>>4NE1:HELIX   21  21 SER B   31  GLU B   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 21 21 SER B 31 GLU B 60 1 30 ATOM 7881 N SER B 31 44.346-111.274 -10.635 1.00297.59 N ANISOU 7881 N SER B 31 38528 35548 38992 1237 891 -2243 N ATOM 7882 CA SER B 31 43.337-112.210 -10.156 1.00306.87 C ANISOU 7882 CA SER B 31 39897 36407 40290 1144 915 -2204 C ATOM 7883 C SER B 31 42.050-111.471 -9.794 1.00314.90 C ANISOU 7883 C SER B 31 41169 37737 40740 990 865 -1903 C ATOM 7884 O SER B 31 42.084-110.304 -9.366 1.00329.07 O ANISOU 7884 O SER B 31 43048 39769 42213 1039 714 -1575 O ATOM 7885 CB SER B 31 43.862-112.978 -8.942 1.00304.23 C ANISOU 7885 CB SER B 31 39688 35398 40505 1333 663 -1890 C ATOM 7886 OG SER B 31 44.026-112.110 -7.830 1.00301.06 O ANISOU 7886 OG SER B 31 39526 35019 39843 1415 368 -1344 O ATOM 7887 N GLY B 32 40.926-112.168 -9.961 1.00316.06 N ANISOU 7887 N GLY B 32 41404 37850 40834 801 1008 -2046 N ATOM 7888 CA GLY B 32 39.579-111.598 -9.788 1.00311.88 C ANISOU 7888 CA GLY B 32 41046 37600 39853 619 1017 -1859 C ATOM 7889 C GLY B 32 39.215-111.098 -8.400 1.00306.08 C ANISOU 7889 C GLY B 32 40600 36694 39000 665 817 -1404 C ATOM 7890 O GLY B 32 38.569-110.062 -8.246 1.00300.70 O ANISOU 7890 O GLY B 32 39954 36308 37990 583 799 -1232 O ATOM 7891 N ASP B 33 39.627-111.831 -7.383 1.00304.68 N ANISOU 7891 N ASP B 33 40600 36041 39123 748 667 -1211 N ATOM 7892 CA ASP B 33 39.421-111.364 -6.033 1.00303.41 C ANISOU 7892 CA ASP B 33 40713 35780 38789 697 483 -797 C ATOM 7893 C ASP B 33 40.284-110.148 -5.676 1.00302.50 C ANISOU 7893 C ASP B 33 40557 35855 38523 826 337 -575 C ATOM 7894 O ASP B 33 39.775-109.274 -4.994 1.00302.72 O ANISOU 7894 O ASP B 33 40713 36052 38251 711 321 -392 O ATOM 7895 CB ASP B 33 39.570-112.506 -5.044 1.00307.53 C ANISOU 7895 CB ASP B 33 41436 35787 39624 651 310 -576 C ATOM 7896 CG ASP B 33 38.621-113.642 -5.337 1.00309.05 C ANISOU 7896 CG ASP B 33 41675 35789 39961 509 463 -786 C ATOM 7897 OD1 ASP B 33 37.603-113.409 -6.039 1.00300.60 O ANISOU 7897 OD1 ASP B 33 40563 35031 38617 390 696 -1040 O ATOM 7898 OD2 ASP B 33 38.905-114.761 -4.861 1.00316.51 O ANISOU 7898 OD2 ASP B 33 42675 36254 41329 505 324 -666 O ATOM 7899 N ALA B 34 41.541-110.063 -6.160 1.00301.69 N ANISOU 7899 N ALA B 34 40249 35730 38647 1040 266 -641 N ATOM 7900 CA ALA B 34 42.387-108.836 -6.022 1.00295.72 C ANISOU 7900 CA ALA B 34 39413 35208 37737 1171 152 -475 C ATOM 7901 C ALA B 34 41.778-107.562 -6.666 1.00291.69 C ANISOU 7901 C ALA B 34 38773 35196 36860 1102 276 -541 C ATOM 7902 O ALA B 34 41.939-106.458 -6.127 1.00283.12 O ANISOU 7902 O ALA B 34 37710 34260 35603 1121 194 -331 O ATOM 7903 CB ALA B 34 43.811-109.068 -6.533 1.00295.93 C ANISOU 7903 CB ALA B 34 39211 35114 38114 1399 82 -588 C ATOM 7904 N LEU B 35 41.086-107.723 -7.807 1.00294.54 N ANISOU 7904 N LEU B 35 38971 35800 37140 991 455 -813 N ATOM 7905 CA LEU B 35 40.316-106.629 -8.474 1.00288.25 C ANISOU 7905 CA LEU B 35 