>>4GCK:HELIX   32  32 GLN C  118  GLY C  148  1                                  31    
QDRLQGRINQLFERIEVQLRQVMREKKMREG
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 32 32 GLN C 118 GLY C 148 1 31 ATOM 3944 N GLN C 118 -0.440 4.969 29.066 1.00 36.78 N ATOM 3945 CA GLN C 118 -0.603 6.400 29.360 1.00 40.17 C ATOM 3946 C GLN C 118 -1.075 7.250 28.155 1.00 37.44 C ATOM 3947 O GLN C 118 -0.473 7.198 27.083 1.00 30.42 O ATOM 3948 CB GLN C 118 0.735 6.971 29.871 1.00 40.58 C ATOM 3949 CG GLN C 118 1.052 6.679 31.326 1.00 43.54 C ATOM 3950 CD GLN C 118 0.018 7.276 32.268 1.00 56.12 C ATOM 3951 OE1 GLN C 118 -0.308 8.467 32.191 1.00 60.61 O ATOM 3952 NE2 GLN C 118 -0.504 6.450 33.168 1.00 60.62 N ATOM 3953 N ASP C 119 -2.115 8.058 28.357 1.00 32.70 N ATOM 3954 CA ASP C 119 -2.647 8.907 27.299 1.00 35.56 C ATOM 3955 C ASP C 119 -1.584 9.791 26.667 1.00 34.89 C ATOM 3956 O ASP C 119 -1.658 10.105 25.477 1.00 33.64 O ATOM 3957 CB ASP C 119 -3.767 9.810 27.829 1.00 36.42 C ATOM 3958 CG ASP C 119 -5.049 9.064 28.091 1.00 40.26 C ATOM 3959 OD1 ASP C 119 -5.265 7.993 27.483 1.00 50.83 O ATOM 3960 OD2 ASP C 119 -5.860 9.562 28.897 1.00 49.29 O ATOM 3961 N ARG C 120 -0.617 10.212 27.479 1.00 33.53 N ATOM 3962 CA ARG C 120 0.492 11.057 27.025 1.00 32.16 C ATOM 3963 C ARG C 120 1.183 10.466 25.778 1.00 30.93 C ATOM 3964 O ARG C 120 1.642 11.197 24.892 1.00 27.46 O ATOM 3965 CB ARG C 120 1.509 11.228 28.181 1.00 33.63 C ATOM 3966 CG ARG C 120 2.826 11.940 27.806 1.00 37.35 C ATOM 3967 CD ARG C 120 3.806 11.964 28.999 1.00 42.31 C ATOM 3968 NE ARG C 120 4.282 10.632 29.383 1.00 43.08 N ATOM 3969 CZ ARG C 120 5.144 9.907 28.665 1.00 39.69 C ATOM 3970 NH1 ARG C 120 5.634 10.389 27.528 1.00 40.92 N ATOM 3971 NH2 ARG C 120 5.492 8.690 29.072 1.00 32.72 N ATOM 3972 N LEU C 121 1.256 9.140 25.704 1.00 28.18 N ATOM 3973 CA LEU C 121 1.904 8.516 24.566 1.00 28.19 C ATOM 3974 C LEU C 121 1.152 8.796 23.244 1.00 28.58 C ATOM 3975 O LEU C 121 1.774 9.077 22.197 1.00 26.67 O ATOM 3976 CB LEU C 121 2.047 7.013 24.846 1.00 25.95 C ATOM 3977 CG LEU C 121 2.804 6.705 26.136 1.00 26.49 C ATOM 3978 CD1 LEU C 121 2.589 5.231 26.485 1.00 24.96 C ATOM 3979 CD2 LEU C 121 4.298 7.024 25.988 1.00 23.90 C ATOM 3980 N GLN C 122 -0.180 8.736 23.276 1.00 27.25 N ATOM 3981 CA GLN C 122 -0.954 8.998 22.070 1.00 24.26 C ATOM 3982 C GLN C 122 -0.648 10.448 21.701 1.00 27.60 C ATOM 3983 O GLN C 122 -0.557 10.816 20.512 1.00 26.97 O ATOM 3984 CB GLN C 122 -2.445 8.824 22.340 1.00 18.62 C ATOM 3985 CG GLN C 122 -3.302 9.138 21.122 1.00 30.07 C