>>4LGD:HELIX   74  74 SER E  373  ARG E  411  1                                  39    
SIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALR
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 74 74 SER E 373 ARG E 411 1 39 ATOM 22681 N SER E 373 8.935 -35.095 -21.872 1.00119.96 N ANISOU22681 N SER E 373 15125 13806 16648 25 662 -889 N ATOM 22682 CA SER E 373 8.497 -35.269 -23.254 1.00113.47 C ANISOU22682 CA SER E 373 14209 13025 15879 38 636 -960 C ATOM 22683 C SER E 373 8.512 -36.742 -23.645 1.00125.78 C ANISOU22683 C SER E 373 15733 14588 17468 103 763 -1002 C ATOM 22684 O SER E 373 8.944 -37.596 -22.872 1.00127.78 O ANISOU22684 O SER E 373 16036 14820 17696 139 861 -967 O ATOM 22685 CB SER E 373 9.400 -34.479 -24.202 1.00111.13 C ANISOU22685 CB SER E 373 13853 12874 15498 10 484 -863 C ATOM 22686 OG SER E 373 10.701 -35.040 -24.255 1.00105.87 O ANISOU22686 OG SER E 373 13178 12316 14730 39 488 -748 O ATOM 22687 H SER E 373 9.789 -35.112 -21.774 1.00143.95 H ATOM 22688 HA SER E 373 7.581 -34.934 -23.349 1.00136.17 H ATOM 22689 HB2 SER E 373 9.013 -34.496 -25.092 1.00133.36 H ATOM 22690 HB3 SER E 373 9.464 -33.564 -23.887 1.00133.36 H ATOM 22691 HG SER E 373 11.172 -34.606 -24.767 1.00127.04 H ATOM 22692 N ILE E 374 8.046 -37.035 -24.855 1.00131.93 N ANISOU22692 N ILE E 374 16429 15396 18303 118 758 -1078 N ATOM 22693 CA ILE E 374 7.981 -38.412 -25.329 1.00125.91 C ANISOU22693 CA ILE E 374 15627 14637 17578 179 875 -1129 C ATOM 22694 C ILE E 374 9.369 -39.056 -25.384 1.00114.84 C ANISOU22694 C ILE E 374 14216 13346 16072 214 882 -1007 C ATOM 22695 O ILE E 374 9.588 -40.101 -24.772 1.00123.98 O ANISOU22695 O ILE E 374 15412 14468 17228 260 1000 -1001 O ATOM 22696 CB ILE E 374 7.280 -38.514 -26.706 1.00128.65 C ANISOU22696 CB ILE E 374 15879 15006 17996 183 854 -1226 C ATOM 22697 CG1 ILE E 374 5.765 -38.378 -26.545 1.00133.97 C ANISOU22697 CG1 ILE E 374 16564 15545 18794 170 905 -1374 C ATOM 22698 CG2 ILE E 374 7.609 -39.835 -27.382 1.00130.64 C ANISOU22698 CG2 ILE E 374 16077 15307 18252 243 944 -1241 C ATOM 22699 CD1 ILE E 374 5.241 -36.984 -26.827 1.00134.92 C ANISOU22699 CD1 ILE E 374 16672 15658 18934 111 775 -1395 C ATOM 22700 H ILE E 374 7.762 -36.454 -25.421 1.00158.32 H ATOM 22701 HA ILE E 374 7.445 -38.930 -24.692 1.00151.10 H ATOM 22702 HB ILE E 374 7.598 -37.790 -27.269 1.00154.38 H ATOM 22703 HG12 ILE E 374 5.329 -38.988 -27.160 1.00160.77 H ATOM 22704 HG13 ILE E 374 5.526 -38.605 -25.632 1.00160.77 H ATOM 22705 HG21 ILE E 374 7.163 -39.871 -28.232 1.00156.77 H ATOM 22706 HG22 ILE E 374 8.559 -39.893 -27.509 1.00156.77 H ATOM 22707 HG23 ILE E 374 7.308 -40.555 -26.823 1.00156.77 H ATOM 22708 HD11 ILE E 374 4.289 -36.977 -26.706 1.00161.91 H ATOM 22709 HD12 ILE E 374 5.654 -36.366 -26.219 1.00161.91 H ATOM 22710 HD13 ILE E 374 5.459 -36.746 -27.732 1.00161.91 H ATOM 22711 N PRO E 375 10.314 -38.437 -26.113 1.00 99.98 N ANISOU22711 N PRO E 375 12285 11600 14103 194 756 -910 N ATOM 22712 CA PRO E 375 11.665 -39.010 -26.181 1.00 88.34 C ANISOU22712 CA PRO E 375 10799 10239 12527 227 757 -793 C ATOM 22713 C PRO E 375 12.320 -39.161 -24.811 1.00 84.50 C ANISOU22713 C PRO E 375 10405 9724 11979 235 801 -706 C ATOM 22714 O PRO E 375 12.917 -40.200 -24.534 1.00 90.88 O ANISOU22714 O PRO E 375 11225 10549 12758 286 888 -669 O ATOM 22715 CB PRO E 375 12.438 -37.990 -27.023 1.00 98.62 C ANISOU22715 CB PRO E 375 12047 11678 13748 185 594 -705 C ATOM 22716 CG PRO E 375 11.407 -37.293 -27.819 1.00112.93 C ANISOU22716 CG PRO E 375 13813 13459 15638 149 532 -802 C ATOM 22717 CD PRO E 375 10.188 -37.233 -26.953 1.00109.99 C ANISOU22717 CD PRO E 375 13502 12927 15361 141 608 -905 C ATOM 22718 HA PRO E 375 11.653 -39.876 -26.640 1.00106.00 H ATOM 22719 HB2 PRO E 375 12.901 -37.368 -26.441 1.00118.35 H ATOM 22720 HB3 PRO E 375 13.064 -38.451 -27.602 1.00118.35 H ATOM 22721 HG2 PRO E 375 11.714 -36.399 -28.036 1.00135.52 H ATOM 22722 HG3 PRO E 375 11.225 -37.797 -28.627 1.00135.52 H ATOM 22723 HD2 PRO E 375 10.202 -36.434 -26.403 1.00131.98 H ATOM 22724 HD3 PRO E 375 9.385 -37.280 -27.494 1.00131.98 H ATOM 22725 N GLU E 376 12.221 -38.134 -23.971 1.00 94.70 N ANISOU22725 N GLU E 376 11761 10973 13250 185 740 -672 N ATOM 22726 CA GLU E 376 12.769 -38.210 -22.623 1.00 96.27 C ANISOU22726 CA GLU E 376 12050 11137 13391 187 781 -594 C ATOM 22727 C GLU E 376 12.173 -39.410 -21.899 1.00112.93 C ANISOU22727 C GLU E 376 14207 13129 15570 235 948 -670 C ATOM 22728 O GLU E 376 12.886 -40.350 -21.554 1.00131.52 O ANISOU22728 O GLU E 376 16580 15508 17882 282 1022 -615 O ATOM 22729 CB GLU E 376 12.489 -36.924 -21.843 1.00103.34 C ANISOU22729 CB GLU E 376 13007 11982 14276 123 701 -575 C ATOM 22730 CG GLU E 376 13.341 -35.739 -22.275 1.00118.76 C ANISOU22730 CG GLU E 376 14934 14054 16135 75 537 -468 C ATOM 22731 CD GLU E 376 13.071 -34.487 -21.456 1.00123.67 C ANISOU22731 CD GLU E 376 15621 14622 16746 13 462 -449 C ATOM 22732 OE1 GLU E 376 12.396 -33.570 -21.971 1.00128.33 O ANISOU22732 OE1 GLU E 376 16184 15195 17380 -29 378 -502 O ATOM 22733 OE2 GLU E 376 13.538 -34.416 -20.300 1.00122.69 O ANISOU22733 OE2 GLU E 376 15575 14473 16570 6 485 -380 O ATOM 22734 H GLU E 376 11.842 -37.385 -24.158 1.00113.65 H ATOM 22735 HA GLU E 376 13.740 -38.333 -22.674 1.00115.53 H ATOM 22736 HB2 GLU E 376 11.558 -36.680 -21.968 1.00124.01 H ATOM 22737 HB3 GLU E 376 12.662 -37.085 -20.903 1.00124.01 H ATOM 22738 HG2 GLU E 376 14.277 -35.969 -22.171 1.00142.51 H ATOM 22739 HG3 GLU E 376 13.151 -35.536 -23.205 1.00142.51 H ATOM 22740 N LEU E 377 10.859 -39.376 -21.688 1.00106.08 N ANISOU22740 N LEU E 377 13359 12136 14810 223 1005 -796 N ATOM 22741 CA LEU E 377 10.147 -40.478 -21.047 1.00105.91 C ANISOU22741 CA LEU E 377 13381 11995 14864 263 1165 -883 C ATOM 22742 C LEU E 377 10.571 -41.828 -21.618 1.00117.32 C ANISOU22742 C LEU E 377 14783 13486 16309 329 1253 -885 C ATOM 22743 O LEU E 377 10.701 -42.808 -20.885 1.00120.66 O ANISOU22743 O LEU E 377 15256 13857 16734 369 1369 -880 O ATOM 22744 CB LEU E 377 8.637 -40.302 -21.209 1.00103.45 C ANISOU22744 CB LEU E 377 13061 11568 14676 244 1202 -1035 C ATOM 22745 CG LEU E 377 8.010 -39.169 -20.395 1.00106.43 C ANISOU22745 CG LEU E 377 13498 11864 15075 185 1153 -1057 C ATOM 22746 CD1 LEU E 377 6.542 -39.008 -20.754 1.00 98.70 C ANISOU22746 CD1 LEU E 377 12496 10787 14221 170 1181 -1211 C ATOM 22747 CD2 LEU E 377 8.173 -39.428 -18.906 1.00118.67 C ANISOU22747 CD2 LEU E 377 15152 13337 16599 186 1233 -1019 C ATOM 22748 H LEU E 377 10.352 -38.718 -21.910 1.00127.30 H ATOM 22749 HA LEU E 377 10.352 -40.477 -20.089 1.00127.09 H ATOM 22750 HB2 LEU E 377 8.449 -40.126 -22.144 1.00124.14 H ATOM 22751 HB3 LEU E 377 8.203 -41.127 -20.941 1.00124.14 H ATOM 22752 HG LEU E 377 8.464 -38.338 -20.607 1.00127.71 H ATOM 22753 HD11 LEU E 377 6.169 -38.294 -20.233 1.00118.45 H ATOM 22754 HD12 LEU E 377 6.469 -38.804 -21.689 1.00118.45 H ATOM 22755 HD13 LEU E 377 6.082 -39.829 -20.562 1.00118.45 H ATOM 22756 HD21 LEU E 377 7.773 -38.705 -18.418 1.00142.40 H ATOM 22757 HD22 LEU E 377 7.739 -40.254 -18.683 1.00142.40 H ATOM 22758 HD23 LEU E 377 9.109 -39.483 -18.699 1.00142.40 H ATOM 22759 N GLN E 378 10.784 -41.877 -22.929 1.00118.51 N ANISOU22759 N GLN E 378 14840 13733 16456 340 1197 -891 N ATOM 22760 CA GLN E 378 11.191 -43.112 -23.584 1.00115.25 C ANISOU22760 CA GLN E 378 14375 13370 16043 402 1272 -896 C ATOM 22761 C GLN E 378 12.548 -43.569 -23.061 1.00123.63 C ANISOU22761 C GLN E 378 15468 14508 16999 433 1281 -762 C ATOM 22762 O GLN E 378 12.790 -44.767 -22.906 