38010 35443 36066 859 516 -799 C ATOM 7906 C LEU B 35 39.011-106.258 -7.725 1.00280.04 C ANISOU 7906 C LEU B 35 37114 34371 34915 700 554 -655 C ATOM 7907 O LEU B 35 38.649-105.069 -7.640 1.00274.92 O ANISOU 7907 O LEU B 35 36347 33921 34190 661 530 -514 O ATOM 7908 CB LEU B 35 40.038-106.951 -9.960 1.00293.58 C ANISOU 7908 CB LEU B 35 38449 36439 36658 701 655 -1094 C ATOM 7909 CG LEU B 35 39.434-105.886 -10.887 1.00293.38 C ANISOU 7909 CG LEU B 35 38178 36908 36385 510 635 -1011 C ATOM 7910 CD1 LEU B 35 40.319-104.648 -10.984 1.00291.65 C ANISOU 7910 CD1 LEU B 35 37793 36904 36116 628 485 -807 C ATOM 7911 CD2 LEU B 35 39.172-106.483 -12.263 1.00294.39 C ANISOU 7911 CD2 LEU B 35 38119 37363 36369 246 771 -1313 C ATOM 7912 N GLN B 36 38.319-107.280 -7.203 1.00274.70 N ANISOU 7912 N GLN B 36 36658 33425 34290 595 626 -715 N ATOM 7913 CA AGLN B 36 37.169-107.076 -6.320 0.50274.09 C ANISOU 7913 CA AGLN B 36 36745 33271 34124 414 691 -626 C ATOM 7914 CA BGLN B 36 37.173-107.081 -6.318 0.50273.79 C ANISOU 7914 CA BGLN B 36 36708 33232 34087 415 691 -626 C ATOM 7915 C GLN B 36 37.615-106.242 -5.116 1.00280.14 C ANISOU 7915 C GLN B 36 37628 33975 34835 428 604 -409 C ATOM 7916 O GLN B 36 36.886-105.367 -4.670 1.00279.10 O ANISOU 7916 O GLN B 36 37455 33938 34651 295 690 -387 O ATOM 7917 CB AGLN B 36 36.573-108.411 -5.854 0.50268.61 C ANISOU 7917 CB AGLN B 36 36299 32274 33483 288 753 -698 C ATOM 7918 CB BGLN B 36 36.595-108.424 -5.857 0.50267.95 C ANISOU 7918 CB BGLN B 36 36217 32189 33403 291 751 -698 C ATOM 7919 CG AGLN B 36 35.814-109.206 -6.909 0.50265.44 C ANISOU 7919 CG AGLN B 36 35799 31943 33113 195 897 -956 C ATOM 7920 CG BGLN B 36 35.690-109.122 -6.864 0.50264.05 C ANISOU 7920 CG BGLN B 36 35625 31781 32919 177 904 -947 C ATOM 7921 CD AGLN B 36 34.438-108.645 -7.205 0.50263.43 C ANISOU 7921 CD AGLN B 36 35445 31913 32732 0 1016 -996 C ATOM 7922 CD BGLN B 36 34.413-108.352 -7.118 0.50261.32 C ANISOU 7922 CD BGLN B 36 35156 31680 32452 1 1006 -958 C ATOM 7923 OE1AGLN B 36 34.138-107.497 -6.886 0.50259.97 O ANISOU 7923 OE1AGLN B 36 34907 31607 32260 -28 1001 -866 O ATOM 7924 OE1BGLN B 36 34.322-107.168 -6.807 0.50257.11 O ANISOU 7924 OE1BGLN B 36 34514 31275 31900 3 973 -821 O ATOM 7925 NE2AGLN B 36 33.592-109.458 -7.824 0.50265.12 N ANISOU 7925 NE2AGLN B 36 35648 32144 32940 -143 1139 -1186 N ATOM 7926 NE2BGLN B 36 33.420-109.020 -7.690 0.50262.76 N ANISOU 7926 NE2BGLN B 36 35319 31899 32618 -160 1129 -1126 N ATOM 7927 N LEU B 37 38.829-106.528 -4.616 1.00300.55 N ANISOU 7927 N LEU B 37 40323 36392 37477 565 442 -272 N ATOM 7928 CA LEU B 37 39.530-105.762 -3.564 1.00319.60 C ANISOU 7928 CA LEU B 37 42832 38794 39805 565 325 -56 C ATOM 7929 C LEU B 37 39.780-104.314 -3.983 1.00319.19 C ANISOU 7929 C LEU B 37 42519 39031 39726 667 346 -55 C ATOM 7930 O LEU B 37 39.652-103.397 -3.174 1.00324.74 O ANISOU 7930 O LEU B 37 43239 39792 40352 557 385 8 O ATOM 7931 CB LEU B 37 40.895-106.402 -3.225 