ATOM 3986 CD GLN C 122 -2.936 8.299 19.906 1.00 28.56 C ATOM 3987 OE1 GLN C 122 -2.691 8.827 18.814 1.00 31.13 O ATOM 3988 NE2 GLN C 122 -2.907 6.993 20.085 1.00 34.14 N ATOM 3989 N GLY C 123 -0.473 11.279 22.723 1.00 24.82 N ATOM 3990 CA GLY C 123 -0.131 12.669 22.455 1.00 29.55 C ATOM 3991 C GLY C 123 1.173 12.758 21.668 1.00 26.49 C ATOM 3992 O GLY C 123 1.290 13.558 20.743 1.00 30.84 O ATOM 3993 N ARG C 124 2.159 11.932 22.016 1.00 27.91 N ATOM 3994 CA ARG C 124 3.446 11.947 21.301 1.00 25.77 C ATOM 3995 C ARG C 124 3.244 11.530 19.853 1.00 24.01 C ATOM 3996 O ARG C 124 3.828 12.122 18.962 1.00 23.72 O ATOM 3997 CB ARG C 124 4.452 10.989 21.922 1.00 24.68 C ATOM 3998 CG ARG C 124 4.865 11.317 23.313 1.00 42.10 C ATOM 3999 CD ARG C 124 6.334 11.699 23.341 1.00 48.73 C ATOM 4000 NE ARG C 124 7.218 10.630 22.882 1.00 48.52 N ATOM 4001 CZ ARG C 124 8.542 10.742 22.842 1.00 53.21 C ATOM 4002 NH1 ARG C 124 9.118 11.871 23.232 1.00 58.30 N ATOM 4003 NH2 ARG C 124 9.294 9.739 22.420 1.00 50.62 N ATOM 4004 N ILE C 125 2.444 10.486 19.633 1.00 23.03 N ATOM 4005 CA ILE C 125 2.143 10.027 18.289 1.00 18.05 C ATOM 4006 C ILE C 125 1.449 11.129 17.475 1.00 20.89 C ATOM 4007 O ILE C 125 1.810 11.380 16.302 1.00 24.26 O ATOM 4008 CB ILE C 125 1.274 8.737 18.350 1.00 28.48 C ATOM 4009 CG1 ILE C 125 2.165 7.567 18.812 1.00 23.79 C ATOM 4010 CG2 ILE C 125 0.625 8.445 17.014 1.00 20.26 C ATOM 4011 CD1 ILE C 125 3.431 7.443 17.988 1.00 26.29 C ATOM 4012 N ASN C 126 0.470 11.798 18.076 1.00 26.60 N ATOM 4013 CA ASN C 126 -0.210 12.882 17.376 1.00 24.07 C ATOM 4014 C ASN C 126 0.789 13.966 16.981 1.00 24.93 C ATOM 4015 O ASN C 126 0.731 14.518 15.874 1.00 26.32 O ATOM 4016 CB ASN C 126 -1.305 13.480 18.243 1.00 24.27 C ATOM 4017 CG ASN C 126 -2.534 12.615 18.279 1.00 32.60 C ATOM 4018 OD1 ASN C 126 -2.747 11.793 17.374 1.00 29.70 O ATOM 4019 ND2 ASN C 126 -3.368 12.794 19.309 1.00 24.97 N ATOM 4020 N GLN C 127 1.711 14.259 17.890 1.00 29.70 N ATOM 4021 CA GLN C 127 2.744 15.245 17.633 1.00 29.75 C ATOM 4022 C GLN C 127 3.564 14.821 16.420 1.00 28.44 C ATOM 4023 O GLN C 127 3.943 15.658 15.580 1.00 28.78 O ATOM 4024 CB GLN C 127 3.650 15.396 18.865 1.00 29.82 C ATOM 4025 CG GLN C 127 3.069 16.309 19.916 1.00 45.69 C ATOM 4026 CD GLN C 127 4.059 16.644 21.022 1.00 58.64 C ATOM 4027 OE1 GLN C 127 4.121 15.966 22.057 1.00 62.44 O ATOM 4028 NE2 GLN C 127 4.852 17.693 20.803 1.00 67.98 N ATOM 4029 N LEU C 128 3.798 13.516 16.297 1.00 26.57 N ATOM 4030 CA LEU C 128 4.603 13.009 15.188 1.00 25.52 C ATOM 4031 C LEU C 128 