL B 154 7.160 -74.890 39.014 1.00 42.51 C ANISOU 4249 CG2 VAL B 154 5275 5472 5403 -618 -411 382 C ATOM 4250 N ASP B 155 5.777 -72.529 35.443 1.00 44.18 N ANISOU 4250 N ASP B 155 5419 5935 5433 -537 -243 369 N ATOM 4251 CA ASP B 155 5.055 -72.206 34.218 1.00 50.00 C ANISOU 4251 CA ASP B 155 6135 6759 6103 -505 -209 359 C ATOM 4252 C ASP B 155 6.026 -71.852 33.086 1.00 57.63 C ANISOU 4252 C ASP B 155 7070 7779 7050 -515 -175 368 C ATOM 4253 O ASP B 155 5.831 -72.252 31.932 1.00 46.67 O ANISOU 4253 O ASP B 155 5646 6473 5613 -493 -148 327 O ATOM 4254 CB ASP B 155 4.090 -71.050 34.481 1.00 60.28 C ANISOU 4254 CB ASP B 155 7502 8054 7347 -474 -208 406 C ATOM 4255 CG ASP B 155 3.514 -70.471 33.211 1.00 64.73 C ANISOU 4255 CG ASP B 155 8057 8694 7842 -442 -195 418 C ATOM 4256 OD1 ASP B 155 4.015 -69.418 32.746 1.00 69.97 O ANISOU 4256 OD1 ASP B 155 8758 9357 8471 -448 -190 474 O ATOM 4257 OD2 ASP B 155 2.552 -71.073 32.683 1.00 58.49 O1+ ANISOU 4257 OD2 ASP B 155 7225 7961 7038 -417 -202 379 O1+ ATOM 4258 N ARG B 156 7.079 -71.116 33.435 1.00 42.91 N ANISOU 4258 N ARG B 156 5218 5866 5220 -551 -179 423 N ATOM 4259 CA ARG B 156 8.101 -70.721 32.473 1.00 38.53 C ANISOU 4259 CA ARG B 156 4617 5360 4661 -573 -130 455 C ATOM 4260 C ARG B 156 8.969 -71.894 32.094 1.00 45.70 C ANISOU 4260 C ARG B 156 5431 6302 5631 -571 -96 389 C ATOM 4261 O ARG B 156 9.447 -71.984 30.966 1.00 44.92 O ANISOU 4261 O ARG B 156 5283 6290 5494 -560 -23 378 O ATOM 4262 CB ARG B 156 8.989 -69.627 33.055 1.00 43.93 C ANISOU 4262 CB ARG B 156 5326 5965 5401 -625 -158 540 C ATOM 4263 CG ARG B 156 8.254 -68.345 33.413 1.00 63.34 C ANISOU 4263 CG ARG B 156 7889 8369 7807 -619 -197 599 C ATOM 4264 CD ARG B 156 7.356 -67.877 32.299 1.00 55.62 C ANISOU 4264 CD ARG B 156 6935 7472 6724 -580 -159 620 C ATOM 4265 NE ARG B 156 8.069 -67.814 31.028 1.00 55.88 N ANISOU 4265 NE ARG B 156 6915 7593 6722 -603 -90 655 N ATOM 4266 CZ ARG B 156 7.526 -67.387 29.898 1.00 53.15 C ANISOU 4266 CZ ARG B 156 6598 7328 6269 -580 -59 689 C ATOM 4267 NH1 ARG B 156 6.265 -66.984 29.885 1.00 59.74 N1+ ANISOU 4267 NH1 ARG B 156 7497 8156 7046 -531 -106 689 N1+ ATOM 4268 NH2 ARG B 156 8.240 -67.358 28.783 1.00 74.01 N ANISOU 4268 NH2 ARG B 156 9203 10059 8860 -601 20 727 N ATOM 4269 N TYR B 157 9.191 -72.783 33.053 1.00 57.74 N ANISOU 4269 N TYR B 157 6936 7755 7249 -576 -148 348 N ATOM 