1.00326.81 C ANISOU 7931 CB LEU B 37 43834 39476 40860 720 95 119 C ATOM 7932 CG LEU B 37 41.109-107.420 -2.085 1.00335.26 C ANISOU 7932 CG LEU B 37 45195 40209 41979 562 -82 363 C ATOM 7933 CD1 LEU B 37 42.497-108.052 -2.177 1.00337.95 C ANISOU 7933 CD1 LEU B 37 45465 40283 42656 789 -331 514 C ATOM 7934 CD2 LEU B 37 40.912-106.809 -0.698 1.00336.74 C ANISOU 7934 CD2 LEU B 37 45609 40478 41857 254 -121 573 C ATOM 7935 N MET B 38 40.157-104.114 -5.241 1.00306.36 N ANISOU 7935 N MET B 38 40635 37593 38174 835 327 -139 N ATOM 7936 CA MET B 38 40.429-102.775 -5.748 1.00289.85 C ANISOU 7936 CA MET B 38 38266 35775 36086 913 298 -82 C ATOM 7937 C MET B 38 39.191-101.911 -5.911 1.00286.87 C ANISOU 7937 C MET B 38 37699 35532 35765 752 408 -95 C ATOM 7938 O MET B 38 39.253-100.697 -5.682 1.00286.40 O ANISOU 7938 O MET B 38 37460 35557 35802 763 397 -7 O ATOM 7939 CB MET B 38 41.235-102.842 -7.030 1.00278.32 C ANISOU 7939 CB MET B 38 36586 34520 34640 1055 231 -150 C ATOM 7940 CG MET B 38 42.689-103.139 -6.730 1.00269.77 C ANISOU 7940 CG MET B 38 35577 33300 33622 1258 107 -108 C ATOM 7941 SD MET B 38 43.285-102.150 -5.339 1.00256.81 S ANISOU 7941 SD MET B 38 34060 31575 31938 1305 -3 144 S ATOM 7942 CE MET B 38 43.381-100.522 -6.087 1.00260.66 C ANISOU 7942 CE MET B 38 34197 32422 32420 1356 -12 200 C ATOM 7943 N VAL B 39 38.084-102.547 -6.297 1.00279.45 N ANISOU 7943 N VAL B 39 36768 34578 34832 602 511 -210 N ATOM 7944 CA VAL B 39 36.745-101.953 -6.217 1.00272.77 C ANISOU 7944 CA VAL B 39 35765 33749 34124 418 627 -234 C ATOM 7945 C VAL B 39 36.484-101.362 -4.814 1.00283.39 C ANISOU 7945 C VAL B 39 37219 34922 35534 308 751 -261 C ATOM 7946 O VAL B 39 36.117-100.185 -4.694 1.00281.77 O ANISOU 7946 O VAL B 39 36739 34749 35572 263 804 -252 O ATOM 7947 CB VAL B 39 35.673-102.991 -6.599 1.00262.58 C ANISOU 7947 CB VAL B 39 34559 32413 32795 261 728 -371 C ATOM 7948 CG1 VAL B 39 34.282-102.543 -6.174 1.00260.62 C ANISOU 7948 CG1 VAL B 39 34206 32085 32732 59 876 -428 C ATOM 7949 CG2 VAL B 39 35.742-103.264 -8.089 1.00254.36 C ANISOU 7949 CG2 VAL B 39 33310 31642 31693 258 646 -383 C ATOM 7950 N GLU B 40 36.715-102.174 -3.767 1.00296.62 N ANISOU 7950 N GLU B 40 39266 36419 37017 221 789 -294 N ATOM 7951 CA GLU B 40 36.643-101.749 -2.333 1.00301.35 C ANISOU 7951 CA GLU B 40 40029 36928 37542 6 910 -336 C ATOM 7952 C GLU B 40 37.635-100.621 -1.952 1.00301.36 C ANISOU 7952 C GLU B 40 39913 37018 37570 99 849 -252 C ATOM 7953 O GLU B 40 37.234 -99.623 -1.346 1.00302.07 O ANISOU 7953 O GLU B 40 39852 37121 37799 -61 1023 -381 O ATOM 7954 CB GLU B 40 36.860-102.931 -1.352 1.00301.27 C ANISOU 7954 CB GLU B 40 40449 36759 37258 -168 869 -277 C ATOM 7955 CG GLU B 40 35.972-104.159 -1.530 1.00299.52 C ANISOU 7955 CG GLU B 40 40394 36407 37000 -285 925 -349 C ATOM 7956 CD GLU B 40 34.662-104.075 -0.771 1.00299.99 C ANISOU 7956 CD GLU B 40 40521 36439 37023 -648 1182 -544 C ATOM 7957 OE1 GLU B 40 33.918-105.073 -0.804 