3.857 13.190 13.880 1.00 26.99 C ATOM 4032 O LEU C 128 4.421 13.639 12.875 1.00 23.50 O ATOM 4033 CB LEU C 128 4.941 11.536 15.421 1.00 23.89 C ATOM 4034 CG LEU C 128 5.706 10.868 14.288 1.00 29.58 C ATOM 4035 CD1 LEU C 128 6.989 11.653 14.007 1.00 27.30 C ATOM 4036 CD2 LEU C 128 6.023 9.410 14.662 1.00 17.62 C ATOM 4037 N PHE C 129 2.568 12.856 13.891 1.00 24.71 N ATOM 4038 CA PHE C 129 1.780 13.015 12.690 1.00 23.08 C ATOM 4039 C PHE C 129 1.742 14.465 12.305 1.00 22.70 C ATOM 4040 O PHE C 129 1.816 14.765 11.126 1.00 21.22 O ATOM 4041 CB PHE C 129 0.358 12.477 12.888 1.00 25.20 C ATOM 4042 CG PHE C 129 0.266 10.990 12.739 1.00 27.98 C ATOM 4043 CD1 PHE C 129 0.630 10.390 11.542 1.00 31.03 C ATOM 4044 CD2 PHE C 129 -0.195 10.192 13.780 1.00 28.52 C ATOM 4045 CE1 PHE C 129 0.522 9.022 11.367 1.00 31.45 C ATOM 4046 CE2 PHE C 129 -0.308 8.806 13.619 1.00 28.46 C ATOM 4047 CZ PHE C 129 0.056 8.223 12.411 1.00 31.00 C ATOM 4048 N GLU C 130 1.627 15.360 13.295 1.00 25.16 N ATOM 4049 CA GLU C 130 1.605 16.803 13.006 1.00 30.63 C ATOM 4050 C GLU C 130 2.951 17.222 12.399 1.00 30.67 C ATOM 4051 O GLU C 130 2.991 18.011 11.452 1.00 22.91 O ATOM 4052 CB GLU C 130 1.320 17.621 14.275 1.00 30.94 C ATOM 4053 CG GLU C 130 -0.126 17.489 14.812 1.00 45.34 C ATOM 4054 CD GLU C 130 -1.182 17.942 13.800 1.00 51.90 C ATOM 4055 OE1 GLU C 130 -0.917 18.941 13.095 1.00 55.50 O ATOM 4056 OE2 GLU C 130 -2.274 17.313 13.716 1.00 44.05 O ATOM 4057 N ARG C 131 4.047 16.678 12.929 1.00 27.57 N ATOM 4058 CA ARG C 131 5.366 16.991 12.379 1.00 26.94 C ATOM 4059 C ARG C 131 5.459 16.549 10.898 1.00 26.07 C ATOM 4060 O ARG C 131 5.851 17.329 10.017 1.00 22.45 O ATOM 4061 CB ARG C 131 6.438 16.311 13.229 1.00 32.42 C ATOM 4062 CG ARG C 131 7.797 16.298 12.574 1.00 43.81 C ATOM 4063 CD ARG C 131 8.810 17.096 13.346 1.00 46.05 C ATOM 4064 NE ARG C 131 9.681 16.245 14.145 1.00 49.30 N ATOM 4065 CZ ARG C 131 11.009 16.338 14.143 1.00 46.94 C ATOM 4066 NH1 ARG C 131 11.608 17.238 13.381 1.00 48.14 N ATOM 4067 NH2 ARG C 131 11.738 15.545 14.911 1.00 46.61 N ATOM 4068 N ILE C 132 5.065 15.309 10.613 1.00 26.49 N ATOM 4069 CA ILE C 132 5.072 14.796 9.246 1.00 26.14 C ATOM 4070 C ILE C 132 4.197 15.651 8.297 1.00 28.46 C ATOM 4071 O ILE C 132 4.619 16.032 7.191 1.00 25.01 O ATOM 4072 CB ILE C 132 4.559 13.319 9.231 1.00 24.55 C ATOM 4073 CG1 ILE C 132 5.577 12.447 9.974 1.00 27.35 C ATOM 4074 CG2 ILE C 132 4.268 12.860 7.790 1.00 27.40 C ATOM 4075 CD1 ILE C 132 5.137 11.050 10.270 1.00 24.08 C ATOM 4076 N GLU C 133 2.976 15.936 8.735 1.00 