4270 CA TYR B 157 9.985 -73.972 32.798 1.00 52.48 C ANISOU 4270 CA TYR B 157 6178 7097 6663 -560 -133 277 C ATOM 4271 C TYR B 157 9.304 -74.806 31.734 1.00 45.79 C ANISOU 4271 C TYR B 157 5317 6332 5747 -509 -95 186 C ATOM 4272 O TYR B 157 9.964 -75.396 30.877 1.00 40.18 O ANISOU 4272 O TYR B 157 4542 5678 5045 -478 -38 124 O ATOM 4273 CB TYR B 157 10.165 -74.796 34.069 1.00 45.03 C ANISOU 4273 CB TYR B 157 5235 6047 5826 -573 -219 259 C ATOM 4274 CG TYR B 157 10.478 -76.255 33.799 1.00 46.75 C ANISOU 4274 CG TYR B 157 5382 6259 6123 -538 -225 166 C ATOM 4275 CD1 TYR B 157 11.760 -76.665 33.438 1.00 41.81 C ANISOU 4275 CD1 TYR B 157 4653 5638 5597 -522 -198 136 C ATOM 4276 CD2 TYR B 157 9.483 -77.222 33.892 1.00 39.88 C ANISOU 4276 CD2 TYR B 157 4539 5371 5243 -520 -259 108 C ATOM 4277 CE1 TYR B 157 12.037 -78.004 33.187 1.00 49.52 C ANISOU 4277 CE1 TYR B 157 5567 6593 6653 -474 -208 37 C ATOM 4278 CE2 TYR B 157 9.751 -78.555 33.643 1.00 50.17 C ANISOU 4278 CE2 TYR B 157 5787 6645 6629 -487 -282 18 C ATOM 4279 CZ TYR B 157 11.025 -78.948 33.295 1.00 58.27 C ANISOU 4279 CZ TYR B 157 6724 7669 7747 -457 -258 -24 C ATOM 4280 OH TYR B 157 11.269 -80.289 33.047 1.00 55.88 O ANISOU 4280 OH TYR B 157 6372 7323 7535 -409 -286 -126 O ATOM 4281 N ILE B 158 7.978 -74.849 31.786 1.00 43.15 N ANISOU 4281 N ILE B 158 5043 6005 5348 -498 -128 175 N ATOM 4282 CA ILE B 158 7.215 -75.597 30.794 1.00 51.64 C ANISOU 4282 CA ILE B 158 6114 7146 6361 -457 -124 89 C ATOM 4283 C ILE B 158 7.345 -74.922 29.430 1.00 46.38 C ANISOU 4283 C ILE B 158 5461 6593 5567 -433 -54 96 C ATOM 4284 O ILE B 158 7.572 -75.588 28.422 1.00 38.25 O ANISOU 4284 O ILE B 158 4413 5630 4489 -394 -19 11 O ATOM 4285 CB ILE B 158 5.730 -75.734 31.197 1.00 50.25 C ANISOU 4285 CB ILE B 158 5976 6949 6169 -459 -184 90 C ATOM 4286 CG1 ILE B 158 5.618 -76.620 32.446 1.00 51.62 C ANISOU 4286 CG1 ILE B 158 6136 7021 6456 -485 -237 84 C ATOM 4287 CG2 ILE B 158 4.898 -76.287 30.033 1.00 34.52 C ANISOU 4287 CG2 ILE B 158 3982 5028 4108 -425 -202 10 C ATOM 4288 CD1 ILE B 158 4.227 -76.707 33.036 1.00 64.32 C ANISOU 4288 CD1 ILE B 158 7765 8610 8066 -497 -272 110 C ATOM 4289 N ALA B 159 7.241 -73.595 29.419 1.00 43.79 N ANISOU 4289 N ALA B 159 5177 6280 5179 -456 -37 200 N ATOM 4290 CA ALA B 159 7.297 -72.823 28.182 1.00 34.68 C ANISOU 4290 CA ALA B 159 4055 5228 3895 -443 23 240 