1.00137.43 O ANISOU22762 O GLN E 378 17223 16241 18752 490 1390 -765 O ATOM 22763 CB GLN E 378 11.247 -42.923 -25.102 1.00120.26 C ANISOU22763 CB GLN E 378 14902 14107 16683 399 1193 -917 C ATOM 22764 CG GLN E 378 11.619 -44.177 -25.875 1.00123.96 C ANISOU22764 CG GLN E 378 15312 14632 17157 461 1268 -931 C ATOM 22765 CD GLN E 378 10.653 -45.321 -25.634 1.00134.02 C ANISOU22765 CD GLN E 378 16605 15784 18534 503 1426 -1052 C ATOM 22766 OE1 GLN E 378 10.527 -45.819 -24.515 1.00128.69 O ANISOU22766 OE1 GLN E 378 16011 15017 17869 520 1521 -1052 O ATOM 22767 NE2 GLN E 378 9.962 -45.743 -26.686 1.00150.11 N ANISOU22767 NE2 GLN E 378 18569 17819 20646 518 1454 -1154 N ATOM 22768 H GLN E 378 10.700 -41.207 -23.461 1.00142.21 H ATOM 22769 HA GLN E 378 10.535 -43.813 -23.387 1.00138.29 H ATOM 22770 HB2 GLN E 378 10.374 -42.634 -25.411 1.00144.31 H ATOM 22771 HB3 GLN E 378 11.908 -42.243 -25.306 1.00144.31 H ATOM 22772 HG2 GLN E 378 11.616 -43.976 -26.824 1.00148.76 H ATOM 22773 HG3 GLN E 378 12.503 -44.468 -25.600 1.00148.76 H ATOM 22774 HE21 GLN E 378 10.075 -45.370 -27.452 1.00180.13 H ATOM 22775 HE22 GLN E 378 9.401 -46.389 -26.601 1.00180.13 H ATOM 22776 N ASN E 379 13.432 -42.613 -22.795 1.00114.29 N ANISOU22776 N ASN E 379 14302 13405 15719 396 1165 -645 N ATOM 22777 CA ASN E 379 14.740 -42.925 -22.230 1.00110.62 C ANISOU22777 CA ASN E 379 13869 13015 15148 421 1162 -512 C ATOM 22778 C ASN E 379 14.611 -43.601 -20.870 1.00 99.18 C ANISOU22778 C ASN E 379 12517 11456 13711 445 1282 -511 C ATOM 22779 O ASN E 379 15.468 -44.391 -20.480 1.00 94.48 O ANISOU22779 O ASN E 379 11943 10895 13060 489 1334 -438 O ATOM 22780 CB ASN E 379 15.594 -41.661 -22.089 1.00105.93 C ANISOU22780 CB ASN E 379 13283 12514 14452 368 1015 -394 C ATOM 22781 CG ASN E 379 15.911 -41.016 -23.423 1.00101.84 C ANISOU22781 CG ASN E 379 12670 12119 13905 343 891 -376 C ATOM 22782 OD1 ASN E 379 15.608 -39.845 -23.647 1.00105.89 O ANISOU22782 OD1 ASN E 379 13175 12641 14417 285 784 -379 O ATOM 22783 ND2 ASN E 379 16.530 -41.778 -24.315 1.00110.93 N ANISOU22783 ND2 ASN E 379 13751 13366 15032 387 904 -356 N ATOM 22784 H ASN E 379 13.299 -41.774 -22.932 1.00137.15 H ATOM 22785 HA ASN E 379 15.208 -43.541 -22.831 1.00132.75 H ATOM 22786 HB2 ASN E 379 15.113 -41.013 -21.550 1.00127.12 H ATOM 22787 HB3 ASN E 379 16.433 -41.892 -21.661 1.00127.12 H ATOM 22788 HD21 ASN E 379 16.730 -42.592 -24.121 1.00133.12 H ATOM 22789 HD22 ASN E 379 16.732 -41.459 -25.087 1.00133.12 H ATOM 22790 N PHE E 380 13.539 -43.286 -20.151 1.00109.71 N ANISOU22790 N PHE E 380 13909 12660 15117 415 1325 -593 N ATOM 22791 CA PHE E 380 13.330 -43.835 -18.816 1.00114.17 C ANISOU22791 CA PHE E 380 14570 13114 15695 429 1436 -597 C ATOM 22792 C PHE E 380 12.821 -45.270 -18.873 1.00109.34 C ANISOU22792 C PHE E 380 13958 12430 15158 490 1588 -683 C ATOM 22793 O PHE E 380 13.277 -46.123 -18.113 1.00118.31 O ANISOU22793 O PHE E 380 15147 13539 16266 529 1675 -640 O ATOM 22794 CB PHE E 380 12.358 -42.961 -18.024 1.00110.11 C ANISOU22794 CB PHE E 380 14118 12489 15231 373 1426 -657 C ATOM 22795 CG PHE E 380 12.880 -41.582 -17.745 1.00106.56 C ANISOU22795 CG PHE E 380 13687 12097 14706 314 1287 -566 C ATOM 22796 CD1 PHE E 380 13.566 -41.309 -16.578 1.00101.85 C ANISOU22796 CD1 PHE E 380 13170 11497 14031 298 1279 -466 C ATOM 22797 CD2 PHE E 380 12.691 -40.562 -18.657 1.00116.52 C ANISOU22797 CD2 PHE E 380 14886 13416 15972 272 1164 -581 C ATOM 22798 CE1 PHE E 380 14.048 -40.040 -16.325 1.00 91.54 C ANISOU22798 CE1 PHE E 380 11881 10245 12655 243 1151 -384 C ATOM 22799 CE2 PHE E 380 13.171 -39.292 -18.410 1.00110.88 C ANISOU22799 CE2 PHE E 380 14189 12754 15188 217 1036 -498 C ATOM 22800 CZ PHE E 380 13.851 -39.032 -17.240 1.00 88.01 C ANISOU22800 CZ PHE E 380 11373 9853 12214 202 1030 -400 C ATOM 22801 H PHE E 380 12.916 -42.754 -20.414 1.00131.66 H ATOM 22802 HA PHE E 380 14.186 -43.840 -18.339 1.00137.00 H ATOM 22803 HB2 PHE E 380 11.535 -42.870 -18.530 1.00132.13 H ATOM 22804 HB3 PHE E 380 12.175 -43.387 -17.173 1.00132.13 H ATOM 22805 HD1 PHE E 380 13.702 -41.986 -15.955 1.00122.22 H ATOM 22806 HD2 PHE E 380 12.232 -40.732 -19.448 1.00139.83 H ATOM 22807 HE1 PHE E 380 14.507 -39.866 -15.535 1.00109.85 H ATOM 22808 HE2 PHE E 380 13.035 -38.614 -19.031 1.00133.06 H ATOM 22809 HZ PHE E 380 14.176 -38.177 -17.070 1.00105.61 H ATOM 22810 N LEU E 381 11.873 -45.532 -19.768 1.00110.91 N ANISOU22810 N LEU E 381 14097 12595 15450 497 1619 -804 N ATOM 22811 CA LEU E 381 11.398 -46.894 -19.983 1.00110.83 C ANISOU22811 CA LEU E 381 14074 12525 15510 553 1758 -890 C ATOM 22812 C LEU E 381 12.575 -47.782 -20.360 1.00107.74 C ANISOU22812 C LEU E 381 13651 12235 15051 611 1775 -803 C ATOM 22813 O LEU E 381 12.696 -48.909 -19.881 1.00114.71 O ANISOU22813 O LEU E 381 14571 13070 15944 661 1892 -806 O ATOM 22814 CB LEU E 381 10.345 -46.937 -21.092 1.00108.44 C ANISOU22814 CB LEU E 381 13696 12200 15307 549 1765 -1022 C ATOM 22815 CG LEU E 381 9.025 -46.210 -20.829 1.00112.13 C ANISOU22815 CG LEU E 381 14186 12558 15861 500 1762 -1131 C ATOM 22816 CD1 LEU E 381 8.113 -46.322 -22.040 1.00124.36 C ANISOU22816 CD1 LEU E 381 15650 14103 17500 502 1765 -1253 C ATOM 22817 CD2 LEU E 381 8.332 -46.759 -19.593 1.00 99.99 C ANISOU22817 CD2 LEU E 381 12741 10875 14374 505 1891 -1188 C ATOM 22818 H LEU E 381 11.490 -44.942 -20.261 1.00133.10 H ATOM 22819 HA LEU E 381 10.997 -47.238 -19.157 1.00132.99 H ATOM 22820 HB2 LEU E 381 10.732 -46.546 -21.890 1.00130.13 H ATOM 22821 HB3 LEU E 381 10.128 -47.867 -21.265 1.00130.13 H ATOM 22822 HG LEU E 381 9.207 -45.269 -20.678 1.00134.56 H ATOM 22823 HD11 LEU E 381 7.292 -45.860 -21.857 1.00149.24 H ATOM 22824 HD12 LEU E 381 8.550 -45.926 -22.798 1.00149.24 H ATOM 22825 HD13 LEU E 381 7.936 -47.250 -22.213 1.00149.24 H ATOM 22826 HD21 LEU E 381 7.510 -46.281 -19.458 1.00119.98 H ATOM 22827 HD22 LEU E 381 8.151 -47.692 -19.724 1.00119.98 H ATOM 22828 HD23 LEU E 381 8.908 -46.640 -18.834 1.00119.98 H ATOM 22829 N THR E 382 13.444 -47.260 -21.220 1.00 96.67 N ANISOU22829 N THR E 382 12180 10973 13578 604 1658 -725 N ATOM 22830 CA THR E 382 14.625 -47.989 -21.667 1.00 94.08 C ANISOU22830 CA THR E 382 11811 10757 13178 656 1659 -638 C ATOM 22831 C THR E 382 15.561 -48.311 -20.505 1.00 99.08 C ANISOU22831 C THR E 382 12524 11392 13732 677 1690 -526 C ATOM 22832 O THR E 382 16.119 -49.405 -20.435 1.00113.88 O ANISOU22832 O THR E 382 14400 13281 15588 737 1769 -497 O ATOM 22833 CB THR E 382 15.403 -47.185 -22.725 1.00 98.44 C ANISOU22833 CB THR E 382 12280 11463 13661 632 1514 -569 C ATOM 22834 OG1 THR E 382 14.658 -47.155 -23.949 1.00103.33 O ANISOU22834 OG1 THR E 382 12815 12094 14351 626 1498 -670 O ATOM 22835 CG2 THR E 382 16.769 -47.807 -22.984 1.00 91.53 C ANISOU22835 CG2 THR E 382 11374 10709 12694 680 1504 -460 C ATOM 22836 H THR E 382 13.370 -46.475 -21.563 1.00116.01 H ATOM 22837 HA THR E 382 14.344 -48.835 -22.074 1.00112.90 H ATOM 22838 HB THR E 382 15.535 -46.278 -22.406 1.00118.13 H ATOM 22839 HG1 THR E 382 13.928 -46.802 -23.826 1.00123.99 H ATOM 22840 HG21 THR E 382 17.242 -47.296 -23.644 1.00109.84 H ATOM 22841 HG22 THR E 382 17.283 -47.820 -22.172 1.00109.84 H ATOM 22842 HG23 THR E 382 16.665 -48.707 -23.301 1.00109.84 H ATOM 22843 N ILE E 383 15.733 -47.353 -19.600 1.00102.31 N ANISOU22843 N ILE E 383 12997 11784 14091 629 1628 -463 N ATOM 22844 CA ILE E 383 16.604 -47.541 -18.445 1.00 99.98 C ANISOU22844 CA ILE E 383 12780 11491 13717 642 1648 -353 C ATOM 22845 C ILE E 383 16.035 -48.587 -17.488 1.00 99.27 C ANISOU22845 C ILE E 383 