>>4DSL:HELIX    8   8 ASP A  439  ASN A  468  1                                  30    
DEPVLAEHLVRKAAAIWELERPFLDELRRN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 8 8 ASP A 439 ASN A 468 1 30 ATOM 1085 N ASP A 439 -24.818 -29.981 51.640 1.00 46.85 N ANISOU 1085 N ASP A 439 5892 5843 6065 101 338 126 N ATOM 1086 CA ASP A 439 -24.713 -29.785 53.085 1.00 46.80 C ANISOU 1086 CA ASP A 439 5896 5846 6039 119 349 133 C ATOM 1087 C ASP A 439 -23.225 -29.596 53.422 1.00 46.33 C ANISOU 1087 C ASP A 439 5848 5793 5962 143 334 125 C ATOM 1088 O ASP A 439 -22.346 -29.833 52.576 1.00 45.18 O ANISOU 1088 O ASP A 439 5704 5644 5820 146 319 117 O ATOM 1089 CB ASP A 439 -25.326 -30.962 53.882 1.00 47.48 C ANISOU 1089 CB ASP A 439 6001 5919 6121 114 367 154 C ATOM 1090 CG ASP A 439 -26.686 -31.492 53.301 1.00 49.14 C ANISOU 1090 CG ASP A 439 6202 6119 6352 85 379 165 C ATOM 1091 OD1 ASP A 439 -27.545 -30.706 52.816 1.00 49.76 O ANISOU 1091 OD1 ASP A 439 6254 6206 6445 72 380 161 O ATOM 1092 OD2 ASP A 439 -26.904 -32.730 53.369 1.00 50.77 O1- ANISOU 1092 OD2 ASP A 439 6426 6306 6559 76 386 178 O1- ATOM 1093 N GLU A 440 -22.943 -29.188 54.656 1.00 40.59 N ATOM 1094 CA GLU A 440 -21.606 -28.719 54.987 1.00 45.94 C ANISOU 1094 CA GLU A 440 5811 5766 5876 180 320 117 C ATOM 1095 C GLU A 440 -20.493 -29.748 54.837 1.00 45.64 C ANISOU 1095 C GLU A 440 5790 5721 5831 192 311 121 C ATOM 1096 O GLU A 440 -19.389 -29.372 54.486 1.00 45.27 O ANISOU 1096 O GLU A 440 5737 5683 5781 202 293 111 O ATOM 1097 CB GLU A 440 -21.580 -28.101 56.376 1.00 46.70 C ANISOU 1097 CB GLU A 440 5917 5876 5951 194 326 119 C ATOM 1098 CG GLU A 440 -20.208 -27.575 56.802 1.00 47.86 C ANISOU 1098 CG GLU A 440 6068 6036 6079 213 305 109 C ATOM 1099 CD GLU A 440 -20.272 -26.820 58.110 1.00 50.92 C ANISOU 1099 CD GLU A 440 6466 6436 6444 224 309 108 C ATOM 1100 OE1 GLU A 440 -19.794 -27.368 59.123 1.00 52.31 O ANISOU 1100 OE1 GLU A 440 6663 6614 6600 240 309 117 O ATOM 1101 OE2 GLU A 440 -20.818 -25.687 58.132 1.00 53.55 O1- ANISOU 1101 OE2 GLU A 440 6790 6777 6781 219 311 98 O1- ATOM 1102 N PRO A 441 -20.769 -31.047 55.104 1.00 40.05 N ATOM 1103 CA PRO A 441 -19.636 -31.989 54.996 1.00 45.33 C ANISOU 1103 CA PRO A 441 5787 5657 5780 209 314 141 C ATOM 1104 C PRO A 441 -19.020 -32.048 53.578 1.00 44.47 C ANISOU 1104 C PRO A 441 5667 5543 5686 205 301 130 C ATOM 1105 O PRO A 441 -17.789 -31.915 53.436 1.00 44.05 O ANISOU 1105 O PRO A 441 5612 5500 5625 223 286 125 O ATOM 1106 CB PRO A 441 -20.246 -33.349 55.407 1.00 45.50 C ANISOU 1106 CB PRO A 441 5832 5657 5799 205 332 159 C ATOM 1107 CG PRO A 441 -21.553 -33.029 56.086 1.00 45.54 C ANISOU 1107 CG PRO A 441 5833 5664 5806 191 350 166 C ATOM 1108 CD PRO A 441 -22.024 -31.736 55.490 1.00 45.92 C ANISOU 1108 CD PRO A 441 5853 5726 5868 178 345 152 C ATOM 1109 N VAL A 442 -19.865 -32.245 52.553 1.00 43.42 N ANISOU 1109 N VAL A 442 5528 5397 5573 183 305 128 N ATOM 1110 CA VAL A 442 -19.393 -32.255 51.161 1.00 42.23 C ANISOU 1110 CA VAL A 442 5369 5241 5435 178 293 118 C ATOM 1111 C VAL A 442 -18.697 -30.935 50.881 1.00 41.41 C ANISOU 1111 C VAL A 442 5242 5160 5332 184 278 103 C ATOM 1112 O VAL A 442 -17.473 -30.908 50.673 1.00 42.26 O ANISOU 1112 O VAL A 442 5349 5275 5433 201 265 99 O ATOM 1113 CB VAL A 442 -20.504 -32.481 50.105 1.00 41.92 C ANISOU 1113 CB VAL A 442 5324 5186 5416 151 298 116 C ATOM 1114 CG1 VAL A 442 -19.926 -32.344 48.718 1.00 41.65 C ANISOU 1114 CG1 VAL A 442 