1.00300.93 O ANISOU 7957 OE1 GLU B 40 40800 36450 37090 -775 1234 -599 O ATOM 7958 OE2 GLU B 40 34.373-103.034 -0.136 1.00299.83 O ANISOU 7958 OE2 GLU B 40 40375 36491 37053 -827 1359 -681 O ATOM 7959 N LEU B 41 38.917-100.799 -2.285 1.00297.54 N ANISOU 7959 N LEU B 41 39477 36575 36997 342 628 -76 N ATOM 7960 CA LEU B 41 39.969 -99.828 -1.936 1.00282.99 C ANISOU 7960 CA LEU B 41 37550 34819 35152 444 546 22 C ATOM 7961 C LEU B 41 39.744 -98.437 -2.552 1.00272.02 C ANISOU 7961 C LEU B 41 35740 33559 34057 533 601 -12 C ATOM 7962 O LEU B 41 39.902 -97.416 -1.875 1.00270.18 O ANISOU 7962 O LEU B 41 35395 33338 33920 451 694 -65 O ATOM 7963 CB LEU B 41 41.336-100.387 -2.318 1.00279.15 C ANISOU 7963 CB LEU B 41 37154 34327 34580 702 297 200 C ATOM 7964 CG LEU B 41 42.610 -99.574 -2.090 1.00273.42 C ANISOU 7964 CG LEU B 41 36359 33689 33838 853 164 333 C ATOM 7965 CD1 LEU B 41 42.656 -98.851 -0.750 1.00274.30 C ANISOU 7965 CD1 LEU B 41 36578 33815 33827 602 255 326 C ATOM 7966 CD2 LEU B 41 43.783-100.524 -2.216 1.00272.39 C ANISOU 7966 CD2 LEU B 41 36375 33447 33673 1037 -63 481 C ATOM 7967 N LEU B 42 39.363 -98.406 -3.824 1.00261.63 N ANISOU 7967 N LEU B 42 34169 32338 32898 653 533 27 N ATOM 7968 CA LEU B 42 39.014 -97.162 -4.486 1.00254.35 C ANISOU 7968 CA LEU B 42 32806 31514 32320 686 518 85 C ATOM 7969 C LEU B 42 37.719 -96.569 -3.949 1.00257.69 C ANISOU 7969 C LEU B 42 33034 31784 33090 464 743 -82 C ATOM 7970 O LEU B 42 37.631 -95.361 -3.764 1.00262.62 O ANISOU 7970 O LEU B 42 33332 32362 34088 447 800 -99 O ATOM 7971 CB LEU B 42 38.915 -97.380 -5.983 1.00249.23 C ANISOU 7971 CB LEU B 42 31949 31062 31683 764 348 221 C ATOM 7972 CG LEU B 42 40.221 -97.455 -6.768 1.00244.06 C ANISOU 7972 CG LEU B 42 31284 30618 30830 954 153 347 C ATOM 7973 CD1 LEU B 42 39.907 -97.674 -8.238 1.00244.22 C ANISOU 7973 CD1 LEU B 42 31083 30903 30806 880 36 425 C ATOM 7974 CD2 LEU B 42 41.033 -96.184 -6.578 1.00240.09 C ANISOU 7974 CD2 LEU B 42 30577 30171 30472 1070 67 481 C ATOM 7975 N LYS B 43 36.729 -97.425 -3.696 1.00257.02 N ANISOU 7975 N LYS B 43 33121 31596 32936 286 886 -232 N ATOM 7976 CA LYS B 43 35.489 -97.024 -3.033 1.00257.57 C ANISOU 7976 CA LYS B 43 33042 31496 33325 33 1157 -473 C ATOM 7977 C LYS B 43 35.841 -96.274 -1.749 1.00265.94 C ANISOU 7977 C LYS B 43 34138 32489 34418 -122 1365 -673 C ATOM 7978 O LYS B 43 35.446 -95.123 -1.567 1.00269.81 O ANISOU 7978 O LYS B 43 34233 32877 35402 -192 1516 -814 O ATOM 7979 CB LYS B 43 34.599 -98.255 -2.780 1.00250.74 C ANISOU 7979 CB LYS B 43 32473 30554 32240 -151 1281 -613 C ATOM 7980 CG LYS B 43 33.535 -98.133 -1.694 1.00249.37 C ANISOU 7980 CG LYS B 43 32315 30222 32212 -492 1624 -946 C ATOM 7981 CD LYS B 43 33.315 -99.479 -1.009 1.00250.20 C ANISOU 7981 CD LYS B 43 32914 30301 31848 -698 1697 -1025 C ATOM 7982 CE LYS B 43 32.661 -99.330 0.359 1.00253.85 C ANISOU 7982 CE LYS B 43 33491 30696 32264 -1131 2044 -1364 C ATOM 7983 NZ LYS B 43 31.178 -99.302 