12769 11266 13685 677 1802 -409 C ATOM 22846 O ILE E 383 16.775 -49.417 -16.956 1.00 88.66 O ANISOU22846 O ILE E 383 11460 9930 12295 724 1862 -342 O ATOM 22847 CB ILE E 383 16.825 -46.216 -17.689 1.00 90.96 C ANISOU22847 CB ILE E 383 11690 10356 12514 576 1546 -281 C ATOM 22848 CG1 ILE E 383 17.692 -45.275 -18.524 1.00 98.10 C ANISOU22848 CG1 ILE E 383 12525 11411 13336 547 1393 -196 C ATOM 22849 CG2 ILE E 383 17.501 -46.468 -16.353 1.00 92.61 C ANISOU22849 CG2 ILE E 383 11992 10539 12657 587 1587 -188 C ATOM 22850 CD1 ILE E 383 17.754 -43.860 -17.998 1.00101.39 C ANISOU22850 CD1 ILE E 383 12981 11836 13706 475 1281 -143 C ATOM 22851 H ILE E 383 15.354 -46.582 -19.632 1.00122.77 H ATOM 22852 HA ILE E 383 17.477 -47.860 -18.755 1.00119.98 H ATOM 22853 HB ILE E 383 15.964 -45.796 -17.532 1.00109.15 H ATOM 22854 HG12 ILE E 383 18.598 -45.622 -18.545 1.00117.72 H ATOM 22855 HG13 ILE E 383 17.334 -45.240 -19.425 1.00117.72 H ATOM 22856 HG21 ILE E 383 17.626 -45.629 -15.903 1.00111.13 H ATOM 22857 HG22 ILE E 383 16.943 -47.043 -15.824 1.00111.13 H ATOM 22858 HG23 ILE E 383 18.351 -46.887 -16.507 1.00111.13 H ATOM 22859 HD11 ILE E 383 18.315 -43.337 -18.575 1.00121.67 H ATOM 22860 HD12 ILE E 383 16.866 -43.494 -17.982 1.00121.67 H ATOM 22861 HD13 ILE E 383 18.119 -43.874 -17.110 1.00121.67 H ATOM 22862 N LEU E 384 14.723 -48.545 -17.275 1.00 96.19 N ANISOU22862 N LEU E 384 12404 10750 13395 654 1864 -532 N ATOM 22863 CA LEU E 384 14.060 -49.510 -16.401 1.00 95.84 C ANISOU22863 CA LEU E 384 12433 10570 13412 681 2012 -597 C ATOM 22864 C LEU E 384 14.125 -50.918 -16.990 1.00 96.18 C ANISOU22864 C LEU E 384 12437 10614 13492 752 2115 -638 C ATOM 22865 O LEU E 384 14.271 -51.897 -16.259 1.00 91.59 O ANISOU22865 O LEU E 384 11915 9973 12913 793 2222 -626 O ATOM 22866 CB LEU E 384 12.604 -49.103 -16.155 1.00 91.71 C ANISOU22866 CB LEU E 384 11936 9920 12990 637 2049 -728 C ATOM 22867 CG LEU E 384 12.391 -47.974 -15.142 1.00109.16 C ANISOU22867 CG LEU E 384 14218 12082 15177 572 1993 -700 C ATOM 22868 CD1 LEU E 384 10.939 -47.519 -15.132 1.00118.21 C ANISOU22868 CD1 LEU E 384 15369 13117 16427 530 2017 -837 C ATOM 22869 CD2 LEU E 384 12.818 -48.411 -13.747 1.00 96.99 C ANISOU22869 CD2 LEU E 384 12779 10483 13589 583 2064 -632 C ATOM 22870 H LEU E 384 14.192 -47.966 -17.625 1.00115.43 H ATOM 22871 HA LEU E 384 14.520 -49.523 -15.536 1.00115.01 H ATOM 22872 HB2 LEU E 384 12.221 -48.813 -16.998 1.00110.05 H ATOM 22873 HB3 LEU E 384 12.121 -49.879 -15.830 1.00110.05 H ATOM 22874 HG LEU E 384 12.939 -47.215 -15.398 1.00130.99 H ATOM 22875 HD11 LEU E 384 10.838 -46.813 -14.490 1.00141.85 H ATOM 22876 HD12 LEU E 384 10.705 -47.202 -16.008 1.00141.85 H ATOM 22877 HD13 LEU E 384 10.381 -48.263 -14.893 1.00141.85 H ATOM 22878 HD21 LEU E 384 12.674 -47.685 -13.135 1.00116.38 H ATOM 22879 HD22 LEU E 384 12.294 -49.171 -13.484 1.00116.38 H ATOM 22880 HD23 LEU E 384 13.749 -48.644 -13.765 1.00116.38 H ATOM 22881 N GLU E 385 14.019 -51.015 -18.310 1.00 88.96 N ANISOU22881 N GLU E 385 11425 9769 12608 766 2082 -685 N ATOM 22882 CA GLU E 385 14.142 -52.300 -18.984 1.00 89.09 C ANISOU22882 CA GLU E 385 11395 9799 12655 833 2170 -721 C ATOM 22883 C GLU E 385 15.578 -52.806 -18.896 1.00 96.73 C ANISOU22883 C GLU E 385 12359 10869 13524 881 2154 -590 C ATOM 22884 O GLU E 385 15.813 -53.979 -18.618 1.00100.73 O ANISOU22884 O GLU E 385 12891 11344 14039 939 2258 -588 O ATOM 22885 CB GLU E 385 13.706 -52.189 -20.445 1.00 91.93 C ANISOU22885 CB GLU E 385 11648 10216 13067 831 2128 -801 C ATOM 22886 CG GLU E 385 12.216 -51.937 -20.622 1.00116.03 C ANISOU22886 CG GLU E 385 14696 13160 16230 797 2165 -946 C ATOM 22887 CD GLU E 385 11.816 -51.794 -22.077 1.00137.39 C ANISOU22887 CD GLU E 385 17294 15927 18982 793 2118 -1020 C ATOM 22888 OE1 GLU E 385 12.474 -52.414 -22.939 1.00159.20 O ANISOU22888 OE1 GLU E 385 19989 18781 21718 837 2116 -993 O ATOM 22889 OE2 GLU E 385 10.844 -51.060 -22.358 1.00125.56 O ANISOU22889 OE2 GLU E 385 15778 14384 17544 747 2082 -1104 O ATOM 22890 H GLU E 385 13.876 -50.352 -18.839 1.00106.76 H ATOM 22891 HA GLU E 385 13.561 -52.953 -18.541 1.00106.90 H ATOM 22892 HB2 GLU E 385 14.182 -51.452 -20.858 1.00110.32 H ATOM 22893 HB3 GLU E 385 13.923 -53.018 -20.900 1.00110.32 H ATOM 22894 HG2 GLU E 385 11.722 -52.683 -20.247 1.00139.23 H ATOM 22895 HG3 GLU E 385 11.977 -51.117 -20.163 1.00139.23 H ATOM 22896 N LYS E 386 16.536 -51.914 -19.124 1.00107.06 N ANISOU22896 N LYS E 386 13639 12302 14739 856 2023 -482 N ATOM 22897 CA LYS E 386 17.946 -52.269 -19.021 1.00105.90 C ANISOU22897 CA LYS E 386 13486 12260 14490 897 1995 -352 C ATOM 22898 C LYS E 386 18.276 -52.741 -17.607 1.00101.76 C ANISOU22898 C LYS E 386 13068 11663 13934 916 2069 -292 C ATOM 22899 O LYS E 386 19.171 -53.561 -17.411 1.00103.23 O ANISOU22899 O LYS E 386 13263 11890 14070 971 2107 -219 O ATOM 22900 CB LYS E 386 18.827 -51.075 -19.390 1.00122.14 C ANISOU22900 CB LYS E 386 15502 14454 16452 854 1836 -250 C ATOM 22901 CG LYS E 386 20.321 -51.355 -19.312 1.00132.72 C ANISOU22901 CG LYS E 386 16832 15914 17683 892 1798 -113 C ATOM 22902 CD LYS E 386 20.744 -52.411 -20.319 1.00154.29 C ANISOU22902 CD LYS E 386 19484 18715 20424 958 1840 -128 C ATOM 22903 CE LYS E 386 22.228 -52.720 -20.213 1.00171.24 C ANISOU22903 CE LYS E 386 21621 20979 22464 998 1805 5 C ATOM 22904 NZ LYS E 386 22.646 -53.790 -21.161 1.00177.49 N ANISOU22904 NZ LYS E 386 22336 21835 23266 1065 1851 -13 N ATOM 22905 H LYS E 386 16.395 -51.094 -19.341 1.00128.48 H ATOM 22906 HA LYS E 386 18.142 -53.001 -19.643 1.00127.08 H ATOM 22907 HB2 LYS E 386 18.624 -50.808 -20.301 1.00146.57 H ATOM 22908 HB3 LYS E 386 18.632 -50.344 -18.783 1.00146.57 H ATOM 22909 HG2 LYS E 386 20.810 -50.540 -19.504 1.00159.27 H ATOM 22910 HG3 LYS E 386 20.540 -51.677 -18.424 1.00159.27 H ATOM 22911 HD2 LYS E 386 20.251 -53.230 -20.151 1.00185.15 H ATOM 22912 HD3 LYS E 386 20.564 -52.089 -21.216 1.00185.15 H ATOM 22913 HE2 LYS E 386 22.735 -51.919 -20.419 1.00205.49 H ATOM 22914 HE3 LYS E 386 22.428 -53.019 -19.312 1.00205.49 H ATOM 22915 HZ1 LYS E 386 23.518 -53.949 -21.076 1.00212.98 H ATOM 22916 HZ2 LYS E 386 22.198 -54.540 -20.989 1.00212.98 H ATOM 22917 HZ3 LYS E 386 22.478 -53.538 -21.998 1.00212.98 H ATOM 22918 N GLU E 387 17.550 -52.215 -16.624 1.00115.11 N ANISOU22918 N GLU E 387 14838 13246 15651 869 2088 -321 N ATOM 22919 CA GLU E 387 17.745 -52.605 -15.230 1.00123.37 C ANISOU22919 CA GLU E 387 15991 14213 16671 880 2160 -272 C ATOM 22920 C GLU E 387 17.070 -53.943 -14.948 1.00122.03 C ANISOU22920 C GLU E 387 15858 13925 16583 929 2319 -359 C ATOM 22921 O GLU E 387 17.576 -54.754 -14.173 1.00131.20 O ANISOU22921 O GLU E 387 17079 15056 17713 970 2392 -305 O ATOM 22922 CB GLU E 387 17.185 -51.533 -14.290 1.00131.83 C ANISOU22922 CB GLU E 387 17134 15212 17743 808 2124 -276 C ATOM 22923 CG GLU E 387 17.469 -51.796 -12.813 1.00147.46 C ANISOU22923 CG GLU E 387 19225 17121 19683 811 2183 -213 C ATOM 22924 CD GLU E 387 16.792 -50.795 -11.889 1.00157.21 C ANISOU22924 CD GLU E 387 20529 18273 20929 739 2159 -234 C ATOM 22925 OE1 GLU E 387 16.946 -50.926 -10.656 1.00157.97 O ANISOU22925 OE1 GLU E 387 20719 18307 20995 733 2205 -187 O ATOM 22926 OE2 GLU E 387 16.109 -49.880 -12.393 1.00155.48 O ANISOU22926 OE2 GLU E 387 20273 18052 20750 690 2093 -297 O ATOM 22927 H GLU E 387 16.933 -51.627 -16.739 1.00138.13 H ATOM 22928 HA GLU E 387 18.704 -52.701 -15.052 1.00148.04 H ATOM 22929 HB2 GLU E 387 17.582 -50.679 -14.520 1.00158.19 H ATOM 22930 HB3 GLU E 387 16.223 -51.490 -14.404 