24.43 N ATOM 4077 CA GLU C 133 2.035 16.702 7.940 1.00 29.34 C ATOM 4078 C GLU C 133 2.576 18.107 7.618 1.00 28.04 C ATOM 4079 O GLU C 133 2.392 18.617 6.506 1.00 26.80 O ATOM 4080 CB GLU C 133 0.685 16.793 8.687 1.00 26.16 C ATOM 4081 CG GLU C 133 -0.484 17.194 7.805 1.00 33.31 C ATOM 4082 CD GLU C 133 -1.852 17.051 8.488 1.00 34.79 C ATOM 4083 OE1 GLU C 133 -1.976 16.235 9.425 1.00 39.84 O ATOM 4084 OE2 GLU C 133 -2.801 17.754 8.071 1.00 35.01 O ATOM 4085 N VAL C 134 3.256 18.714 8.588 1.00 28.63 N ATOM 4086 CA VAL C 134 3.829 20.051 8.422 1.00 29.11 C ATOM 4087 C VAL C 134 4.986 20.031 7.415 1.00 30.67 C ATOM 4088 O VAL C 134 5.222 21.013 6.685 1.00 27.17 O ATOM 4089 CB VAL C 134 4.354 20.600 9.758 1.00 29.36 C ATOM 4090 CG1 VAL C 134 5.051 21.940 9.542 1.00 19.99 C ATOM 4091 CG2 VAL C 134 3.221 20.748 10.754 1.00 19.98 C ATOM 4092 N GLN C 135 5.697 18.908 7.367 1.00 29.39 N ATOM 4093 CA GLN C 135 6.788 18.747 6.414 1.00 30.47 C ATOM 4094 C GLN C 135 6.196 18.617 5.022 1.00 30.08 C ATOM 4095 O GLN C 135 6.700 19.203 4.068 1.00 29.85 O ATOM 4096 CB GLN C 135 7.596 17.475 6.706 1.00 30.74 C ATOM 4097 CG GLN C 135 8.973 17.732 7.282 1.00 45.77 C ATOM 4098 CD GLN C 135 9.967 18.298 6.268 1.00 38.89 C ATOM 4099 OE1 GLN C 135 9.591 18.939 5.269 1.00 39.76 O ATOM 4100 NE2 GLN C 135 11.246 18.083 6.539 1.00 41.96 N ATOM 4101 N LEU C 136 5.131 17.829 4.899 1.00 31.34 N ATOM 4102 CA LEU C 136 4.493 17.633 3.593 1.00 30.16 C ATOM 4103 C LEU C 136 3.979 18.958 3.090 1.00 24.36 C ATOM 4104 O LEU C 136 4.042 19.260 1.894 1.00 25.66 O ATOM 4105 CB LEU C 136 3.313 16.680 3.704 1.00 27.25 C ATOM 4106 CG LEU C 136 3.577 15.221 4.060 1.00 27.11 C ATOM 4107 CD1 LEU C 136 2.265 14.549 4.438 1.00 27.97 C ATOM 4108 CD2 LEU C 136 4.215 14.539 2.890 1.00 22.69 C ATOM 4109 N ARG C 137 3.425 19.724 4.013 1.00 22.91 N ATOM 4110 CA ARG C 137 2.887 21.033 3.680 1.00 27.96 C ATOM 4111 C ARG C 137 4.053 21.881 3.166 1.00 23.30 C ATOM 4112 O ARG C 137 3.971 22.497 2.114 1.00 27.42 O ATOM 4113 CB ARG C 137 2.260 21.636 4.929 1.00 29.84 C ATOM 4114 CG ARG C 137 0.926 22.289 4.703 1.00 32.23 C ATOM 4115 CD ARG C 137 0.026 22.095 5.909 1.00 23.97 C ATOM 4116 NE ARG C 137 0.702 22.391 7.167 1.00 29.01 N ATOM 4117 CZ ARG C 137 0.409 21.799 8.321 1.00 31.77 C ATOM 4118 NH1 ARG C 137 -0.552 20.881 8.381 1.00 30.08 N ATOM 4119 NH2 ARG C 137 1.103 22.094 9.412 1.00 35.08 N ATOM 4120 N GLN C 138 5.158 21.850 3.896 1.00 29.42 N ATOM 4121 CA GLN C 138 6.373 22.599 3.517 1.00 33.86 C ATOM 4122 C GLN C 138 6.902 22.162 2.143 1.00 27.47 C