5283 5150 5393 149 285 104 C ATOM 1115 CG2 VAL A 442 -21.103 -33.855 50.237 1.00 42.15 C ANISOU 1115 CG2 VAL A 442 5378 5191 5446 142 311 130 C ATOM 1116 N LEU A 443 -19.473 -29.848 50.941 1.00 39.72 N ANISOU 1116 N LEU A 443 5009 4956 5125 171 279 96 N ATOM 1117 CA LEU A 443 -18.996 -28.495 50.656 1.00 37.71 C ANISOU 1117 CA LEU A 443 4735 4721 4874 172 266 81 C ATOM 1118 C LEU A 443 -17.587 -28.213 51.175 1.00 37.13 C ANISOU 1118 C LEU A 443 4662 4662 4784 194 252 79 C ATOM 1119 O LEU A 443 -16.692 -27.786 50.424 1.00 36.50 O ANISOU 1119 O LEU A 443 4570 4591 4708 198 238 70 O ATOM 1120 CB LEU A 443 -19.963 -27.500 51.248 1.00 37.05 C ANISOU 1120 CB LEU A 443 4640 4646 4790 164 273 79 C ATOM 1121 CG LEU A 443 -19.633 -26.041 51.014 1.00 35.64 C ANISOU 1121 CG LEU A 443 4444 4484 4615 163 261 64 C ATOM 1122 CD1 LEU A 443 -19.697 -25.704 49.554 1.00 34.26 C ANISOU 1122 CD1 LEU A 443 4253 4306 4459 150 253 55 C ATOM 1123 CD2 LEU A 443 -20.621 -25.230 51.804 1.00 36.23 C ANISOU 1123 CD2 LEU A 443 4515 4564 4685 159 272 64 C ATOM 1124 N ALA A 444 -17.420 -28.487 52.462 1.00 36.48 N ANISOU 1124 N ALA A 444 4595 4584 4683 207 256 87 N ATOM 1125 CA ALA A 444 -16.189 -28.252 53.188 1.00 35.98 C ANISOU 1125 CA ALA A 444 4533 4536 4601 227 242 87 C ATOM 1126 C ALA A 444 -15.071 -29.089 52.630 1.00 35.82 C ANISOU 1126 C ALA A 444 4516 4513 4579 241 234 91 C ATOM 1127 O ALA A 444 -13.936 -28.601 52.499 1.00 35.41 O ANISOU 1127 O ALA A 444 4453 4478 4524 251 218 87 O ATOM 1128 CB ALA A 444 -16.392 -28.544 54.656 1.00 35.48 C ANISOU 1128 CB ALA A 444 4489 4475 4518 237 251 97 C ATOM 1129 N GLU A 445 -15.379 -30.348 52.304 1.00 35.78 N ANISOU 1129 N GLU A 445 4528 4488 4578 242 246 101 N ATOM 1130 CA GLU A 445 -14.349 -31.188 51.728 1.00 35.94 C ANISOU 1130 CA GLU A 445 4554 4503 4596 259 240 106 C ATOM 1131 C GLU A 445 -14.037 -30.658 50.339 1.00 35.00 C ANISOU 1131 C GLU A 445 4417 4388 4495 251 232 94 C ATOM 1132 O GLU A 445 -12.872 -30.621 49.916 1.00 35.23 O ANISOU 1132 O GLU A 445 4437 4428 4522 266 221 93 O ATOM 1133 CB GLU A 445 -14.696 -32.684 51.683 1.00 36.20 C ANISOU 1133 CB GLU A 445 4615 4512 4629 263 255 119 C ATOM 1134 CG GLU A 445 -13.622 -33.467 50.839 1.00 38.34 C ANISOU 1134 CG GLU A 445 4892 4777 4900 281 250 122 C ATOM 1135 CD GLU A 445 -13.551 -34.969 51.052 1.00 40.75 C ANISOU 1135 CD GLU A 445 5229 5059 5196 295 261 136 C ATOM 1136 OE1 GLU A 445 -14.299 -35.515 51.882 1.00 42.42 O ANISOU 1136 OE1 GLU A 445 5459 5258 5401 290 273 146 O ATOM 1137 OE2 GLU A 445 -12.709 -35.618 50.386 1.00 42.99 O1- ANISOU 1137 OE2 GLU A 445 5519 5336 5477 313 259 139 O1- ATOM 1138 N HIS A 446 -15.068 -30.210 49.639 1.00 28.76 N ATOM 1139 CA HIS A 446 -14.856 -29.780 48.261 1.00 32.81 C ANISOU 1139 CA HIS A 446 4115 4104 4249 219 229 75 C ATOM 1140 C HIS A 446 -13.877 -28.622 48.126 1.00 31.16 C ANISOU 1140 C HIS A 446 3883 3919 4039 225 214 66 C ATOM 1141 O HIS A 446 -13.058 -28.626 47.213 1.00 32.17 O ANISOU 1141 O HIS A 446 4002 4050 4171 232 207 64 O ATOM 1142 CB HIS A 446 -16.164 -29.495 47.538 1.00 32.93 C ANISOU 1142 CB HIS A 446 4125 4107 4280 193 236 69 C ATOM 1143 CG HIS A 446 -15.976 -29.083 46.115 1.00 36.17 C ANISOU 1143 CG HIS A 446 4522 4517 4705 186 229 59 C ATOM 1144 ND1 HIS A 446 -15.100 -29.724 45.261 1.00 40.10 N ANISOU 1144 ND1 HIS A 446 5025 5009 5201 198 225 59 N ATOM 1145 CD2 HIS A 446 -16.539 -28.083 45.395 1.00 38.17 C ANISOU 1145 CD2 HIS A 446 4757 4776 4971 168 