1.00158.19 H ATOM 22931 HG2 GLU E 387 17.145 -52.681 -12.583 1.00176.96 H ATOM 22932 HG3 GLU E 387 18.425 -51.743 -12.662 1.00176.96 H ATOM 22933 N GLU E 388 15.923 -54.165 -15.583 1.00119.79 N ANISOU22933 N GLU E 388 15537 13574 16402 924 2371 -495 N ATOM 22934 CA GLU E 388 15.167 -55.400 -15.409 1.00117.79 C ANISOU22934 CA GLU E 388 15314 13206 16235 965 2521 -591 C ATOM 22935 C GLU E 388 15.943 -56.595 -15.954 1.00112.95 C ANISOU22935 C GLU E 388 14661 12653 15603 1043 2572 -558 C ATOM 22936 O GLU E 388 16.125 -57.597 -15.264 1.00110.28 O ANISOU22936 O GLU E 388 14383 12254 15266 1087 2674 -542 O ATOM 22937 CB GLU E 388 13.818 -55.291 -16.123 1.00126.68 C ANISOU22937 CB GLU E 388 16395 14265 17471 940 2551 -743 C ATOM 22938 CG GLU E 388 12.901 -56.484 -15.914 1.00137.44 C ANISOU22938 CG GLU E 388 17791 15500 18928 974 2707 -855 C ATOM 22939 CD GLU E 388 11.655 -56.420 -16.777 1.00146.99 C ANISOU22939 CD GLU E 388 18944 16663 20244 955 2731 -1003 C ATOM 22940 OE1 GLU E 388 10.642 -57.051 -16.407 1.00150.60 O ANISOU22940 OE1 GLU E 388 19441 16993 20785 957 2848 -1108 O ATOM 22941 OE2 GLU E 388 11.689 -55.745 -17.828 1.00143.92 O ANISOU22941 OE2 GLU E 388 18467 16362 19853 936 2633 -1013 O ATOM 22942 H GLU E 388 15.558 -53.608 -16.127 1.00143.74 H ATOM 22943 HA GLU E 388 15.001 -55.548 -14.455 1.00141.35 H ATOM 22944 HB2 GLU E 388 13.356 -54.503 -15.796 1.00152.01 H ATOM 22945 HB3 GLU E 388 13.977 -55.206 -17.076 1.00152.01 H ATOM 22946 HG2 GLU E 388 13.381 -57.296 -16.139 1.00164.92 H ATOM 22947 HG3 GLU E 388 12.623 -56.510 -14.985 1.00164.92 H ATOM 22948 N GLN E 389 16.399 -56.481 -17.197 1.00108.89 N ANISOU22948 N GLN E 389 14044 12258 15072 1058 2501 -548 N ATOM 22949 CA GLN E 389 17.131 -57.561 -17.843 1.00117.85 C ANISOU22949 CA GLN E 389 15129 13459 16191 1131 2541 -522 C ATOM 22950 C GLN E 389 18.409 -57.887 -17.077 1.00138.00 C ANISOU22950 C GLN E 389 17728 16061 18644 1168 2534 -383 C ATOM 22951 O GLN E 389 18.838 -59.040 -17.035 1.00160.97 O ANISOU22951 O GLN E 389 20644 18964 21553 1234 2615 -367 O ATOM 22952 CB GLN E 389 17.478 -57.192 -19.290 1.00122.73 C ANISOU22952 CB GLN E 389 15627 14211 16795 1131 2446 -524 C ATOM 22953 CG GLN E 389 16.291 -56.767 -20.155 1.00149.51 C ANISOU22953 CG GLN E 389 18962 17569 20277 1092 2436 -654 C ATOM 22954 CD GLN E 389 15.249 -57.857 -20.325 1.00181.53 C ANISOU22954 CD GLN E 389 23022 21510 24442 1125 2576 -786 C ATOM 22955 OE1 GLN E 389 14.937 -58.590 -19.387 1.00197.44 O ANISOU22955 OE1 GLN E 389 25119 23414 26485 1146 2686 -806 O ATOM 22956 NE2 GLN E 389 14.703 -57.967 -21.530 1.00189.41 N ANISOU22956 NE2 GLN E 389 23932 22535 25500 1126 2572 -878 N ATOM 22957 H GLN E 389 16.296 -55.784 -17.690 1.00130.67 H ATOM 22958 HA GLN E 389 16.571 -58.365 -17.859 1.00141.42 H ATOM 22959 HB2 GLN E 389 18.108 -56.454 -19.277 1.00147.28 H ATOM 22960 HB3 GLN E 389 17.888 -57.961 -19.715 1.00147.28 H ATOM 22961 HG2 GLN E 389 15.858 -56.003 -19.742 1.00179.41 H ATOM 22962 HG3 GLN E 389 16.615 -56.526 -21.037 1.00179.41 H ATOM 22963 HE21 GLN E 389 14.945 -57.436 -22.162 1.00227.29 H ATOM 22964 HE22 GLN E 389 14.107 -58.569 -21.679 1.00227.29 H ATOM 22965 N ASP E 390 19.014 -56.872 -16.468 1.00129.58 N ANISOU22965 N ASP E 390 16695 15046 17496 1125 2435 -283 N ATOM 22966 CA ASP E 390 20.270 -57.060 -15.751 1.00132.32 C ANISOU22966 CA ASP E 390 17083 15451 17741 1155 2415 -144 C ATOM 22967 C ASP E 390 20.066 -57.691 -14.379 1.00132.43 C ANISOU22967 C ASP E 390 17212 15339 17765 1170 2521 -134 C ATOM 22968 O ASP E 390 21.031 -58.085 -13.725 1.00143.82 O ANISOU22968 O ASP E 390 18697 16813 19137 1205 2528 -30 O ATOM 22969 CB ASP E 390 21.009 -55.730 -15.606 1.00152.46 C ANISOU22969 CB ASP E 390 19626 18104 20197 1102 2269 -39 C ATOM 22970 CG ASP E 390 21.692 -55.301 -16.891 1.00181.22 C ANISOU22970 CG ASP E 390 23157 21902 23796 1103 2160 -5 C ATOM 22971 OD1 ASP E 390 21.783 -54.080 -17.138 1.00193.36 O ANISOU22971 OD1 ASP E 390 24669 23504 25296 1044 2042 24 O ATOM 22972 OD2 ASP E 390 22.138 -56.186 -17.654 1.00184.38 O ANISOU22972 OD2 ASP E 390 23497 22360 24200 1163 2193 -9 O ATOM 22973 H ASP E 390 18.718 -56.065 -16.456 1.00155.50 H ATOM 22974 HA ASP E 390 20.841 -57.662 -16.272 1.00158.78 H ATOM 22975 HB2 ASP E 390 20.374 -55.040 -15.359 1.00182.95 H ATOM 22976 HB3 ASP E 390 21.689 -55.818 -14.920 1.00182.95 H ATOM 22977 N LYS E 391 18.814 -57.782 -13.942 1.00131.83 N ANISOU22977 N LYS E 391 17187 15125 17777 1142 2602 -243 N ATOM 22978 CA LYS E 391 18.502 -58.441 -12.678 1.00131.95 C ANISOU22978 CA LYS E 391 17312 15012 17810 1153 2713 -247 C ATOM 22979 C LYS E 391 17.803 -59.781 -12.903 1.00143.32 C ANISOU22979 C LYS E 391 18756 16357 19342 1205 2856 -351 C ATOM 22980 O LYS E 391 17.852 -60.665 -12.048 1.00146.01 O ANISOU22980 O LYS E 391 19175 16617 19687 1238 2955 -337 O ATOM 22981 CB LYS E 391 17.662 -57.529 -11.783 1.00114.98 C ANISOU22981 CB LYS E 391 15235 12771 15683 1079 2704 -282 C ATOM 22982 CG LYS E 391 18.476 -56.426 -11.120 1.00124.56 C ANISOU22982 CG LYS E 391 16480 14053 16794 1035 2591 -160 C ATOM 22983 CD LYS E 391 17.666 -55.675 -10.078 1.00135.96 C ANISOU22983 CD LYS E 391 18008 15393 18260 967 2599 -193 C ATOM 22984 CE LYS E 391 18.488 -54.585 -9.408 1.00148.02 C ANISOU22984 CE LYS E 391 19568 16990 19684 923 2488 -70 C ATOM 22985 NZ LYS E 391 17.676 -53.769 -8.462 1.00159.54 N ANISOU22985 NZ LYS E 391 21101 18351 21165 853 2489 -108 N ATOM 22986 H LYS E 391 18.129 -57.470 -14.357 1.00158.20 H ATOM 22987 HA LYS E 391 19.342 -58.623 -12.207 1.00158.34 H ATOM 22988 HB2 LYS E 391 16.973 -57.109 -12.321 1.00137.98 H ATOM 22989 HB3 LYS E 391 17.256 -58.063 -11.083 1.00137.98 H ATOM 22990 HG2 LYS E 391 19.246 -56.818 -10.680 1.00149.47 H ATOM 22991 HG3 LYS E 391 18.763 -55.791 -11.795 1.00149.47 H ATOM 22992 HD2 LYS E 391 16.902 -55.259 -10.506 1.00163.16 H ATOM 22993 HD3 LYS E 391 17.370 -56.296 -9.394 1.00163.16 H ATOM 22994 HE2 LYS E 391 19.211 -54.995 -8.908 1.00177.63 H ATOM 22995 HE3 LYS E 391 18.845 -53.993 -10.088 1.00177.63 H ATOM 22996 HZ1 LYS E 391 18.185 -53.142 -8.088 1.00191.45 H ATOM 22997 HZ2 LYS E 391 17.007 -53.376 -8.897 1.00191.45 H ATOM 22998 HZ3 LYS E 391 17.340 -54.289 -7.822 1.00191.45 H ATOM 22999 N ILE E 392 17.160 -59.932 -14.056 1.00134.57 N ANISOU22999 N ILE E 392 17566 15260 18307 1210 2865 -454 N ATOM 23000 CA ILE E 392 16.621 -61.225 -14.454 1.00112.88 C ANISOU23000 CA ILE E 392 14807 12443 15640 1263 2991 -547 C ATOM 23001 C ILE E 392 17.774 -62.160 -14.792 1.00112.42 C ANISOU23001 C ILE E 392 14717 12466 15530 1340 3004 -467 C ATOM 23002 O ILE E 392 17.677 -63.372 -14.610 1.00123.37 O ANISOU23002 O ILE E 392 16135 13786 16955 1395 3119 -497 O ATOM 23003 CB ILE E 392 15.685 -61.099 -15.671 1.00104.38 C ANISOU23003 CB ILE E 392 13642 11367 14650 1248 2988 -675 C ATOM 23004 CG1 ILE E 392 14.292 -60.653 -15.221 1.00109.65 C ANISOU23004 CG1 ILE E 392 14356 11909 15399 1188 3031 -788 C ATOM 23005 CG2 ILE E 392 15.595 -62.424 -16.416 1.00 98.60 C ANISOU23005 CG2 ILE E 392 12866 10625 13973 1316 3085 -737 C ATOM 23006 CD1 ILE E 392 13.282 -60.548 -16.346 1.00114.91 C ANISOU23006 CD1 ILE E 392 14940 12564 16155 1172 3035 -920 C ATOM 23007 H ILE E 392 17.022 -59.302 -14.625 1.00161.49 H ATOM 23008 HA ILE E 392 16.113 -61.611 -13.710 1.00135.46 H ATOM 23009 HB ILE E 392 16.046 -60.429 -16.273 1.00125.25 H ATOM 23010 HG12 ILE E 392 13.952 -61.294 -14.577 1.00131.59 H ATOM 23011 HG13 ILE E 392 14.364 -59.779 -14.806 1.00131.59 H ATOM 23012 HG21 ILE E 392 15.008 -62.319 -17.169 1.00118.32 H ATOM 23013 