0.292 1.00252.37 N ANISOU 7983 NZ LYS B 43 33081 30378 32429 -1329 2299 -1636 N ATOM 7984 N VAL B 44 36.635 -96.916 -0.893 1.00274.34 N ANISOU 7984 N VAL B 44 35639 33606 34990 -200 1352 -668 N ATOM 7985 CA VAL B 44 37.031 -96.335 0.397 1.00284.02 C ANISOU 7985 CA VAL B 44 36963 34848 36103 -451 1541 -851 C ATOM 7986 C VAL B 44 37.956 -95.111 0.236 1.00289.31 C ANISOU 7986 C VAL B 44 37351 35577 36996 -258 1462 -772 C ATOM 7987 O VAL B 44 37.902 -94.186 1.053 1.00296.58 O ANISOU 7987 O VAL B 44 38113 36473 38100 -476 1708 -1029 O ATOM 7988 CB VAL B 44 37.627 -97.391 1.379 1.00283.77 C ANISOU 7988 CB VAL B 44 37471 34881 35467 -664 1474 -770 C ATOM 7989 CG1 VAL B 44 37.794 -96.798 2.773 1.00285.55 C ANISOU 7989 CG1 VAL B 44 37791 35193 35511 -1088 1710 -998 C ATOM 7990 CG2 VAL B 44 36.734 -98.625 1.478 1.00280.87 C ANISOU 7990 CG2 VAL B 44 37368 34434 34914 -846 1521 -808 C ATOM 7991 N PHE B 45 38.774 -95.084 -0.817 1.00288.44 N ANISOU 7991 N PHE B 45 37154 35553 36886 109 1152 -462 N ATOM 7992 CA PHE B 45 39.592 -93.900 -1.105 1.00286.89 C ANISOU 7992 CA PHE B 45 36656 35415 36932 299 1056 -358 C ATOM 7993 C PHE B 45 38.725 -92.646 -1.225 1.00285.29 C ANISOU 7993 C PHE B 45 35919 35063 37412 223 1240 -524 C ATOM 7994 O PHE B 45 38.931 -91.665 -0.504 1.00282.93 O ANISOU 7994 O PHE B 45 35440 34707 37354 107 1428 -723 O ATOM 7995 CB PHE B 45 40.415 -94.071 -2.389 1.00286.06 C ANISOU 7995 CB PHE B 45 36485 35454 36749 647 715 -25 C ATOM 7996 CG PHE B 45 41.256 -92.856 -2.741 1.00290.02 C ANISOU 7996 CG PHE B 45 36674 36033 37487 825 594 114 C ATOM 7997 CD1 PHE B 45 42.616 -92.842 -2.468 1.00295.77 C ANISOU 7997 CD1 PHE B 45 37595 36873 37909 964 462 221 C ATOM 7998 CD2 PHE B 45 40.691 -91.714 -3.338 1.00289.27 C ANISOU 7998 CD2 PHE B 45 36060 35874 37976 842 587 168 C ATOM 7999 CE1 PHE B 45 43.399 -91.730 -2.779 1.00299.16 C ANISOU 7999 CE1 PHE B 45 37745 37378 38542 1120 357 343 C ATOM 8000 CE2 PHE B 45 41.470 -90.596 -3.649 1.00292.51 C ANISOU 8000 CE2 PHE B 45 36171 36337 38630 989 456 327 C ATOM 8001 CZ PHE B 45 42.828 -90.606 -3.369 1.00296.44 C ANISOU 8001 CZ PHE B 45 36903 36977 38752 1131 356 396 C ATOM 8002 N VAL B 46 37.766 -92.694 -2.152 1.00284.35 N ANISOU 8002 N VAL B 46 35519 34869 37650 270 1175 -437 N ATOM 8003 CA VAL B 46 36.891 -91.559 -2.457 1.00283.38 C ANISOU 8003 CA VAL B 46 34800 34542 38330 222 1261 -496 C ATOM 8004 C VAL B 46 36.011 -91.240 -1.258 1.00287.10 C ANISOU 8004 C VAL B 46 35180 34789 39115 -108 1709 -993 C ATOM 8005 O VAL B 46 35.828 -90.071 -0.946 1.00281.10 O ANISOU 8005 O VAL B 46 33971 33836 38997 -178 1888 -1189 O ATOM 8006 CB VAL B 46 36.015 -91.791 -3.720 1.00284.60 C ANISOU 8006 CB VAL B 46 34678 34688 38768 282 1038 -229 C ATOM 8007 CG1 VAL B 46 35.159 -90.568 -4.022 1.00283.92 C ANISOU 8007 CG1 VAL B 46 33904 34332 39637 227 1055 -203 C ATOM 8008 CG2 VAL B 46 36.878 -92.114 -4.929 1.00284.74 C ANISOU 8008 CG2 VAL B 46 34774 34998 38414 504 644 191 