225 48 C ATOM 1146 CE1 HIS A 446 -15.132 -29.132 44.080 1.00 40.17 C ANISOU 1146 CE1 HIS A 446 5020 5019 5222 188 220 49 C ATOM 1147 NE2 HIS A 446 -16.003 -28.137 44.134 1.00 38.59 N ANISOU 1147 NE2 HIS A 446 4805 4826 5031 169 219 42 N ATOM 1148 N LEU A 447 -13.941 -27.664 49.046 1.00 28.65 N ANISOU 1148 N LEU A 447 3557 3616 3713 223 208 63 N ATOM 1149 CA LEU A 447 -13.069 -26.522 49.005 1.00 27.03 C ANISOU 1149 CA LEU A 447 3332 3432 3507 224 192 55 C ATOM 1150 C LEU A 447 -11.626 -26.777 49.472 1.00 26.74 C ANISOU 1150 C LEU A 447 3292 3411 3456 246 180 61 C ATOM 1151 O LEU A 447 -10.712 -26.043 49.118 1.00 27.21 O ANISOU 1151 O LEU A 447 3333 3488 3518 247 166 57 O ATOM 1152 CB LEU A 447 -13.638 -25.430 49.888 1.00 26.65 C ANISOU 1152 CB LEU A 447 3280 3392 3453 215 190 48 C ATOM 1153 CG LEU A 447 -15.109 -25.013 49.815 1.00 26.26 C ANISOU 1153 CG LEU A 447 3231 3332 3413 197 203 43 C ATOM 1154 CD1 LEU A 447 -15.211 -23.660 50.459 1.00 22.49 C ANISOU 1154 CD1 LEU A 447 2747 2868 2930 192 196 34 C ATOM 1155 CD2 LEU A 447 -15.707 -24.982 48.399 1.00 25.14 C ANISOU 1155 CD2 LEU A 447 3080 3181 3293 181 207 38 C ATOM 1156 N VAL A 448 -11.431 -27.737 50.352 1.00 25.82 N ANISOU 1156 N VAL A 448 3195 3291 3326 262 185 74 N ATOM 1157 CA VAL A 448 -10.124 -27.947 50.911 1.00 25.44 C ANISOU 1157 CA VAL A 448 3143 3260 3263 283 172 82 C ATOM 1158 C VAL A 448 -9.270 -28.583 49.803 1.00 25.71 C ANISOU 1158 C VAL A 448 3171 3293 3305 296 172 86 C ATOM 1159 O VAL A 448 -8.110 -28.230 49.599 1.00 24.44 O ANISOU 1159 O VAL A 448 2991 3153 3143 306 158 87 O ATOM 1160 CB VAL A 448 -10.241 -28.739 52.233 1.00 25.75 C ANISOU 1160 CB VAL A 448 3205 3296 3283 298 178 94 C ATOM 1161 CG1 VAL A 448 -8.978 -29.528 52.576 1.00 23.22 C ANISOU 1161 CG1 VAL A 448 2888 2986 2949 325 170 107 C ATOM 1162 CG2 VAL A 448 -10.616 -27.781 53.344 1.00 24.37 C ANISOU 1162 CG2 VAL A 448 3030 3131 3097 289 172 88 C ATOM 1163 N ARG A 449 -9.925 -29.443 49.031 1.00 26.22 N ANISOU 1163 N ARG A 449 3250 3335 3379 294 187 87 N ATOM 1164 CA ARG A 449 -9.378 -29.988 47.783 1.00 26.65 C ANISOU 1164 CA ARG A 449 3303 3382 3442 303 189 89 C ATOM 1165 C ARG A 449 -9.046 -28.939 46.706 1.00 26.50 C ANISOU 1165 C ARG A 449 3258 3376 3437 291 181 77 C ATOM 1166 O ARG A 449 -7.966 -28.997 46.121 1.00 27.00 O ANISOU 1166 O ARG A 449 3309 3451 3500 306 175 81 O ATOM 1167 CB ARG A 449 -10.307 -31.095 47.257 1.00 26.74 C ANISOU 1167 CB ARG A 449 3340 3362 3458 298 206 91 C ATOM 1168 CG ARG A 449 -10.286 -32.349 48.179 1.00 27.15 C ANISOU 1168 CG ARG A 449 3420 3401 3495 316 215 106 C ATOM 1169 CD ARG A 449 -11.160 -33.472 47.657 1.00 29.68 C ANISOU 1169 CD ARG A 449 3768 3689 3820 309 231 109 C ATOM 1170 NE ARG A 449 -10.884 -34.757 48.314 1.00 33.14 N ANISOU 1170 NE ARG A 449 4234 4113 4243 330 239 124 N ATOM 1171 CZ ARG A 449 -9.915 -35.612 47.971 1.00 33.36 C ANISOU 1171 CZ ARG A 449 4274 4137 4264 358 241 132 C ATOM 1172 NH1 ARG A 449 -9.060 -35.363 46.970 1.00 33.37 N ANISOU 1172 NH1 ARG A 449 4261 4149 4271 369 236 128 N ATOM 1173 NH2 ARG A 449 -9.791 -36.732 48.642 1.00 33.96 N ANISOU 1173 NH2 ARG A 449 4378 4199 4327 376 250 146 N ATOM 1174 N LYS A 450 -9.925 -27.964 46.447 1.00 26.11 N ANISOU 1174 N LYS A 450 3198 3324 3397 266 179 65 N ATOM 1175 CA LYS A 450 -9.480 -26.828 45.616 1.00 25.39 C ANISOU 1175 CA LYS A 450 3082 3248 3317 256 169 55 C ATOM 1176 C LYS A 450 -8.225 -26.051 46.149 1.00 25.73 C ANISOU 1176 C LYS A 450 3103 