HG22 ILE E 392 16.472 -62.673 -16.717 1.00118.32 H ATOM 23014 HG23 ILE E 392 15.250 -63.093 -15.822 1.00118.32 H ATOM 23015 HD11 ILE E 392 12.439 -60.265 -15.984 1.00137.89 H ATOM 23016 HD12 ILE E 392 13.595 -59.907 -16.988 1.00137.89 H ATOM 23017 HD13 ILE E 392 13.187 -61.408 -16.762 1.00137.89 H ATOM 23018 N GLN E 393 18.868 -61.588 -15.285 1.00113.97 N ANISOU23018 N GLN E 393 14855 12809 15641 1345 2887 -365 N ATOM 23019 CA GLN E 393 20.052 -62.369 -15.625 1.00122.20 C ANISOU23019 CA GLN E 393 15861 13943 16626 1416 2886 -281 C ATOM 23020 C GLN E 393 20.984 -62.522 -14.429 1.00128.09 C ANISOU23020 C GLN E 393 16692 14689 17288 1436 2887 -155 C ATOM 23021 O GLN E 393 21.895 -63.347 -14.447 1.00132.38 O ANISOU23021 O GLN E 393 17229 15279 17791 1501 2911 -88 O ATOM 23022 CB GLN E 393 20.804 -61.729 -16.795 1.00133.46 C ANISOU23022 CB GLN E 393 17176 15534 18000 1412 2760 -236 C ATOM 23023 CG GLN E 393 20.382 -62.261 -18.156 1.00149.64 C ANISOU23023 CG GLN E 393 19127 17613 20117 1440 2787 -335 C ATOM 23024 CD GLN E 393 21.124 -61.598 -19.300 1.00161.25 C ANISOU23024 CD GLN E 393 20488 19247 21532 1431 2661 -289 C ATOM 23025 OE1 GLN E 393 21.539 -60.442 -19.200 1.00167.31 O ANISOU23025 OE1 GLN E 393 21249 20088 22232 1380 2544 -219 O ATOM 23026 NE2 GLN E 393 21.297 -62.330 -20.395 1.00155.04 N ANISOU23026 NE2 GLN E 393 19617 18518 20771 1479 2685 -329 N ATOM 23027 H GLN E 393 18.951 -60.745 -15.431 1.00136.77 H ATOM 23028 HA GLN E 393 19.771 -63.265 -15.903 1.00146.64 H ATOM 23029 HB2 GLN E 393 20.641 -60.773 -16.786 1.00160.16 H ATOM 23030 HB3 GLN E 393 21.752 -61.903 -16.689 1.00160.16 H ATOM 23031 HG2 GLN E 393 20.563 -63.213 -18.193 1.00179.57 H ATOM 23032 HG3 GLN E 393 19.434 -62.098 -18.279 1.00179.57 H ATOM 23033 HE21 GLN E 393 20.995 -63.134 -20.427 1.00186.04 H ATOM 23034 HE22 GLN E 393 21.712 -61.999 -21.072 1.00186.04 H ATOM 23035 N GLN E 394 20.758 -61.725 -13.391 1.00133.04 N ANISOU23035 N GLN E 394 17397 15264 17889 1379 2861 -124 N ATOM 23036 CA GLN E 394 21.550 -61.833 -12.174 1.00143.09 C ANISOU23036 CA GLN E 394 18758 16526 19084 1391 2865 -8 C ATOM 23037 C GLN E 394 21.061 -63.017 -11.348 1.00137.71 C ANISOU23037 C GLN E 394 18164 15703 18456 1429 3013 -51 C ATOM 23038 O GLN E 394 21.828 -63.631 -10.606 1.00128.91 O ANISOU23038 O GLN E 394 17106 14584 17289 1471 3045 36 O ATOM 23039 CB GLN E 394 21.463 -60.540 -11.360 1.00156.99 C ANISOU23039 CB GLN E 394 20570 18280 20798 1314 2785 38 C ATOM 23040 CG GLN E 394 22.436 -60.473 -10.192 1.00167.73 C ANISOU23040 CG GLN E 394 22009 19657 22062 1320 2764 172 C ATOM 23041 CD GLN E 394 23.878 -60.670 -10.622 1.00172.45 C ANISOU23041 CD GLN E 394 22552 20401 22570 1373 2696 290 C ATOM 23042 OE1 GLN E 394 24.370 -61.797 -10.684 1.00180.78 O ANISOU23042 OE1 GLN E 394 23606 21457 23624 1445 2763 311 O ATOM 23043 NE2 GLN E 394 24.563 -59.573 -10.922 1.00167.26 N ANISOU23043 NE2 GLN E 394 21849 19867 21836 1335 2562 367 N ATOM 23044 H GLN E 394 20.152 -61.114 -13.366 1.00159.65 H ATOM 23045 HA GLN E 394 22.488 -61.987 -12.409 1.00171.71 H ATOM 23046 HB2 GLN E 394 21.653 -59.790 -11.946 1.00188.39 H ATOM 23047 HB3 GLN E 394 20.566 -60.457 -11.002 1.00188.39 H ATOM 23048 HG2 GLN E 394 22.365 -59.602 -9.771 1.00201.27 H ATOM 23049 HG3 GLN E 394 22.214 -61.170 -9.555 1.00201.27 H ATOM 23050 HE21 GLN E 394 24.186 -58.802 -10.868 1.00200.71 H ATOM 23051 HE22 GLN E 394 25.384 -59.633 -11.171 1.00200.71 H ATOM 23052 N VAL E 395 19.778 -63.338 -11.490 1.00137.07 N ANISOU23052 N VAL E 395 18094 15507 18478 1412 3100 -186 N ATOM 23053 CA VAL E 395 19.187 -64.476 -10.795 1.00122.54 C ANISOU23053 CA VAL E 395 16334 13527 16698 1443 3246 -242 C ATOM 23054 C VAL E 395 19.426 -65.767 -11.568 1.00120.90 C ANISOU23054 C VAL E 395 16077 13332 16526 1524 3319 -273 C ATOM 23055 O VAL E 395 19.516 -66.843 -10.979 1.00138.62 O ANISOU23055 O VAL E 395 18385 15501 18783 1572 3420 -264 O ATOM 23056 CB VAL E 395 17.672 -64.288 -10.565 1.00113.43 C ANISOU23056 CB VAL E 395 15216 12240 15641 1388 3314 -378 C ATOM 23057 CG1 VAL E 395 16.947 -64.032 -11.871 1.00128.47 C ANISOU23057 CG1 VAL E 395 17021 14175 17618 1374 3292 -489 C ATOM 23058 CG2 VAL E 395 17.082 -65.503 -9.881 1.00116.77 C ANISOU23058 CG2 VAL E 395 15721 12522 16124 1420 3466 -436 C ATOM 23059 H VAL E 395 19.225 -62.908 -11.989 1.00164.48 H ATOM 23060 HA VAL E 395 19.615 -64.568 -9.918 1.00147.04 H ATOM 23061 HB VAL E 395 17.531 -63.513 -9.982 1.00136.11 H ATOM 23062 HG11 VAL E 395 16.011 -63.920 -11.691 1.00154.17 H ATOM 23063 HG12 VAL E 395 17.301 -63.235 -12.273 1.00154.17 H ATOM 23064 HG13 VAL E 395 17.082 -64.782 -12.455 1.00154.17 H ATOM 23065 HG21 VAL E 395 16.141 -65.361 -9.750 1.00140.12 H ATOM 23066 HG22 VAL E 395 17.223 -66.273 -10.437 1.00140.12 H ATOM 23067 HG23 VAL E 395 17.516 -65.626 -9.034 1.00140.12 H ATOM 23068 N GLN E 396 19.528 -65.661 -12.889 1.00116.45 N ANISOU23068 N GLN E 396 15402 12864 15979 1538 3269 -308 N ATOM 23069 CA GLN E 396 19.853 -66.816 -13.715 1.00110.14 C ANISOU23069 CA GLN E 396 14547 12095 15208 1614 3326 -331 C ATOM 23070 C GLN E 396 21.272 -67.289 -13.418 1.00121.97 C ANISOU23070 C GLN E 396 16054 13675 16616 1675 3301 -196 C ATOM 23071 O GLN E 396 21.532 -68.489 -13.350 1.00146.12 O ANISOU23071 O GLN E 396 19130 16697 19691 1743 3389 -195 O ATOM 23072 CB GLN E 396 19.701 -66.482 -15.199 1.00106.10 C ANISOU23072 CB GLN E 396 13910 11678 14725 1609 3265 -392 C ATOM 23073 CG GLN E 396 18.255 -66.402 -15.666 1.00118.62 C ANISOU23073 CG GLN E 396 15477 13175 16418 1569 3318 -545 C ATOM 23074 CD GLN E 396 18.133 -66.021 -17.130 1.00130.71 C ANISOU23074 CD GLN E 396 16885 14806 17974 1561 3251 -600 C ATOM 23075 OE1 GLN E 396 19.123 -65.692 -17.783 1.00125.44 O ANISOU23075 OE1 GLN E 396 16146 14277 17238 1577 3155 -522 O ATOM 23076 NE2 GLN E 396 16.913 -66.070 -17.654 1.00135.78 N ANISOU23076 NE2 GLN E 396 17502 15378 18712 1536 3301 -736 N ATOM 23077 H GLN E 396 19.414 -64.931 -13.330 1.00139.74 H ATOM 23078 HA GLN E 396 19.236 -67.548 -13.502 1.00132.17 H ATOM 23079 HB2 GLN E 396 20.115 -65.622 -15.370 1.00127.32 H ATOM 23080 HB3 GLN E 396 20.143 -67.169 -15.721 1.00127.32 H ATOM 23081 HG2 GLN E 396 17.835 -67.268 -15.544 1.00142.34 H ATOM 23082 HG3 GLN E 396 17.790 -65.731 -15.141 1.00142.34 H ATOM 23083 HE21 GLN E 396 16.245 -66.307 -17.167 1.00162.94 H ATOM 23084 HE22 GLN E 396 16.791 -65.863 -18.480 1.00162.94 H ATOM 23085 N LYS E 397 22.185 -66.339 -13.238 1.00120.43 N ANISOU23085 N LYS E 397 15846 13589 16325 1651 3180 -83 N ATOM 23086 CA LYS E 397 23.558 -66.660 -12.864 1.00118.70 C ANISOU23086 CA LYS E 397 15638 13450 16011 1703 3146 53 C ATOM 23087 C LYS E 397 23.611 -67.211 -11.441 1.00124.30 C ANISOU23087 C LYS E 397 16473 14051 16706 1717 3226 100 C ATOM 23088 O LYS E 397 24.596 -67.831 -11.041 1.00122.59 O ANISOU23088 O LYS E 397 16280 13866 16432 1775 3235 195 O ATOM 23089 CB LYS E 397 24.452 -65.422 -12.979 1.00114.83 C ANISOU23089 CB LYS E 397 15107 13100 15422 1664 2995 158 C ATOM 23090 CG LYS E 397 24.690 -64.955 -14.409 1.00121.44 C ANISOU23090 CG LYS E 397 15817 14070 16255 1660 2907 137 C ATOM 23091 CD LYS E 397 25.570 -63.712 -14.448 1.00137.40 C ANISOU23091 CD LYS E 397 17806 16225 18175 1617 2758 244 C ATOM 23092 CE LYS E 397 25.695 -63.153 -15.859 1.00143.55 C ANISOU23092 CE LYS E 397 18461 17128 18951 1601 2668 217 C ATOM 23093 NZ LYS E 397 26.499 -61.898 -15.898 1.00139.13 N ANISOU23093 NZ LYS E 397 17873 16696 18294 1553 2522 318 N ATOM 23094 H LYS E 397 22.034 -65.498 -13.327 1.00144.52 H ATOM 23095 HA LYS E 397 