ATOM 4123 O GLN C 138 7.281 22.998 1.324 1.00 24.26 O ATOM 4124 CB GLN C 138 7.448 22.415 4.603 1.00 39.10 C ATOM 4125 CG GLN C 138 8.471 23.537 4.682 1.00 54.40 C ATOM 4126 CD GLN C 138 9.790 23.210 3.988 1.00 66.62 C ATOM 4127 OE1 GLN C 138 10.411 22.167 4.246 1.00 71.20 O ATOM 4128 NE2 GLN C 138 10.236 24.113 3.114 1.00 72.48 N ATOM 4129 N VAL C 139 6.954 20.854 1.891 1.00 27.37 N ATOM 4130 CA VAL C 139 7.387 20.361 0.589 1.00 22.90 C ATOM 4131 C VAL C 139 6.455 20.907 -0.516 1.00 26.15 C ATOM 4132 O VAL C 139 6.915 21.341 -1.589 1.00 23.49 O ATOM 4133 CB VAL C 139 7.353 18.795 0.522 1.00 22.94 C ATOM 4134 CG1 VAL C 139 7.345 18.317 -0.949 1.00 19.66 C ATOM 4135 CG2 VAL C 139 8.558 18.211 1.236 1.00 24.25 C ATOM 4136 N MET C 140 5.146 20.863 -0.262 1.00 21.98 N ATOM 4137 CA MET C 140 4.159 21.330 -1.234 1.00 28.56 C ATOM 4138 C MET C 140 4.274 22.819 -1.538 1.00 26.80 C ATOM 4139 O MET C 140 4.090 23.244 -2.681 1.00 27.37 O ATOM 4140 CB MET C 140 2.738 21.046 -0.734 1.00 25.88 C ATOM 4141 CG MET C 140 2.310 19.589 -0.870 1.00 34.38 C ATOM 4142 SD MET C 140 0.797 19.179 0.067 1.00 29.57 S ATOM 4143 CE MET C 140 0.882 17.352 -0.002 1.00 27.51 C ATOM 4144 N ARG C 141 4.570 23.606 -0.512 1.00 27.49 N ATOM 4145 CA ARG C 141 4.704 25.046 -0.670 1.00 34.35 C ATOM 4146 C ARG C 141 5.912 25.440 -1.502 1.00 33.34 C ATOM 4147 O ARG C 141 5.969 26.531 -2.056 1.00 32.80 O ATOM 4148 CB ARG C 141 4.757 25.724 0.711 1.00 31.84 C ATOM 4149 CG ARG C 141 3.352 25.978 1.246 1.00 45.08 C ATOM 4150 CD ARG C 141 3.280 26.921 2.458 1.00 51.25 C ATOM 4151 NE ARG C 141 3.397 26.231 3.736 1.00 48.20 N ATOM 4152 CZ ARG C 141 4.554 25.965 4.328 1.00 53.28 C ATOM 4153 NH1 ARG C 141 5.687 26.341 3.746 1.00 58.11 N ATOM 4154 NH2 ARG C 141 4.580 25.327 5.498 1.00 44.36 N ATOM 4155 N GLU C 142 6.870 24.533 -1.599 1.00 34.21 N ATOM 4156 CA GLU C 142 8.085 24.782 -2.356 1.00 34.95 C ATOM 4157 C GLU C 142 7.901 24.564 -3.847 1.00 33.05 C ATOM 4158 O GLU C 142 8.717 25.023 -4.640 1.00 32.89 O ATOM 4159 CB GLU C 142 9.170 23.833 -1.880 1.00 36.56 C ATOM 4160 CG GLU C 142 10.424 24.482 -1.401 1.00 47.60 C ATOM 4161 CD GLU C 142 10.510 24.462 0.084 1.00 45.90 C ATOM 4162 OE1 GLU C 142 9.612 25.052 0.715 1.00 57.93 O ATOM 4163 OE2 GLU C 142 11.456 23.852 0.615 1.00 39.81 O ATOM 4164 N LYS C 143 6.840 23.866 -4.245 1.00 29.93 N ATOM 4165 CA LYS C 143 6.651 23.579 -5.653 1.00 30.50 C ATOM 4166 C LYS C 143 6.737 24.830 -6.514 1.00 36.16 C ATOM 4167 O LYS C 143 7.354 24.822 -7.579 1.00 33.05 O ATOM 4168 CB LYS C 143 5.306 22.897 -5.887 1.00 