3319 3352 265 152 57 C ATOM 1177 O LYS A 450 -7.263 -25.793 45.387 1.00 25.36 O ANISOU 1177 O LYS A 450 3039 3287 3311 271 146 59 O ATOM 1178 CB LYS A 450 -10.626 -25.904 45.275 1.00 24.49 C ANISOU 1178 CB LYS A 450 2963 3127 3214 231 171 43 C ATOM 1179 CG LYS A 450 -11.732 -26.643 44.541 1.00 26.50 C ANISOU 1179 CG LYS A 450 3234 3358 3479 221 185 41 C ATOM 1180 CD LYS A 450 -12.802 -25.773 43.853 1.00 26.03 C ANISOU 1180 CD LYS A 450 3165 3292 3433 197 186 30 C ATOM 1181 CE LYS A 450 -13.434 -24.743 44.774 1.00 25.90 C ANISOU 1181 CE LYS A 450 3143 3284 3415 185 183 25 C ATOM 1182 NZ LYS A 450 -13.883 -23.568 43.941 1.00 29.80 N ANISOU 1182 NZ LYS A 450 3620 3781 3922 168 179 14 N ATOM 1183 N ALA A 451 -8.222 -25.688 47.433 1.00 25.28 N ANISOU 1183 N ALA A 451 3049 3272 3283 264 144 59 N ATOM 1184 CA ALA A 451 -7.093 -24.952 48.014 1.00 24.71 C ANISOU 1184 CA ALA A 451 2958 3227 3203 269 126 60 C ATOM 1185 C ALA A 451 -5.831 -25.784 47.975 1.00 25.25 C ANISOU 1185 C ALA A 451 3021 3309 3265 294 122 75 C ATOM 1186 O ALA A 451 -4.726 -25.300 47.678 1.00 25.44 O ANISOU 1186 O ALA A 451 3020 3354 3291 298 109 78 O ATOM 1187 CB ALA A 451 -7.397 -24.570 49.413 1.00 24.31 C ANISOU 1187 CB ALA A 451 2917 3181 3138 265 119 59 C ATOM 1188 N ALA A 452 -5.997 -27.066 48.266 1.00 25.87 N ANISOU 1188 N ALA A 452 3121 3373 3336 312 134 85 N ATOM 1189 CA ALA A 452 -4.867 -27.954 48.365 1.00 25.73 C ANISOU 1189 CA ALA A 452 3101 3366 3309 341 132 101 C ATOM 1190 C ALA A 452 -4.198 -28.033 47.008 1.00 26.35 C ANISOU 1190 C ALA A 452 3164 3448 3400 348 136 102 C ATOM 1191 O ALA A 452 -2.941 -28.048 46.933 1.00 27.04 O ANISOU 1191 O ALA A 452 3232 3559 3485 366 127 112 O ATOM 1192 CB ALA A 452 -5.309 -29.300 48.832 1.00 25.14 C ANISOU 1192 CB ALA A 452 3058 3271 3225 358 147 110 C ATOM 1193 N ALA A 453 -5.027 -28.086 45.953 1.00 25.46 N ANISOU 1193 N ALA A 453 3059 3313 3299 335 148 93 N ATOM 1194 CA ALA A 453 -4.544 -28.142 44.573 1.00 25.95 C ANISOU 1194 CA ALA A 453 3111 3376 3372 341 154 92 C ATOM 1195 C ALA A 453 -3.776 -26.880 44.195 1.00 26.89 C ANISOU 1195 C ALA A 453 3196 3521 3499 330 139 88 C ATOM 1196 O ALA A 453 -2.696 -26.951 43.567 1.00 26.83 O ANISOU 1196 O ALA A 453 3170 3530 3495 346 138 97 O ATOM 1197 CB ALA A 453 -5.680 -28.306 43.637 1.00 25.59 C ANISOU 1197 CB ALA A 453 3083 3304 3338 325 166 81 C ATOM 1198 N ILE A 454 -4.362 -25.733 44.547 1.00 26.62 N ANISOU 1198 N ILE A 454 3154 3490 3469 304 130 76 N ATOM 1199 CA ILE A 454 -3.783 -24.457 44.230 1.00 27.33 C ANISOU 1199 CA ILE A 454 3216 3601 3568 289 116 71 C ATOM 1200 C ILE A 454 -2.411 -24.395 44.909 1.00 28.29 C ANISOU 1200 C ILE A 454 3317 3752 3680 303 101 84 C ATOM 1201 O ILE A 454 -1.415 -23.983 44.305 1.00 28.19 O ANISOU 1201 O ILE A 454 3278 3760 3673 306 94 90 O ATOM 1202 CB ILE A 454 -4.674 -23.309 44.719 1.00 26.64 C ANISOU 1202 CB ILE A 454 3130 3510 3483 261 108 57 C ATOM 1203 CG1 ILE A 454 -5.919 -23.174 43.846 1.00 27.06 C ANISOU 1203 CG1 ILE A 454 3195 3539 3547 245 121 45 C ATOM 1204 CG2 ILE A 454 -3.909 -22.032 44.729 1.00 25.85 C ANISOU 1204 CG2 ILE A 454 3003 3432 3385 247 90 54 C ATOM 1205 CD1 ILE A 454 -7.165 -22.539 44.596 1.00 26.98 C ANISOU 1205 CD1 ILE A 454 3197 3517 3536 225 121 34 C ATOM 1206 N TRP A 455 -2.386 -24.825 46.164 1.00 29.19 N ANISOU 1206 N TRP A 455 3443 3870 3780 313 95 90 N ATOM 1207 CA TRP A 455 -1.170 -24.926 46.935 1.00 30.31 C ANISOU 1207 CA TRP A 455 3568 4039 3910 329 80 