23.906 -67.346 -13.471 1.00142.43 H ATOM 23096 HB2 LYS E 397 24.035 -64.692 -12.496 1.00137.79 H ATOM 23097 HB3 LYS E 397 25.315 -65.624 -12.587 1.00137.79 H ATOM 23098 HG2 LYS E 397 25.135 -65.659 -14.906 1.00145.73 H ATOM 23099 HG3 LYS E 397 23.839 -64.738 -14.821 1.00145.73 H ATOM 23100 HD2 LYS E 397 25.180 -63.027 -13.884 1.00164.88 H ATOM 23101 HD3 LYS E 397 26.458 -63.941 -14.133 1.00164.88 H ATOM 23102 HE2 LYS E 397 26.132 -63.809 -16.423 1.00172.25 H ATOM 23103 HE3 LYS E 397 24.809 -62.955 -16.201 1.00172.25 H ATOM 23104 HZ1 LYS E 397 26.553 -61.597 -16.734 1.00166.96 H ATOM 23105 HZ2 LYS E 397 26.116 -61.275 -15.391 1.00166.96 H ATOM 23106 HZ3 LYS E 397 27.321 -62.054 -15.594 1.00166.96 H ATOM 23107 N LYS E 398 22.547 -66.976 -10.681 1.00132.37 N ANISOU23107 N LYS E 398 17572 14943 17778 1664 3282 33 N ATOM 23108 CA LYS E 398 22.445 -67.491 -9.321 1.00132.61 C ANISOU23108 CA LYS E 398 17726 14859 17803 1669 3365 65 C ATOM 23109 C LYS E 398 21.939 -68.933 -9.324 1.00141.51 C ANISOU23109 C LYS E 398 18884 15876 19008 1728 3509 -12 C ATOM 23110 O LYS E 398 22.408 -69.765 -8.546 1.00127.78 O ANISOU23110 O LYS E 398 17217 14090 17245 1774 3571 47 O ATOM 23111 CB LYS E 398 21.518 -66.600 -8.485 1.00111.93 C ANISOU23111 CB LYS E 398 15177 12149 15202 1584 3363 25 C ATOM 23112 CG LYS E 398 21.223 -67.139 -7.095 1.00114.03 C ANISOU23112 CG LYS E 398 15573 12282 15473 1581 3460 38 C ATOM 23113 CD LYS E 398 20.484 -66.120 -6.236 1.00108.75 C ANISOU23113 CD LYS E 398 14970 11545 14807 1493 3440 16 C ATOM 23114 CE LYS E 398 19.118 -65.786 -6.810 1.00109.43 C ANISOU23114 CE LYS E 398 15022 11564 14991 1445 3469 -133 C ATOM 23115 NZ LYS E 398 18.369 -64.826 -5.953 1.00111.76 N ANISOU23115 NZ LYS E 398 15383 11789 15293 1362 3455 -159 N ATOM 23116 H LYS E 398 21.864 -66.518 -10.933 1.00158.84 H ATOM 23117 HA LYS E 398 23.333 -67.480 -8.906 1.00159.14 H ATOM 23118 HB2 LYS E 398 21.933 -65.729 -8.382 1.00134.32 H ATOM 23119 HB3 LYS E 398 20.672 -66.507 -8.951 1.00134.32 H ATOM 23120 HG2 LYS E 398 20.668 -67.931 -7.171 1.00136.84 H ATOM 23121 HG3 LYS E 398 22.059 -67.358 -6.654 1.00136.84 H ATOM 23122 HD2 LYS E 398 20.358 -66.485 -5.346 1.00130.51 H ATOM 23123 HD3 LYS E 398 21.004 -65.302 -6.192 1.00130.51 H ATOM 23124 HE2 LYS E 398 19.230 -65.384 -7.686 1.00131.31 H ATOM 23125 HE3 LYS E 398 18.594 -66.599 -6.881 1.00131.31 H ATOM 23126 HZ1 LYS E 398 17.575 -64.650 -6.315 1.00134.11 H ATOM 23127 HZ2 LYS E 398 18.247 -65.173 -5.143 1.00134.11 H ATOM 23128 HZ3 LYS E 398 18.827 -64.066 -5.876 1.00134.11 H ATOM 23129 N TYR E 399 20.989 -69.227 -10.207 1.00164.61 N ANISOU23129 N TYR E 399 21756 18762 22027 1725 3560 -142 N ATOM 23130 CA TYR E 399 20.424 -70.570 -10.307 1.00 96.21 C ATOM 23131 C TYR E 399 21.323 -71.511 -11.109 1.00113.20 C ATOM 23132 O TYR E 399 21.251 -72.730 -10.950 1.00139.32 O ATOM 23133 CB TYR E 399 19.033 -70.522 -10.949 1.00106.80 C ATOM 23134 CG TYR E 399 17.918 -70.108 -10.010 1.00114.73 C ATOM 23135 CD1 TYR E 399 17.934 -70.474 -8.670 1.00121.91 C ATOM 23136 CD2 TYR E 399 16.846 -69.355 -10.469 1.00116.58 C ATOM 23137 CE1 TYR E 399 16.915 -70.101 -7.815 1.00122.58 C ATOM 23138 CE2 TYR E 399 15.824 -68.976 -9.621 1.00120.26 C ATOM 23139 CZ TYR E 399 15.864 -69.351 -8.296 1.00127.10 C ATOM 23140 OH TYR E 399 14.850 -68.979 -7.444 1.00139.16 O ATOM 23141 H TYR E 399 20.652 -68.663 -10.762 1.00197.54 H ATOM 23142 HA TYR E 399 20.327 -70.942 -9.406 1.00115.45 H ATOM 23143 HB2 TYR E 399 19.051 -69.886 -11.681 1.00128.16 H ATOM 23144 HB3 TYR E 399 18.818 -71.404 -11.289 1.00128.16 H ATOM 23145 HD1 TYR E 399 18.642 -70.980 -8.343 1.00146.29 H ATOM 23146 HD2 TYR E 399 16.817 -69.100 -11.363 1.00139.90 H ATOM 23147 HE1 TYR E 399 16.940 -70.352 -6.920 1.00147.09 H ATOM 23148 HE2 TYR E 399 15.113 -68.471 -9.943 1.00144.32 H ATOM 23149 HH TYR E 399 14.135 -69.281 -7.709 1.00167.00 H ATOM 23150 N ASP E 400 22.164 -70.947 -11.970 1.00183.81 N ANISOU23150 N ASP E 400 31031 17978 20831 96 4384 2138 N ATOM 23151 CA ASP E 400 23.079 -71.752 -12.773 1.00151.98 C ANISOU23151 CA ASP E 400 26871 14099 16776 61 4145 1827 C ATOM 23152 C ASP E 400 24.398 -71.993 -12.044 1.00150.46 C ANISOU23152 C ASP E 400 26625 14037 16507 29 4079 1416 C ATOM 23153 O ASP E 400 25.205 -72.820 -12.467 1.00170.98 O ANISOU23153 O ASP E 400 29106 16765 19093 19 3842 1144 O ATOM 23154 CB ASP E 400 23.340 -71.094 -14.129 1.00154.92 C ANISOU23154 CB ASP E 400 27260 14517 17086 -67 4297 1742 C ATOM 23155 CG ASP E 400 22.259 -71.406 -15.147 1.00161.99 C ANISOU23155 CG ASP E 400 28142 15336 18071 -22 4207 2065 C ATOM 23156 OD1 ASP E 400 21.812 -70.472 -15.848 1.00166.38 O ANISOU23156 OD1 ASP E 400 28782 15832 18602 -95 4450 2215 O ATOM 23157 OD2 ASP E 400 21.863 -72.586 -15.255 1.00158.94 O ANISOU23157 OD2 ASP E 400 27659 14951 17779 84 3893 2168 O ATOM 23158 H ASP E 400 22.225 -70.100 -12.108 1.00220.57 H ATOM 23159 HA ASP E 400 22.666 -72.625 -12.939 1.00182.38 H ATOM 23160 HB2 ASP E 400 23.374 -70.131 -14.012 1.00185.91 H ATOM 23161 HB3 ASP E 400 24.185 -71.416 -14.480 1.00185.91 H ATOM 23162 N LYS E 401 24.619 -71.264 -10.954 1.00142.37 N ANISOU23162 N LYS E 401 25686 12979 15430 11 4291 1372 N ATOM 23163 CA LYS E 401 25.749 -71.538 -10.075 1.00147.50 C ANISOU23163 CA LYS E 401 26288 13735 16018 1 4220 1021 C ATOM 23164 C LYS E 401 25.295 -72.475 -8.961 1.00161.08 C ANISOU23164 C LYS E 401 27969 15405 17830 150 3991 1160 C ATOM 23165 O LYS E 401 26.109 -72.972 -8.182 1.00176.79 O ANISOU23165 O LYS E 401 29901 17477 19792 171 3862 905 O ATOM 23166 CB LYS E 401 26.301 -70.241 -9.479 1.00140.34 C ANISOU23166 CB LYS E 401 25495 12827 15002 -103 4573 876 C ATOM 23167 CG LYS E 401 27.641 -70.399 -8.771 1.00140.80 C ANISOU23167 CG LYS E 401 25504 13016 14976 -143 4528 460 C ATOM 23168 CD LYS E 401 28.145 -69.066 -8.241 1.00165.91 C ANISOU23168 CD LYS E 401 28801 16191 18047 -250 4890 329 C ATOM 23169 CE LYS E 401 29.525 -69.196 -7.618 1.00173.25 C ANISOU23169 CE LYS E 401 29680 17258 18888 -299 4851 -101 C ATOM 23170 NZ LYS E 401 30.015 -67.900 -7.067 1.00171.79 N ANISOU23170 NZ LYS E 401 29609 17066 18597 -402 5204 -227 N ATOM 23171 H LYS E 401 24.129 -70.605 -10.701 1.00170.85 H ATOM 23172 HA LYS E 401 26.463 -71.978 -10.583 1.00176.99 H ATOM 23173 HB2 LYS E 401 26.420 -69.597 -10.194 1.00168.41 H ATOM 23174 HB3 LYS E 401 25.664 -69.900 -8.833 1.00168.41 H ATOM 23175 HG2 LYS E 401 27.538 -71.006 -8.021 1.00168.95 H ATOM 23176 HG3 LYS E 401 28.296 -70.746 -9.396 1.00168.95 H ATOM 23177 HD2 LYS E 401 28.201 -68.432 -8.973 1.00199.09 H ATOM 23178 HD3 LYS E 401 27.534 -68.741 -7.561 1.00199.09 H ATOM 23179 HE2 LYS E 401 29.488 -69.838 -6.892 1.00207.90 H ATOM 23180 HE3 LYS E 401 30.154 -69.493 -8.294 1.00207.90 H ATOM 23181 HZ1 LYS E 401 30.823 -68.007 -6.710 1.00206.15 H ATOM 23182 HZ2 LYS E 401 30.063 -67.293 -7.716 1.00206.15 H ATOM 23183 HZ3 LYS E 401 29.457 -67.607 -6.438 1.00206.15 H ATOM 23184 N PHE E 402 23.988 -72.717 -8.897 1.00150.66 N ANISOU23184 N PHE E 402 26679 13948 16617 253 3941 1568 N ATOM 23185 CA PHE E 402 23.411 -73.568 -7.864 1.00130.54 C ANISOU23185 CA PHE E 402 24102 11335 14163 400 3736 1746 C ATOM 23186 C PHE E 402 23.230 -74.991 -8.380 1.00127.07 C ANISOU23186 C PHE E 402 23527 10940 13815 492 3348 1772 C ATOM 23187 O PHE E 402 23.401 -75.953 -7.633 1.00131.82 O ANISOU23187 O PHE E 402 24053 11571 14462 587 3100 1710 O ATOM 23188 CB PHE E 402 22.072 -72.992 -7.393 1.00122.20 C ANISOU23188 CB PHE E 402 23162 10098 13172 462 3913 2182 C ATOM 23189 CG PHE E 402 21.555 -73.609 -6.123 1.00112.93 