C ATOM 8009 N VAL B 47 35.493 -92.283 -0.597 1.00295.22 N ANISOU 8009 N VAL B 47 36614 35843 39711 -342 1901 -1216 N ATOM 8010 CA VAL B 47 34.716 -92.174 0.659 1.00303.97 C ANISOU 8010 CA VAL B 47 37737 36826 40928 -766 2370 -1746 C ATOM 8011 C VAL B 47 35.420 -91.294 1.706 1.00311.71 C ANISOU 8011 C VAL B 47 38681 37844 41908 -963 2615 -2039 C ATOM 8012 O VAL B 47 34.844 -90.320 2.187 1.00321.09 O ANISOU 8012 O VAL B 47 39430 38830 43737 -1177 2970 -2457 O ATOM 8013 CB VAL B 47 34.335 -93.585 1.245 1.00300.22 C ANISOU 8013 CB VAL B 47 37827 36463 39780 -1018 2460 -1842 C ATOM 8014 CG1 VAL B 47 34.034 -93.567 2.750 1.00297.94 C ANISOU 8014 CG1 VAL B 47 37727 36210 39266 -1555 2901 -2340 C ATOM 8015 CG2 VAL B 47 33.161 -94.190 0.489 1.00298.80 C ANISOU 8015 CG2 VAL B 47 37532 36159 39836 -976 2422 -1793 C ATOM 8016 N GLU B 48 36.664 -91.620 2.049 1.00310.09 N ANISOU 8016 N GLU B 48 38896 37883 41041 -909 2436 -1839 N ATOM 8017 CA GLU B 48 37.347 -90.884 3.112 1.00305.58 C ANISOU 8017 CA GLU B 48 38344 37407 40355 -1168 2665 -2112 C ATOM 8018 C GLU B 48 37.879 -89.547 2.611 1.00297.55 C ANISOU 8018 C GLU B 48 36826 36278 39949 -895 2596 -2046 C ATOM 8019 O GLU B 48 37.957 -88.594 3.380 1.00300.25 O ANISOU 8019 O GLU B 48 36924 36568 40590 -1142 2923 -2439 O ATOM 8020 CB GLU B 48 38.408 -91.742 3.818 1.00305.72 C ANISOU 8020 CB GLU B 48 38980 37714 39464 -1300 2493 -1912 C ATOM 8021 CG GLU B 48 37.821 -92.871 4.687 1.00298.31 C ANISOU 8021 CG GLU B 48 38494 36878 37973 -1755 2640 -2055 C ATOM 8022 CD GLU B 48 37.369 -92.410 6.073 1.00293.58 C ANISOU 8022 CD GLU B 48 37891 36381 37274 -2429 3138 -2622 C ATOM 8023 OE1 GLU B 48 38.121 -91.638 6.707 1.00292.38 O ANISOU 8023 OE1 GLU B 48 37690 36370 37030 -2611 3248 -2764 O ATOM 8024 OE2 GLU B 48 36.280 -92.826 6.535 1.00284.86 O ANISOU 8024 OE2 GLU B 48 36833 35244 36155 -2817 3440 -2955 O ATOM 8025 N ALA B 49 38.187 -89.472 1.314 1.00280.18 N ANISOU 8025 N ALA B 49 34449 34050 37957 -437 2191 -1575 N ATOM 8026 CA ALA B 49 38.416 -88.189 0.648 1.00266.14 C ANISOU 8026 CA ALA B 49 32098 32117 36903 -199 2083 -1447 C ATOM 8027 C ALA B 49 37.199 -87.278 0.875 1.00264.78 C ANISOU 8027 C ALA B 49 31315 31579 37710 -404 2439 -1853 C ATOM 8028 O ALA B 49 37.347 -86.160 1.375 1.00263.82 O ANISOU 8028 O ALA B 49 30809 31296 38133 -510 2684 -2153 O ATOM 8029 CB ALA B 49 38.706 -88.377 -0.839 1.00256.45 C ANISOU 8029 CB ALA B 49 30772 30966 35699 197 1594 -872 C ATOM 8030 N ALA B 50 36.001 -87.776 0.553 1.00263.20 N ANISOU 8030 N ALA B 50 31005 31226 37772 -479 2490 -1902 N ATOM 8031 CA ALA B 50 34.744 -87.043 0.779 1.00267.06 C ANISOU 8031 CA ALA B 50 30887 31317 39266 -689 2839 -2314 C ATOM 8032 C ALA B 50 34.435 -86.795 2.262 1.00272.46 C ANISOU 8032 C ALA B 50 31602 31950 39970 -1180 3463 -3080 C ATOM 8033 O ALA B 50 34.103 -85.672 2.614 1.00274.70 O ANISOU 8033 O ALA B 50 31300 31925 41148 -1317 3787 -3489 O ATOM 8034 CB ALA B 50 33.568 -87.730 0.086 1.00266.34 