104 C ATOM 1208 C TRP A 455 -0.191 -25.799 46.185 1.00 31.06 C ANISOU 1208 C TRP A 455 3651 4142 4007 357 88 120 C ATOM 1209 O TRP A 455 0.978 -25.456 46.067 1.00 31.41 O ANISOU 1209 O TRP A 455 3666 4214 4052 363 76 130 O ATOM 1210 CB TRP A 455 -1.489 -25.568 48.275 1.00 30.36 C ANISOU 1210 CB TRP A 455 3597 4039 3898 339 78 109 C ATOM 1211 CG TRP A 455 -0.341 -25.631 49.215 1.00 32.64 C ANISOU 1211 CG TRP A 455 3871 4356 4173 354 59 123 C ATOM 1212 CD1 TRP A 455 0.385 -26.724 49.548 1.00 33.05 C ANISOU 1212 CD1 TRP A 455 3926 4417 4215 386 62 141 C ATOM 1213 CD2 TRP A 455 0.200 -24.543 49.980 1.00 35.28 C ANISOU 1213 CD2 TRP A 455 4188 4716 4503 338 34 120 C ATOM 1214 NE1 TRP A 455 1.353 -26.388 50.454 1.00 33.50 N ANISOU 1214 NE1 TRP A 455 3965 4504 4261 390 39 150 N ATOM 1215 CE2 TRP A 455 1.253 -25.057 50.742 1.00 32.86 C ANISOU 1215 CE2 TRP A 455 3871 4432 4182 360 21 137 C ATOM 1216 CE3 TRP A 455 -0.117 -23.173 50.094 1.00 37.85 C ANISOU 1216 CE3 TRP A 455 4506 5044 4832 306 21 104 C ATOM 1217 CZ2 TRP A 455 2.013 -24.267 51.577 1.00 35.81 C ANISOU 1217 CZ2 TRP A 455 4227 4834 4547 349 -7 139 C ATOM 1218 CZ3 TRP A 455 0.631 -22.388 50.948 1.00 37.02 C ANISOU 1218 CZ3 TRP A 455 4386 4962 4716 296 -6 106 C ATOM 1219 CH2 TRP A 455 1.682 -22.936 51.678 1.00 36.69 C ANISOU 1219 CH2 TRP A 455 4334 4946 4662 316 -20 123 C ATOM 1220 N GLU A 456 -0.675 -26.926 45.660 1.00 31.69 N ANISOU 1220 N GLU A 456 3756 4198 4087 374 109 122 N ATOM 1221 CA GLU A 456 0.228 -27.934 45.101 1.00 32.68 C ANISOU 1221 CA GLU A 456 3879 4329 4211 407 119 138 C ATOM 1222 C GLU A 456 0.722 -27.627 43.682 1.00 32.34 C ANISOU 1222 C GLU A 456 3815 4292 4180 408 126 138 C ATOM 1223 O GLU A 456 1.778 -28.107 43.294 1.00 32.33 O ANISOU 1223 O GLU A 456 3799 4306 4177 434 130 153 O ATOM 1224 CB GLU A 456 -0.368 -29.348 45.213 1.00 32.62 C ANISOU 1224 CB GLU A 456 3909 4292 4194 427 137 143 C ATOM 1225 CG GLU A 456 -0.163 -30.022 46.589 1.00 34.41 C ANISOU 1225 CG GLU A 456 4148 4524 4403 445 132 154 C ATOM 1226 CD GLU A 456 1.321 -30.069 47.082 1.00 38.66 C ANISOU 1226 CD GLU A 456 4658 5097 4933 470 118 173 C ATOM 1227 OE1 GLU A 456 2.237 -30.506 46.347 1.00 37.82 O ANISOU 1227 OE1 GLU A 456 4538 5003 4830 495 124 186 O ATOM 1228 OE2 GLU A 456 1.566 -29.686 48.248 1.00 39.94 O1- ANISOU 1228 OE2 GLU A 456 4813 5277 5085 466 100 176 O1- ATOM 1229 N LEU A 457 -0.027 -26.787 42.964 1.00 26.53 N ATOM 1230 CA LEU A 457 0.163 -26.491 41.542 1.00 31.90 C ANISOU 1230 CA LEU A 457 3747 4224 4149 377 137 119 C ATOM 1231 C LEU A 457 0.767 -25.126 41.197 1.00 32.53 C ANISOU 1231 C LEU A 457 3791 4329 4240 357 123 117 C ATOM 1232 O LEU A 457 1.226 -24.925 40.068 1.00 33.17 O ANISOU 1232 O LEU A 457 3858 4416 4329 360 130 119 O ATOM 1233 CB LEU A 457 -1.172 -26.602 40.809 1.00 31.24 C ANISOU 1233 CB LEU A 457 3690 4106 4072 361 149 103 C ATOM 1234 CG LEU A 457 -1.835 -27.975 40.753 1.00 29.84 C ANISOU 1234 CG LEU A 457 3550 3899 3887 377 166 104 C ATOM 1235 CD1 LEU A 457 -3.344 -27.845 40.432 1.00 28.10 C ANISOU 1235 CD1 LEU A 457 3353 3649 3673 351 172 88 C ATOM 1236 CD2 LEU A 457 -1.103 -28.873 39.752 1.00 25.24 C ANISOU 1236 CD2 LEU A 457 2973 3314 3302 407 181 115 C ATOM 1237 N GLU A 458 0.745 -24.169 42.118 1.00 32.85 N ANISOU 1237 N GLU A 458 3820 4383 4279 335 103 112 N ATOM 1238 CA GLU A 458 1.462 -22.942 41.865 1.00 33.59 C ANISOU 1238 CA GLU A 458 3880 4501 4382 316 89 112 C ATOM 1239 C GLU A 458 2.840 -23.229 41.204 