C ANISOU23189 CG PHE E 402 21984 8849 12076 599 3774 2347 C ATOM 23190 CD1 PHE E 402 22.400 -73.822 -5.046 1.00122.52 C ANISOU23190 CD1 PHE E 402 23175 10131 13246 611 3725 2090 C ATOM 23191 CD2 PHE E 402 20.219 -73.958 -5.998 1.00119.63 C ANISOU23191 CD2 PHE E 402 22854 9559 13039 714 3697 2762 C ATOM 23192 CE1 PHE E 402 21.928 -74.386 -3.874 1.00120.31 C ANISOU23192 CE1 PHE E 402 22893 9784 13037 735 3599 2241 C ATOM 23193 CE2 PHE E 402 19.741 -74.521 -4.825 1.00128.29 C ANISOU23193 CE2 PHE E 402 23949 10587 14208 839 3571 2915 C ATOM 23194 CZ PHE E 402 20.598 -74.735 -3.763 1.00115.25 C ANISOU23194 CZ PHE E 402 22273 9004 12511 849 3522 2654 C ATOM 23195 H PHE E 402 23.410 -72.396 -9.446 1.00180.80 H ATOM 23196 HA PHE E 402 24.017 -73.597 -7.095 1.00156.65 H ATOM 23197 HB2 PHE E 402 22.178 -72.041 -7.239 1.00146.64 H ATOM 23198 HB3 PHE E 402 21.408 -73.140 -8.085 1.00146.64 H ATOM 23199 HD1 PHE E 402 23.298 -73.591 -5.115 1.00147.03 H ATOM 23200 HD2 PHE E 402 19.639 -73.817 -6.711 1.00143.55 H ATOM 23201 HE1 PHE E 402 22.507 -74.527 -3.161 1.00144.38 H ATOM 23202 HE2 PHE E 402 18.844 -74.755 -4.754 1.00153.95 H ATOM 23203 HZ PHE E 402 20.279 -75.112 -2.975 1.00138.29 H ATOM 23204 N ARG E 403 22.884 -75.125 -9.658 1.00131.00 N ANISOU23204 N ARG E 403 23992 11443 14339 465 3294 1865 N ATOM 23205 CA ARG E 403 22.839 -76.438 -10.287 1.00135.79 C ANISOU23205 CA ARG E 403 24465 12109 15020 536 2933 1849 C ATOM 23206 C ARG E 403 24.240 -77.030 -10.319 1.00144.24 C ANISOU23206 C ARG E 403 25427 13353 16024 491 2759 1398 C ATOM 23207 O ARG E 403 24.430 -78.215 -10.050 1.00155.49 O ANISOU23207 O ARG E 403 26744 14832 17504 579 2444 1321 O ATOM 23208 CB ARG E 403 22.287 -76.356 -11.713 1.00128.84 C ANISOU23208 CB ARG E 403 23576 11208 14167 499 2937 2008 C ATOM 23209 CG ARG E 403 20.776 -76.230 -11.799 1.00146.27 C ANISOU23209 CG ARG E 403 25851 13249 16476 580 2985 2483 C ATOM 23210 CD ARG E 403 20.273 -76.615 -13.183 1.00159.33 C ANISOU23210 CD ARG E 403 27454 14905 18181 576 2864 2619 C ATOM 23211 NE ARG E 403 19.039 -75.916 -13.536 1.00182.72 N ANISOU23211 NE ARG E 403 30517 17719 21189 586 3058 3014 N ATOM 23212 CZ ARG E 403 18.989 -74.721 -14.123 1.00191.87 C ANISOU23212 CZ ARG E 403 31772 18849 22282 475 3369 3045 C ATOM 23213 NH1 ARG E 403 20.103 -74.070 -14.433 1.00196.08 N ANISOU23213 NH1 ARG E 403 32315 19490 22697 342 3526 2704 N ATOM 23214 NH2 ARG E 403 17.816 -74.172 -14.402 1.00191.01 N ANISOU23214 NH2 ARG E 403 31750 18602 22224 495 3523 3420 N ATOM 23215 H ARG E 403 22.671 -74.474 -10.178 1.00157.20 H ATOM 23216 HA ARG E 403 22.262 -77.033 -9.764 1.00162.95 H ATOM 23217 HB2 ARG E 403 22.672 -75.581 -12.150 1.00154.60 H ATOM 23218 HB3 ARG E 403 22.543 -77.161 -12.191 1.00154.60 H ATOM 23219 HG2 ARG E 403 20.367 -76.823 -11.149 1.00175.52 H ATOM 23220 HG3 ARG E 403 20.520 -75.311 -11.626 1.00175.52 H ATOM 23221 HD2 ARG E 403 20.948 -76.388 -13.841 1.00191.20 H ATOM 23222 HD3 ARG E 403 20.095 -77.569 -13.202 1.00191.20 H ATOM 23223 HE ARG E 403 18.294 -76.303 -13.352 1.00219.26 H ATOM 23224 HH11 ARG E 403 20.869 -74.418 -14.256 1.00235.30 H ATOM 23225 HH12 ARG E 403 20.059 -73.299 -14.812 1.00235.30 H ATOM 23226 HH21 ARG E 403 17.089 -74.586 -14.204 1.00229.21 H ATOM 23227 HH22 ARG E 403 17.782 -73.400 -14.780 1.00229.21 H ATOM 23228 N GLN E 404 25.222 -76.193 -10.638 1.00138.60 N ANISOU23228 N GLN E 404 24743 12728 15191 352 2967 1101 N ATOM 23229 CA GLN E 404 26.604 -76.646 -10.758 1.00152.02 C ANISOU23229 CA GLN E 404 26345 14598 16817 294 2829 657 C ATOM 23230 C GLN E 404 27.209 -77.040 -9.412 1.00157.75 C ANISOU23230 C GLN E 404 27045 15363 17528 348 2739 475 C ATOM 23231 O GLN E 404 28.330 -77.544 -9.356 1.00159.83 O ANISOU23231 O GLN E 404 27221 15765 17741 317 2593 115 O ATOM 23232 CB GLN E 404 27.470 -75.570 -11.418 1.00157.33 C ANISOU23232 CB GLN E 404 27066 15349 17365 129 3098 396 C ATOM 23233 CG GLN E 404 28.005 -75.970 -12.783 1.00166.50 C ANISOU23233 CG GLN E 404 28135 16623 18505 61 2963 205 C ATOM 23234 CD GLN E 404 29.064 -75.017 -13.298 1.00166.41 C ANISOU23234 CD GLN E 404 28157 16710 18362 -100 3200 -118 C ATOM 23235 OE1 GLN E 404 29.043 -73.823 -12.996 1.00143.86 O ANISOU23235 OE1 GLN E 404 25419 13802 15441 -173 3525 -87 O ATOM 23236 NE2 GLN E 404 30.004 -75.542 -14.076 1.00181.31 N ANISOU23236 NE2 GLN E 404 29940 18740 20209 -156 3036 -431 N ATOM 23237 H GLN E 404 25.114 -75.354 -10.791 1.00166.32 H ATOM 23238 HA GLN E 404 26.624 -77.438 -11.335 1.00182.42 H ATOM 23239 HB2 GLN E 404 26.938 -74.767 -11.531 1.00188.80 H ATOM 23240 HB3 GLN E 404 28.229 -75.384 -10.844 1.00188.80 H ATOM 23241 HG2 GLN E 404 28.401 -76.853 -12.721 1.00199.80 H ATOM 23242 HG3 GLN E 404 27.273 -75.978 -13.420 1.00199.80 H ATOM 23243 HE21 GLN E 404 29.989 -76.382 -14.261 1.00217.57 H ATOM 23244 HE22 GLN E 404 30.628 -75.043 -14.394 1.00217.57 H ATOM 23245 N LYS E 405 26.472 -76.806 -8.330 1.00159.40 N ANISOU23245 N LYS E 405 27332 15451 17781 426 2827 723 N ATOM 23246 CA LYS E 405 26.935 -77.183 -6.999 1.00152.10 C ANISOU23246 CA LYS E 405 26390 14550 16850 487 2743 586 C ATOM 23247 C LYS E 405 26.104 -78.326 -6.421 1.00143.78 C ANISOU23247 C LYS E 405 25280 13427 15923 651 2455 834 C ATOM 23248 O LYS E 405 26.632 -79.185 -5.716 1.00143.09 O ANISOU23248 O LYS E 405 25113 13405 15849 715 2231 662 O ATOM 23249 CB LYS E 405 26.918 -75.971 -6.065 1.00150.19 C ANISOU23249 CB LYS E 405 26283 14238 16545 441 3083 623 C ATOM 23250 CG LYS E 405 27.909 -74.885 -6.459 1.00162.55 C ANISOU23250 CG LYS E 405 27899 15887 17977 280 3357 325 C ATOM 23251 CD LYS E 405 29.348 -75.383 -6.389 1.00183.85 C ANISOU23251 CD LYS E 405 30497 18758 20600 230 3209 -135 C ATOM 23252 CE LYS E 405 30.321 -74.376 -6.981 1.00202.48 C ANISOU23252 CE LYS E 405 32894 21207 22831 67 3460 -431 C ATOM 23253 NZ LYS E 405 31.730 -74.855 -6.913 1.00209.20 N ANISOU23253 NZ LYS E 405 33649 22229 23610 18 3317 -882 N ATOM 23254 H LYS E 405 25.698 -76.430 -8.341 1.00191.28 H ATOM 23255 HA LYS E 405 27.862 -77.494 -7.066 1.00182.52 H ATOM 23256 HB2 LYS E 405 26.030 -75.581 -6.074 1.00180.23 H ATOM 23257 HB3 LYS E 405 27.139 -76.265 -5.167 1.00180.23 H ATOM 23258 HG2 LYS E 405 27.730 -74.603 -7.370 1.00195.07 H ATOM 23259 HG3 LYS E 405 27.818 -74.133 -5.852 1.00195.07 H ATOM 23260 HD2 LYS E 405 29.591 -75.529 -5.461 1.00220.62 H ATOM 23261 HD3 LYS E 405 29.425 -76.209 -6.890 1.00220.62 H ATOM 23262 HE2 LYS E 405 30.097 -74.226 -7.913 1.00242.97 H ATOM 23263 HE3 LYS E 405 30.260 -73.544 -6.485 1.00242.97 H ATOM 23264 HZ1 LYS E 405 32.275 -74.247 -7.266 1.00251.04 H ATOM 23265 HZ2 LYS E 405 31.962 -74.995 -6.065 1.00251.04 H ATOM 23266 HZ3 LYS E 405 31.814 -75.616 -7.365 1.00251.04 H ATOM 23267 N LEU E 406 24.808 -78.337 -6.716 1.00140.55 N ANISOU23267 N LEU E 406 24912 12884 15605 719 2462 1238 N ATOM 23268 CA LEU E 406 23.971 -79.476 -6.361 1.00145.83 C ANISOU23268 CA LEU E 406 25520 13490 16400 872 2172 1485 C ATOM 23269 C LEU E 406 24.409 -80.690 -7.168 1.00150.29 C ANISOU23269 C LEU E 406 25936 14167 16998 897 1830 1317 C ATOM 23270 O LEU E 406 24.370 -81.819 -6.683 1.00144.39 O ANISOU23270 O LEU E 406 25102 13440 16320 1006 1536 1316 O ATOM 23271 CB LEU E 406 22.495 -79.186 -6.641 1.00149.49 C ANISOU23271 CB LEU E 406 26059 13789 16950 929 2261 1950 C ATOM 23272 CG LEU E 406 21.702 -78.391 -5.601 1.00149.12 C ANISOU23272 CG LEU E 406 26142 13597 16920 968 2500 2224 C ATOM 23273 CD1 LEU E 406 20.225 -78.380 -5.966 1.00152.81 C ANISOU23273 CD1 LEU E 406 26658 13913 17492 1042 2513 2683 C ATOM 23274 CD2 LEU E 