C ATOM 4291 C ALA B 159 8.579 -73.086 27.419 1.00 34.74 C ANISOU 4291 C ALA B 159 4006 5303 3893 -437 124 220 C ATOM 4292 O ALA B 159 8.605 -73.019 26.193 1.00 42.11 O ANISOU 4292 O ALA B 159 4963 6344 4693 -407 187 205 O ATOM 4293 CB ALA B 159 7.167 -71.331 28.479 1.00 37.32 C ANISOU 4293 CB ALA B 159 4443 5532 4206 -477 14 369 C ATOM 4294 N VAL B 160 9.640 -73.397 28.150 1.00 44.65 N ANISOU 4294 N VAL B 160 5183 6497 5285 -460 139 221 N ATOM 4295 CA VAL B 160 10.953 -73.559 27.551 1.00 49.49 C ANISOU 4295 CA VAL B 160 5709 7169 5924 -454 248 216 C ATOM 4296 C VAL B 160 11.309 -75.020 27.272 1.00 58.22 C ANISOU 4296 C VAL B 160 6755 8289 7077 -389 268 69 C ATOM 4297 O VAL B 160 11.849 -75.341 26.212 1.00 69.86 O ANISOU 4297 O VAL B 160 8197 9865 8481 -340 375 14 O ATOM 4298 CB VAL B 160 12.040 -72.964 28.463 1.00 58.58 C ANISOU 4298 CB VAL B 160 6789 8242 7226 -518 243 310 C ATOM 4299 CG1 VAL B 160 13.423 -73.312 27.932 1.00 49.24 C ANISOU 4299 CG1 VAL B 160 5477 7118 6114 -506 357 297 C ATOM 4300 CG2 VAL B 160 11.866 -71.447 28.610 1.00 33.57 C ANISOU 4300 CG2 VAL B 160 3684 5052 4019 -581 227 452 C ATOM 4301 N CYS B 161 11.032 -75.899 28.228 1.00 55.44 N ANISOU 4301 N CYS B 161 6391 7830 6843 -384 168 8 N ATOM 4302 CA CYS B 161 11.443 -77.296 28.105 1.00 63.50 C ANISOU 4302 CA CYS B 161 7354 8829 7946 -324 164 -126 C ATOM 4303 C CYS B 161 10.315 -78.211 27.634 1.00 55.92 C ANISOU 4303 C CYS B 161 6461 7870 6914 -280 101 -243 C ATOM 4304 O CYS B 161 10.541 -79.392 27.367 1.00 64.19 O ANISOU 4304 O CYS B 161 7481 8894 8016 -223 89 -371 O ATOM 4305 CB CYS B 161 12.013 -77.805 29.439 1.00 70.68 C ANISOU 4305 CB CYS B 161 8203 9603 9050 -350 81 -112 C ATOM 4306 SG CYS B 161 13.394 -76.818 30.096 1.00 64.63 S ANISOU 4306 SG CYS B 161 7346 8808 8403 -410 110 17 S ATOM 4307 N HIS B 162 9.105 -77.672 27.531 1.00 46.79 N ATOM 4308 CA HIS B 162 7.968 -78.460 27.084 1.00 33.71 C ATOM 4309 C HIS B 162 7.059 -77.634 26.182 1.00 59.86 C ATOM 4310 O HIS B 162 5.872 -77.465 26.471 1.00 41.66 O ATOM 4311 CB HIS B 162 7.192 -78.965 28.294 1.00 60.62 C ATOM 4312 CG HIS B 162 8.002 -79.831 29.208 1.00 71.26 C ATOM 4313 ND1 HIS B 162 8.108 -81.197 29.049 1.00 75.05 N ATOM 4314 CD2 HIS B 162 8.755 -79.518 30.296 1.00 73.56 C ATOM 4315 CE1 HIS B 162 8.884 -81.689 29.999 1.00 73.21 C ATOM 4316 NE2 HIS B 162 9.290 -80.695 30.762 1.00 70.26 N