1.00 33.92 C ANISOU 1239 C GLU A 458 3893 4569 4427 339 92 131 C ATOM 1240 O GLU A 458 3.180 -22.672 40.175 1.00 33.46 O ANISOU 1240 O GLU A 458 3816 4518 4380 332 96 131 O ATOM 1241 CB GLU A 458 1.614 -22.141 43.163 1.00 33.96 C ANISOU 1241 CB GLU A 458 3918 4563 4422 298 65 109 C ATOM 1242 CG GLU A 458 2.677 -21.034 43.084 1.00 35.05 C ANISOU 1242 CG GLU A 458 4019 4732 4567 282 46 115 C ATOM 1243 CD GLU A 458 2.599 -19.988 44.179 1.00 38.87 C ANISOU 1243 CD GLU A 458 4500 5224 5045 256 22 106 C ATOM 1244 OE1 GLU A 458 3.185 -18.900 43.956 1.00 40.32 O ANISOU 1244 OE1 GLU A 458 4659 5425 5236 234 7 106 O ATOM 1245 OE2 GLU A 458 1.973 -20.233 45.247 1.00 39.92 O1- ANISOU 1245 OE2 GLU A 458 4656 5346 5165 256 17 100 O1- ATOM 1246 N ARG A 459 3.608 -24.127 41.790 1.00 29.31 N ATOM 1247 CA ARG A 459 4.973 -24.311 41.387 1.00 36.86 C ANISOU 1247 CA ARG A 459 4228 4985 4791 390 92 168 C ATOM 1248 C ARG A 459 5.170 -24.800 39.942 1.00 37.56 C ANISOU 1248 C ARG A 459 4318 5067 4887 409 116 173 C ATOM 1249 O ARG A 459 6.018 -24.268 39.235 1.00 37.53 O ANISOU 1249 O ARG A 459 4282 5085 4891 408 116 182 O ATOM 1250 CB ARG A 459 5.688 -25.212 42.395 1.00 37.61 C ANISOU 1250 CB ARG A 459 4321 5097 4872 419 86 186 C ATOM 1251 CG ARG A 459 7.207 -25.347 42.172 1.00 39.65 C ANISOU 1251 CG ARG A 459 4539 5393 5132 443 83 210 C ATOM 1252 CD ARG A 459 7.829 -24.033 41.722 1.00 41.61 C ANISOU 1252 CD ARG A 459 4748 5668 5394 415 69 211 C ATOM 1253 NE ARG A 459 7.807 -23.045 42.797 1.00 45.12 N ANISOU 1253 NE ARG A 459 5182 6125 5837 383 40 204 N ATOM 1254 CZ ARG A 459 8.200 -21.775 42.672 1.00 45.66 C ANISOU 1254 CZ ARG A 459 5222 6211 5915 350 23 202 C ATOM 1255 NH1 ARG A 459 8.644 -21.323 41.500 1.00 42.06 N ANISOU 1255 NH1 ARG A 459 4743 5765 5474 346 33 207 N ATOM 1256 NH2 ARG A 459 8.139 -20.951 43.729 1.00 45.71 N ANISOU 1256 NH2 ARG A 459 5225 6226 5916 322 -4 194 N ATOM 1257 N PRO A 460 4.422 -25.837 39.505 1.00 38.38 N ANISOU 1257 N PRO A 460 4459 5139 4985 426 136 167 N ATOM 1258 CA PRO A 460 4.568 -26.261 38.090 1.00 38.45 C ANISOU 1258 CA PRO A 460 4472 5138 4998 444 159 170 C ATOM 1259 C PRO A 460 4.131 -25.203 37.072 1.00 38.17 C ANISOU 1259 C PRO A 460 4430 5098 4976 414 160 156 C ATOM 1260 O PRO A 460 4.753 -25.073 36.034 1.00 38.61 O ANISOU 1260 O PRO A 460 4470 5164 5037 424 171 164 O ATOM 1261 CB PRO A 460 3.641 -27.474 37.979 1.00 38.06 C ANISOU 1261 CB PRO A 460 4471 5052 4940 459 176 163 C ATOM 1262 CG PRO A 460 3.432 -27.935 39.363 1.00 38.09 C ANISOU 1262 CG PRO A 460 4487 5053 4933 463 165 165 C ATOM 1263 CD PRO A 460 3.593 -26.782 40.280 1.00 38.04 C ANISOU 1263 CD PRO A 460 4453 5070 4930 436 141 162 C ATOM 1264 N PHE A 461 3.063 -24.471 37.369 1.00 37.64 N ANISOU 1264 N PHE A 461 4375 5014 4913 381 150 138 N ATOM 1265 CA PHE A 461 2.551 -23.464 36.447 1.00 36.63 C ANISOU 1265 CA PHE A 461 4243 4878 4797 353 151 124 C ATOM 1266 C PHE A 461 3.595 -22.375 36.242 1.00 37.49 C ANISOU 1266 C PHE A 461 4310 5020 4915 341 140 134 C ATOM 1267 O PHE A 461 3.955 -22.066 35.117 1.00 38.46 O ANISOU 1267 O PHE A 461 4420 5147 5045 343 150 137 O ATOM 1268 CB PHE A 461 1.206 -22.916 36.948 1.00 35.51 C ANISOU 1268 CB PHE A 461 4122 4714 4657 323 142 104 C ATOM 1269 CG PHE A 461 0.030 -23.780 36.581 1.00 32.30 C ANISOU 1269 CG PHE A 461 3754 4271 4246 327 157 94 C ATOM 1270 CD1 PHE A 461 -0.157 -25.009 37.165 1.00 31.74 C ANISOU 1270 CD1 PHE A 461 3707 4187 4164 349 163 98 C ATOM 1271 