406 21.893 -78.960 -4.209 1.00144.28 C ANISOU23274 CD2 LEU E 406 25506 12981 16331 1062 2369 2170 C ATOM 23275 H LEU E 406 24.392 -77.701 -7.119 1.00168.66 H ATOM 23276 HA LEU E 406 24.076 -79.678 -5.408 1.00175.00 H ATOM 23277 HB2 LEU E 406 22.443 -78.690 -7.473 1.00179.38 H ATOM 23278 HB3 LEU E 406 22.041 -80.036 -6.752 1.00179.38 H ATOM 23279 HG LEU E 406 22.017 -77.474 -5.597 1.00178.94 H ATOM 23280 HD11 LEU E 406 19.744 -77.878 -5.304 1.00183.38 H ATOM 23281 HD12 LEU E 406 20.120 -77.971 -6.828 1.00183.38 H ATOM 23282 HD13 LEU E 406 19.903 -79.284 -5.990 1.00183.38 H ATOM 23283 HD21 LEU E 406 21.382 -78.438 -3.586 1.00173.13 H ATOM 23284 HD22 LEU E 406 21.589 -79.871 -4.199 1.00173.13 H ATOM 23285 HD23 LEU E 406 22.825 -78.923 -3.981 1.00173.13 H ATOM 23286 N GLU E 407 24.831 -80.447 -8.403 1.00153.66 N ANISOU23286 N GLU E 407 26336 14670 17376 796 1870 1175 N ATOM 23287 CA GLU E 407 25.222 -81.525 -9.298 1.00146.16 C ANISOU23287 CA GLU E 407 25252 13827 16457 809 1563 1024 C ATOM 23288 C GLU E 407 26.599 -82.065 -8.927 1.00140.18 C ANISOU23288 C GLU E 407 24401 13228 15634 781 1410 587 C ATOM 23289 O GLU E 407 26.810 -83.278 -8.899 1.00150.93 O ANISOU23289 O GLU E 407 25645 14652 17048 860 1084 500 O ATOM 23290 CB GLU E 407 25.212 -81.037 -10.747 1.00144.01 C ANISOU23290 CB GLU E 407 24986 13581 16151 706 1670 1019 C ATOM 23291 CG GLU E 407 25.178 -82.152 -11.774 1.00172.81 C ANISOU23291 CG GLU E 407 28507 17294 19860 743 1356 999 C ATOM 23292 CD GLU E 407 24.949 -81.632 -13.178 1.00186.93 C ANISOU23292 CD GLU E 407 30314 19081 21628 653 1475 1064 C ATOM 23293 OE1 GLU E 407 24.453 -80.493 -13.314 1.00186.22 O ANISOU23293 OE1 GLU E 407 30344 18903 21509 593 1782 1238 O ATOM 23294 OE2 GLU E 407 25.265 -82.358 -14.145 1.00187.23 O ANISOU23294 OE2 GLU E 407 30250 19207 21681 641 1262 941 O ATOM 23295 H GLU E 407 24.901 -79.662 -8.747 1.00184.39 H ATOM 23296 HA GLU E 407 24.576 -82.257 -9.219 1.00175.40 H ATOM 23297 HB2 GLU E 407 24.426 -80.484 -10.884 1.00172.81 H ATOM 23298 HB3 GLU E 407 26.013 -80.513 -10.905 1.00172.81 H ATOM 23299 HG2 GLU E 407 26.027 -82.621 -11.761 1.00207.37 H ATOM 23300 HG3 GLU E 407 24.456 -82.762 -11.557 1.00207.37 H ATOM 23301 N GLU E 408 27.534 -81.164 -8.640 1.00120.16 N ANISOU23301 N GLU E 408 21918 10755 12982 670 1645 312 N ATOM 23302 CA GLU E 408 28.874 -81.572 -8.238 1.00120.44 C ANISOU23302 CA GLU E 408 21874 10939 12947 636 1527 -111 C ATOM 23303 C GLU E 408 28.824 -82.290 -6.897 1.00130.04 C ANISOU23303 C GLU E 408 23063 12134 14212 755 1357 -92 C ATOM 23304 O GLU E 408 29.714 -83.073 -6.573 1.00137.38 O ANISOU23304 O GLU E 408 23895 13178 15124 773 1143 -381 O ATOM 23305 CB GLU E 408 29.813 -80.367 -8.153 1.00129.95 C ANISOU23305 CB GLU E 408 23153 12204 14016 491 1841 -385 C ATOM 23306 CG GLU E 408 31.254 -80.732 -7.809 1.00145.46 C ANISOU23306 CG GLU E 408 25037 14329 15901 445 1732 -840 C ATOM 23307 CD GLU E 408 32.203 -79.553 -7.923 1.00161.84 C ANISOU23307 CD GLU E 408 27179 16472 17841 293 2036 -1120 C ATOM 23308 OE1 GLU E 408 32.036 -78.739 -8.855 1.00173.24 O ANISOU23308 OE1 GLU E 408 28679 17897 19247 199 2241 -1065 O ATOM 23309 OE2 GLU E 408 33.118 -79.440 -7.080 1.00162.33 O ANISOU23309 OE2 GLU E 408 27237 16607 17836 267 2069 -1397 O ATOM 23310 H GLU E 408 27.417 -80.313 -8.670 1.00144.19 H ATOM 23311 HA GLU E 408 29.235 -82.194 -8.904 1.00144.52 H ATOM 23312 HB2 GLU E 408 29.819 -79.914 -9.011 1.00155.93 H ATOM 23313 HB3 GLU E 408 29.488 -79.765 -7.466 1.00155.93 H ATOM 23314 HG2 GLU E 408 31.288 -81.057 -6.895 1.00174.55 H ATOM 23315 HG3 GLU E 408 31.559 -81.422 -8.418 1.00174.55 H ATOM 23316 N ALA E 409 27.778 -82.020 -6.122 1.00134.37 N ANISOU23316 N ALA E 409 23697 12535 14822 836 1453 250 N ATOM 23317 CA ALA E 409 27.592 -82.676 -4.834 1.00130.84 C ANISOU23317 CA ALA E 409 23232 12052 14431 956 1301 312 C ATOM 23318 C ALA E 409 27.048 -84.087 -5.033 1.00122.48 C ANISOU23318 C ALA E 409 22062 10986 13489 1086 927 456 C ATOM 23319 O ALA E 409 27.458 -85.021 -4.345 1.00131.71 O ANISOU23319 O ALA E 409 23150 12211 14685 1163 684 320 O ATOM 23320 CB ALA E 409 26.656 -81.864 -3.958 1.00129.92 C ANISOU23320 CB ALA E 409 23248 11777 14337 994 1542 629 C ATOM 23321 H ALA E 409 27.159 -81.457 -6.321 1.00161.24 H ATOM 23322 HA ALA E 409 28.457 -82.743 -4.379 1.00157.01 H ATOM 23323 HB1 ALA E 409 26.548 -82.313 -3.117 1.00155.90 H ATOM 23324 HB2 ALA E 409 27.037 -80.994 -3.819 1.00155.90 H ATOM 23325 HB3 ALA E 409 25.807 -81.784 -4.399 1.00155.90 H ATOM 23326 N LEU E 410 26.124 -84.237 -5.977 1.00122.38 N ANISOU23326 N LEU E 410 22047 10905 13547 1110 882 732 N ATOM 23327 CA LEU E 410 25.608 -85.553 -6.333 1.00125.58 C ANISOU23327 CA LEU E 410 22345 11309 14062 1223 532 868 C ATOM 23328 C LEU E 410 26.749 -86.453 -6.790 1.00129.64 C ANISOU23328 C LEU E 410 22721 11992 14544 1198 272 489 C ATOM 23329 O LEU E 410 26.692 -87.672 -6.637 1.00138.54 O ANISOU23329 O LEU E 410 23745 13149 15745 1300 -50 489 O ATOM 23330 CB LEU E 410 24.563 -85.435 -7.444 1.00123.31 C ANISOU23330 CB LEU E 410 22079 10936 13837 1227 557 1184 C ATOM 23331 CG LEU E 410 23.234 -84.802 -7.033 1.00107.12 C ANISOU23331 CG LEU E 410 20148 8706 11847 1281 748 1616 C ATOM 23332 CD1 LEU E 410 22.446 -84.350 -8.249 1.00127.24 C ANISOU23332 CD1 LEU E 410 22735 11190 14421 1240 857 1857 C ATOM 23333 CD2 LEU E 410 22.417 -85.778 -6.214 1.00106.59 C ANISOU23333 CD2 LEU E 410 20046 8557 11896 1442 510 1865 C ATOM 23334 H LEU E 410 25.779 -83.590 -6.426 1.00146.86 H ATOM 23335 HA LEU E 410 25.184 -85.961 -5.550 1.00150.70 H ATOM 23336 HB2 LEU E 410 24.935 -84.893 -8.158 1.00147.97 H ATOM 23337 HB3 LEU E 410 24.370 -86.324 -7.779 1.00147.97 H ATOM 23338 HG LEU E 410 23.411 -84.023 -6.483 1.00128.55 H ATOM 23339 HD11 LEU E 410 21.619 -83.959 -7.958 1.00152.69 H ATOM 23340 HD12 LEU E 410 22.963 -83.702 -8.733 1.00152.69 H ATOM 23341 HD13 LEU E 410 22.270 -85.111 -8.807 1.00152.69 H ATOM 23342 HD21 LEU E 410 21.588 -85.361 -5.967 1.00127.91 H ATOM 23343 HD22 LEU E 410 22.245 -86.561 -6.742 1.00127.91 H ATOM 23344 HD23 LEU E 410 22.912 -86.016 -5.427 1.00127.91 H ATOM 23345 N ARG E 411 27.788 -85.839 -7.347 1.00122.46 N ATOM 23346 CA ARG E 411 28.952 -86.574 -7.823 1.00117.22 C ATOM 23347 C ARG E 411 29.848 -87.014 -6.664 1.00125.70 C ATOM 23348 O ARG E 411 30.742 -87.842 -6.842 1.00120.54 O ATOM 23349 CB ARG E 411 29.744 -85.709 -8.804 1.00122.56 C ATOM 23350 CG ARG E 411 30.865 -86.439 -9.524 1.00135.07 C ATOM 23351 CD ARG E 411 31.461 -85.571 -10.619 1.00128.01 C ATOM 23352 NE ARG E 411 30.534 -85.380 -11.734 1.00122.67 N ATOM 23353 CZ ARG E 411 30.717 -85.831 -12.975 1.00131.74 C ATOM 23354 NH1 ARG E 411 31.808 -86.508 -13.310 1.00124.03 N ATOM 23355 NH2 ARG E 411 29.800 -85.594 -13.900 1.00138.68 N ATOM 23356 H ARG E 411 27.843 -84.989 -7.461 1.00146.95 H ATOM 23357 HA ARG E 411 28.653 -87.377 -8.298 1.00140.67 H ATOM 23358 HB2 ARG E 411 29.136 -85.367 -9.477 1.00147.07 H ATOM 23359 HB3 ARG E 411 30.140 -84.970 -8.316 1.00147.07 H ATOM 23360 HG2 ARG E 411 31.567 -86.656 -8.891 1.00162.08 H ATOM 23361 HG3 ARG E 411 30.515 -87.246 -9.931 1.00162.08 H ATOM 23362 HD2 ARG E 411 31.678 -84.700 -10.253 1.00153.61 H ATOM 23363 HD3 ARG E 411 32.262 -85.998 -10.963 1.00153.61 H ATOM 23364 HE ARG E 411 29.811 -84.940 -11.576 1.00147.20 H ATOM 23365 HH11 ARG E 411 32.413 -86.669 -12.720 1.00148.84 H ATOM 23366 HH12 ARG E 411 31.909 -86.789 -14.117 1.00148.84 H ATOM 23367 HH21 ARG E 411 29.089 -85.154 -13.697 1.00166.41 H ATOM 23368 HH22 ARG E 411 29.914 -85.879 -14.703 1.00166.41 H