C ANISOU 8034 CB ALA B 50 30709 31105 39381 -669 2725 -2164 C ATOM 8035 N VAL B 51 34.554 -87.828 3.111 1.00276.18 N ANISOU 8035 N VAL B 51 32722 32725 39488 -1484 3627 -3269 N ATOM 8036 CA VAL B 51 34.288 -87.726 4.562 1.00280.80 C ANISOU 8036 CA VAL B 51 33422 33388 39880 -2085 4211 -3982 C ATOM 8037 C VAL B 51 35.144 -86.638 5.170 1.00287.77 C ANISOU 8037 C VAL B 51 34103 34307 40927 -2205 4411 -4247 C ATOM 8038 O VAL B 51 34.646 -85.810 5.911 1.00294.10 O ANISOU 8038 O VAL B 51 34483 34929 42330 -2587 4944 -4921 O ATOM 8039 CB VAL B 51 34.530 -89.049 5.343 1.00276.28 C ANISOU 8039 CB VAL B 51 33640 33214 38117 -2421 4214 -3959 C ATOM 8040 CG1 VAL B 51 34.391 -88.831 6.834 1.00274.11 C ANISOU 8040 CG1 VAL B 51 33475 33116 37557 -3142 4784 -4651 C ATOM 8041 CG2 VAL B 51 33.525 -90.112 4.948 1.00278.86 C ANISOU 8041 CG2 VAL B 51 34142 33480 38330 -2412 4142 -3850 C ATOM 8042 N ARG B 52 36.427 -86.630 4.837 1.00290.34 N ANISOU 8042 N ARG B 52 34696 34854 40763 -1889 4005 -3756 N ATOM 8043 CA ARG B 52 37.334 -85.608 5.357 1.00297.20 C ANISOU 8043 CA ARG B 52 35396 35781 41744 -1973 4151 -3956 C ATOM 8044 C ARG B 52 37.117 -84.208 4.772 1.00311.09 C ANISOU 8044 C ARG B 52 36338 37110 44751 -1722 4210 -4048 C ATOM 8045 O ARG B 52 37.312 -83.207 5.478 1.00324.78 O ANISOU 8045 O ARG B 52 37734 38749 46917 -1983 4604 -4555 O ATOM 8046 CB ARG B 52 38.782 -86.057 5.223 1.00280.37 C ANISOU 8046 CB ARG B 52 33794 34009 38724 -1730 3701 -3411 C ATOM 8047 CG ARG B 52 39.071 -87.233 6.125 1.00274.32 C ANISOU 8047 CG ARG B 52 33744 33623 36860 -2118 3708 -3405 C ATOM 8048 CD ARG B 52 40.488 -87.714 5.983 1.00267.02 C ANISOU 8048 CD ARG B 52 33282 32983 35191 -1866 3238 -2847 C ATOM 8049 NE ARG B 52 40.555 -89.066 6.499 1.00272.64 N ANISOU 8049 NE ARG B 52 34615 33940 35036 -2120 3097 -2658 N ATOM 8050 CZ ARG B 52 41.681 -89.712 6.723 1.00275.05 C ANISOU 8050 CZ ARG B 52 35380 34492 34632 -2080 2738 -2236 C ATOM 8051 NH1 ARG B 52 42.835 -89.116 6.466 1.00272.20 N ANISOU 8051 NH1 ARG B 52 34946 34194 34284 -1787 2514 -2000 N ATOM 8052 NH2 ARG B 52 41.647 -90.948 7.202 1.00280.12 N ANISOU 8052 NH2 ARG B 52 36526 35291 34615 -2340 2590 -2036 N ATOM 8053 N GLY B 53 36.719 -84.148 3.499 1.00315.15 N ANISOU 8053 N GLY B 53 36521 37371 45848 -1267 3810 -3548 N ATOM 8054 CA GLY B 53 36.251 -82.913 2.862 1.00321.59 C ANISOU 8054 CA GLY B 53 36486 37705 47999 -1072 3799 -3543 C ATOM 8055 C GLY B 53 35.066 -82.353 3.627 1.00333.41 C ANISOU 8055 C GLY B 53 37441 38809 50427 -1488 4429 -4338 C ATOM 8056 O GLY B 53 35.060 -81.169 3.973 1.00334.75 O ANISOU 8056 O GLY B 53 37008 38660 51522 -1597 4744 -4756 O ATOM 8057 N VAL B 54 34.079 -83.223 3.888 1.00337.22 N ANISOU 8057 N VAL B 54 38127 39309 50689 -1734 4629 -4577 N ATOM 8058 CA VAL B 54 32.906 -82.941 4.751 1.00344.85 C ANISOU 8058 CA VAL B 54 38693 39983 52348 -2228 5306 -5438 C ATOM 8059 C VAL B 54 33.298 -82.403 6.139 1.00360.11 C ANISOU 8059 C VAL B 54 40658 