CD2 PHE A 461 -0.874 -23.371 35.616 1.00 30.61 C ANISOU 1271 CD2 PHE A 461 3552 4037 4040 309 163 80 C ATOM 1272 CE1 PHE A 461 -1.244 -25.829 36.794 1.00 29.73 C ANISOU 1272 CE1 PHE A 461 3489 3900 3907 350 176 89 C ATOM 1273 CE2 PHE A 461 -1.924 -24.161 35.230 1.00 28.59 C ANISOU 1273 CE2 PHE A 461 3331 3752 3782 311 174 71 C ATOM 1274 CZ PHE A 461 -2.123 -25.398 35.826 1.00 29.92 C ANISOU 1274 CZ PHE A 461 3523 3906 3939 330 181 75 C ATOM 1275 N LEU A 462 4.111 -21.824 37.332 1.00 38.28 N ANISOU 1275 N LEU A 462 4389 5142 5014 330 119 139 N ATOM 1276 CA LEU A 462 5.123 -20.778 37.263 1.00 38.69 C ANISOU 1276 CA LEU A 462 4399 5225 5074 314 105 148 C ATOM 1277 C LEU A 462 6.382 -21.328 36.627 1.00 39.65 C ANISOU 1277 C LEU A 462 4495 5372 5197 345 117 171 C ATOM 1278 O LEU A 462 6.953 -20.690 35.737 1.00 40.26 O ANISOU 1278 O LEU A 462 4548 5465 5285 337 122 178 O ATOM 1279 CB LEU A 462 5.436 -20.225 38.656 1.00 38.62 C ANISOU 1279 CB LEU A 462 4378 5235 5062 298 79 149 C ATOM 1280 CG LEU A 462 4.345 -19.325 39.247 1.00 38.06 C ANISOU 1280 CG LEU A 462 4326 5145 4991 264 65 128 C ATOM 1281 CD1 LEU A 462 4.424 -19.183 40.736 1.00 34.81 C ANISOU 1281 CD1 LEU A 462 3915 4741 4568 256 43 127 C ATOM 1282 CD2 LEU A 462 4.444 -17.957 38.592 1.00 39.35 C ANISOU 1282 CD2 LEU A 462 4471 5313 5167 232 58 122 C ATOM 1283 N ASP A 463 6.816 -22.496 37.103 1.00 40.12 N ANISOU 1283 N ASP A 463 4560 5438 5246 379 123 184 N ATOM 1284 CA ASP A 463 7.860 -23.289 36.453 1.00 41.08 C ANISOU 1284 CA ASP A 463 4665 5578 5366 417 140 206 C ATOM 1285 C ASP A 463 7.652 -23.228 34.930 1.00 40.51 C ANISOU 1285 C ASP A 463 4601 5491 5300 420 163 202 C ATOM 1286 O ASP A 463 8.542 -22.804 34.193 1.00 39.66 O ANISOU 1286 O ASP A 463 4461 5407 5200 424 169 216 O ATOM 1287 CB ASP A 463 7.818 -24.756 36.932 1.00 41.67 C ANISOU 1287 CB ASP A 463 4766 5641 5426 455 151 213 C ATOM 1288 CG ASP A 463 8.798 -25.060 38.109 1.00 45.61 C ANISOU 1288 CG ASP A 463 5240 6171 5918 472 135 233 C ATOM 1289 OD1 ASP A 463 9.820 -24.322 38.278 1.00 46.01 O ANISOU 1289 OD1 ASP A 463 5247 6260 5976 463 120 247 O ATOM 1290 OD2 ASP A 463 8.544 -26.078 38.847 1.00 48.15 O1- ANISOU 1290 OD2 ASP A 463 5588 6481 6227 495 138 235 O1- ATOM 1291 N GLU A 464 6.452 -23.587 34.473 1.00 33.59 N ATOM 1292 CA GLU A 464 6.195 -23.589 33.058 1.00 39.35 C ANISOU 1292 CA GLU A 464 4507 5292 5154 420 194 178 C ATOM 1293 C GLU A 464 6.165 -22.179 32.522 1.00 38.79 C ANISOU 1293 C GLU A 464 4413 5229 5095 385 186 172 C ATOM 1294 O GLU A 464 6.877 -21.895 31.559 1.00 38.81 O ANISOU 1294 O GLU A 464 4395 5247 5103 393 198 183 O ATOM 1295 CB GLU A 464 4.912 -24.323 32.698 1.00 39.69 C ANISOU 1295 CB GLU A 464 4599 5292 5189 422 206 160 C ATOM 1296 CG GLU A 464 4.848 -24.642 31.205 1.00 42.18 C ANISOU 1296 CG GLU A 464 4930 5593 5504 437 229 159 C ATOM 1297 CD GLU A 464 3.516 -25.193 30.745 1.00 43.62 C ANISOU 1297 CD GLU A 464 5159 5734 5681 432 237 139 C ATOM 1298 OE1 GLU A 464 3.285 -25.201 29.512 1.00 43.55 O ANISOU 1298 OE1 GLU A 464 5164 5712 5671 434 250 134 O ATOM 1299 OE2 GLU A 464 2.713 -25.629 31.601 1.00 44.24 O1- ANISOU 1299 OE2 GLU A 464 5260 5793 5754 424 229 130 O1- ATOM 1300 N LEU A 465 5.360 -21.295 33.131 1.00 31.88 N ATOM 1301 CA LEU A 465 5.224 -19.910 32.632 1.00 36.37 C ANISOU 1301 CA LEU A 465 4096 4917 4807 315 159 148 C ATOM 1302 C LEU A 465 6.576 -19.296 32.308 1.00 36.44 C ANISOU 1302 C LEU A 465 4060 4963 4824 314 157 168 C ATOM 