34.41 C ATOM 4169 CG LYS C 143 5.218 22.199 -7.239 1.00 36.70 C ATOM 4170 CD LYS C 143 3.830 21.615 -7.473 1.00 39.76 C ATOM 4171 CE LYS C 143 3.716 21.076 -8.876 1.00 42.83 C ATOM 4172 NZ LYS C 143 2.299 21.219 -9.313 1.00 58.00 N ATOM 4173 N LYS C 144 6.106 25.905 -6.053 1.00 43.80 N ATOM 4174 CA LYS C 144 6.114 27.172 -6.789 1.00 49.00 C ATOM 4175 C LYS C 144 7.547 27.594 -7.119 1.00 44.43 C ATOM 4176 O LYS C 144 7.941 27.695 -8.291 1.00 39.88 O ATOM 4177 CB LYS C 144 5.439 28.273 -5.949 1.00 57.77 C ATOM 4178 CG LYS C 144 3.986 28.560 -6.325 1.00 67.79 C ATOM 4179 CD LYS C 144 3.017 28.281 -5.157 1.00 73.77 C ATOM 4180 CE LYS C 144 1.545 28.392 -5.597 1.00 72.08 C ATOM 4181 NZ LYS C 144 0.586 27.882 -4.561 1.00 75.75 N ATOM 4182 N MET C 145 8.316 27.829 -6.062 1.00 42.34 N ATOM 4183 CA MET C 145 9.704 28.248 -6.189 1.00 43.41 C ATOM 4184 C MET C 145 10.571 27.349 -7.041 1.00 39.55 C ATOM 4185 O MET C 145 11.341 27.811 -7.885 1.00 45.73 O ATOM 4186 CB MET C 145 10.302 28.341 -4.809 1.00 45.12 C ATOM 4187 CG MET C 145 9.792 29.516 -4.096 1.00 49.88 C ATOM 4188 SD MET C 145 10.025 29.246 -2.412 1.00 59.44 S ATOM 4189 CE MET C 145 8.358 28.881 -1.954 1.00 40.12 C ATOM 4190 N ARG C 146 10.433 26.053 -6.816 1.00 36.10 N ATOM 4191 CA ARG C 146 11.222 25.074 -7.517 1.00 34.05 C ATOM 4192 C ARG C 146 10.853 24.812 -8.956 1.00 41.67 C ATOM 4193 O ARG C 146 11.714 24.434 -9.754 1.00 48.35 O ATOM 4194 CB ARG C 146 11.188 23.762 -6.740 1.00 25.08 C ATOM 4195 CG ARG C 146 11.637 23.938 -5.319 1.00 27.13 C ATOM 4196 CD ARG C 146 11.585 22.628 -4.557 1.00 27.03 C ATOM 4197 NE ARG C 146 12.300 22.705 -3.293 1.00 30.67 N ATOM 4198 CZ ARG C 146 13.539 22.235 -3.112 1.00 35.31 C ATOM 4199 NH1 ARG C 146 14.186 21.659 -4.107 1.00 24.85 N ATOM 4200 NH2 ARG C 146 14.122 22.331 -1.934 1.00 34.78 N ATOM 4201 N GLU C 147 9.588 24.997 -9.308 1.00 44.29 N ATOM 4202 CA GLU C 147 9.206 24.698 -10.672 1.00 46.48 C ATOM 4203 C GLU C 147 8.231 25.647 -11.326 1.00 45.30 C ATOM 4204 O GLU C 147 7.736 25.360 -12.411 1.00 49.14 O ATOM 4205 CB GLU C 147 8.684 23.266 -10.746 1.00 45.81 C ATOM 4206 CG GLU C 147 7.928 22.818 -9.520 1.00 47.90 C ATOM 4207 CD GLU C 147 7.478 21.384 -9.639 1.00 50.42 C ATOM 4208 OE1 GLU C 147 6.504 21.112 -10.351 1.00 52.72 O ATOM 4209 OE2 GLU C 147 8.102 20.498 -9.046 1.00 50.53 O ATOM 4210 N GLY C 148 7.965 26.775 -10.676 1.00 47.73 N ATOM 4211 CA GLY C 148 7.080 27.777 -11.253 1.00 54.00 C ATOM 4212 C GLY C 148 5.633 27.739 -10.809 1.00 60.00 C ATOM 4213 O GLY C 148 5.140 28.652 -10.115 1.00 60.39 O