1303 O LEU A 465 6.781 -18.717 31.252 1.00 35.78 O ANISOU 1303 O LEU A 465 3966 4883 4747 307 167 170 O ATOM 1304 CB LEU A 465 4.466 -19.034 33.615 1.00 35.36 C ANISOU 1304 CB LEU A 465 3973 4781 4681 280 137 132 C ATOM 1305 CG LEU A 465 2.941 -19.254 33.609 1.00 35.47 C ANISOU 1305 CG LEU A 465 4028 4758 4692 271 141 110 C ATOM 1306 CD1 LEU A 465 2.271 -18.881 34.936 1.00 32.79 C ANISOU 1306 CD1 LEU A 465 3698 4411 4349 251 122 99 C ATOM 1307 CD2 LEU A 465 2.240 -18.566 32.447 1.00 33.23 C ANISOU 1307 CD2 LEU A 465 3754 4457 4416 253 149 98 C ATOM 1308 N ARG A 466 7.493 -19.453 33.241 1.00 36.90 N ANISOU 1308 N ARG A 466 4092 5048 4879 322 145 183 N ATOM 1309 CA ARG A 466 8.866 -19.102 33.060 1.00 38.20 C ANISOU 1309 CA ARG A 466 4212 5252 5051 327 142 207 C ATOM 1310 C ARG A 466 9.401 -19.638 31.702 1.00 38.13 C ANISOU 1310 C ARG A 466 4197 5247 5042 357 171 220 C ATOM 1311 O ARG A 466 9.786 -18.852 30.831 1.00 37.67 O ANISOU 1311 O ARG A 466 4118 5201 4994 344 177 226 O ATOM 1312 CB ARG A 466 9.624 -19.659 34.266 1.00 39.12 C ANISOU 1312 CB ARG A 466 4311 5393 5161 343 128 221 C ATOM 1313 CG ARG A 466 11.076 -19.290 34.381 1.00 43.20 C ANISOU 1313 CG ARG A 466 4775 5955 5684 345 119 247 C ATOM 1314 CD ARG A 466 11.376 -18.312 35.513 1.00 50.21 C ANISOU 1314 CD ARG A 466 5641 6862 6576 309 85 247 C ATOM 1315 NE ARG A 466 12.765 -17.861 35.383 1.00 56.71 N ANISOU 1315 NE ARG A 466 6411 7729 7408 306 78 273 N ATOM 1316 CZ ARG A 466 13.172 -16.984 34.463 1.00 58.72 C ANISOU 1316 CZ ARG A 466 6640 7994 7675 287 84 279 C ATOM 1317 NH1 ARG A 466 12.286 -16.445 33.609 1.00 58.59 N ANISOU 1317 NH1 ARG A 466 6649 7948 7664 269 95 260 N ATOM 1318 NH2 ARG A 466 14.457 -16.652 34.390 1.00 58.75 N ANISOU 1318 NH2 ARG A 466 6593 8040 7688 285 77 305 N ATOM 1319 N ARG A 467 9.383 -20.966 31.522 1.00 38.36 N ANISOU 1319 N ARG A 467 4249 5267 5060 398 190 225 N ATOM 1320 CA ARG A 467 9.845 -21.654 30.300 1.00 38.07 C ANISOU 1320 CA ARG A 467 4214 5230 5019 433 220 237 C ATOM 1321 C ARG A 467 9.337 -20.991 29.016 1.00 37.78 C ANISOU 1321 C ARG A 467 4190 5178 4989 416 232 226 C ATOM 1322 O ARG A 467 10.092 -20.889 28.044 1.00 38.26 O ANISOU 1322 O ARG A 467 4230 5254 5051 431 250 242 O ATOM 1323 CB ARG A 467 9.474 -23.150 30.335 1.00 38.12 C ANISOU 1323 CB ARG A 467 4261 5213 5011 472 237 235 C ATOM 1324 CG ARG A 467 10.608 -24.102 30.764 1.00 39.65 C ANISOU 1324 CG ARG A 467 4435 5433 5197 515 244 260 C ATOM 1325 CD ARG A 467 10.278 -25.087 31.905 1.00 40.95 C ANISOU 1325 CD ARG A 467 4624 5584 5349 532 236 258 C ATOM 1326 NE ARG A 467 9.010 -25.801 31.700 1.00 42.59 N ANISOU 1326 NE ARG A 467 4888 5746 5548 534 246 236 N ATOM 1327 CZ ARG A 467 8.293 -26.371 32.669 1.00 42.29 C ANISOU 1327 CZ ARG A 467 4879 5688 5503 532 236 226 C ATOM 1328 NH1 ARG A 467 8.708 -26.313 33.929 1.00 41.59 N ANISOU 1328 NH1 ARG A 467 4770 5620 5413 530 216 234 N ATOM 1329 NH2 ARG A 467 7.143 -26.982 32.375 1.00 42.68 N ANISOU 1329 NH2 ARG A 467 4976 5696 5545 531 245 207 N ATOM 1330 N ASN A 468 8.084 -20.520 29.026 1.00 36.69 N ATOM 1331 CA ASN A 468 7.508 -19.749 27.918 1.00 35.82 C ATOM 1332 C ASN A 468 7.753 -18.232 27.953 1.00 35.82 C ATOM 1333 O ASN A 468 7.097 -17.477 27.237 1.00 35.23 O ATOM 1334 CB ASN A 468 6.000 -19.904 27.919 1.00 35.85 C ATOM 1335 CG ASN A 468 5.535 -21.334 27.810 1.00 35.57 C ATOM 1336 OD1 ASN A 468 6.327 -22.281 27.795 1.00 36.86 O ATOM 1337 ND2 ASN A 468 4.218 -21.496 27.749 1.00 33.38 N