42070 54096 -2787 5949 -6264 C ATOM 8060 O VAL B 54 32.781 -81.364 6.545 1.00366.29 O ANISOU 8060 O VAL B 54 40725 42444 56003 -3021 6449 -6929 O ATOM 8061 CB VAL B 54 31.930 -84.164 4.865 1.00335.05 C ANISOU 8061 CB VAL B 54 37835 38860 50606 -2436 5389 -5519 C ATOM 8062 CG1 VAL B 54 30.977 -84.062 6.058 1.00338.31 C ANISOU 8062 CG1 VAL B 54 38061 39168 51314 -3097 6172 -6514 C ATOM 8063 CG2 VAL B 54 31.133 -84.337 3.581 1.00326.29 C ANISOU 8063 CG2 VAL B 54 36372 37432 50168 -2020 4945 -4960 C ATOM 8064 N ARG B 55 34.213 -83.076 6.844 1.00369.54 N ANISOU 8064 N ARG B 55 42627 43837 53944 -3027 5930 -6218 N ATOM 8065 CA ARG B 55 34.602 -82.669 8.219 1.00376.76 C ANISOU 8065 CA ARG B 55 43647 45019 54486 -3684 6523 -6977 C ATOM 8066 C ARG B 55 35.285 -81.296 8.339 1.00380.85 C ANISOU 8066 C ARG B 55 43634 45343 55728 -3626 6690 -7227 C ATOM 8067 O ARG B 55 35.104 -80.594 9.338 1.00379.66 O ANISOU 8067 O ARG B 55 43172 45163 55918 -4199 7363 -8105 O ATOM 8068 CB ARG B 55 35.432 -83.751 8.913 1.00376.84 C ANISOU 8068 CB ARG B 55 44597 45691 52893 -3988 6360 -6738 C ATOM 8069 CG ARG B 55 34.686 -85.058 9.107 1.00375.62 C ANISOU 8069 CG ARG B 55 44937 45729 52049 -4234 6345 -6679 C ATOM 8070 CD ARG B 55 35.439 -85.947 10.079 1.00381.27 C ANISOU 8070 CD ARG B 55 46462 47062 51338 -4733 6292 -6581 C ATOM 8071 NE ARG B 55 35.660 -87.312 9.580 1.00379.92 N ANISOU 8071 NE ARG B 55 46927 47083 50343 -4434 5711 -5819 N ATOM 8072 CZ ARG B 55 36.847 -87.812 9.223 1.00379.77 C ANISOU 8072 CZ ARG B 55 47362 47290 49643 -4066 5131 -5097 C ATOM 8073 NH1 ARG B 55 37.944 -87.068 9.292 1.00387.84 N ANISOU 8073 NH1 ARG B 55 48313 48409 50638 -3935 5022 -4988 N ATOM 8074 NH2 ARG B 55 36.939 -89.066 8.794 1.00370.82 N ANISOU 8074 NH2 ARG B 55 46725 46261 47905 -3835 4676 -4510 N ATOM 8075 N GLN B 56 36.043 -80.900 7.320 1.00383.54 N ANISOU 8075 N GLN B 56 43845 45555 56327 -2978 6111 -6500 N ATOM 8076 CA GLN B 56 36.635 -79.558 7.295 1.00385.45 C ANISOU 8076 CA GLN B 56 43516 45541 57394 -2860 6216 -6666 C ATOM 8077 C GLN B 56 35.627 -78.421 6.983 1.00390.08 C ANISOU 8077 C GLN B 56 43045 45385 59782 -2804 6524 -7091 C ATOM 8078 O GLN B 56 35.683 -77.359 7.610 1.00400.63 O ANISOU 8078 O GLN B 56 43843 46481 61895 -3091 7038 -7780 O ATOM 8079 CB GLN B 56 37.863 -79.525 6.376 1.00378.69 C ANISOU 8079 CB GLN B 56 42904 44849 56129 -2253 5500 -5755 C ATOM 8080 CG GLN B 56 38.705 -78.250 6.462 1.00375.98 C ANISOU 8080 CG GLN B 56 42129 44362 56363 -2165 5574 -5876 C ATOM 8081 CD GLN B 56 39.610 -78.162 7.683 1.00375.39 C ANISOU 8081 CD GLN B 56 42471 44755 55404 -2657 5939 -6351 C ATOM 8082 OE1 GLN B 56 39.821 -79.146 8.392 1.00376.58 O ANISOU 8082 OE1 GLN B 56 43332 45410 54340 -3024 5995 -6405 O ATOM 8083 NE2 GLN B 56 40.166 -76.968 7.926 1.00373.41 N ANISOU 8083 NE2 GLN B 56 41759 44337 55779 -2694 6160 -6660 N ATOM 8084 N ALA B 57 34.717 -78.645 6.031 1.00382.99 N ANISOU 8084 N ALA B 57 41821 44111 59583 -2463 6209 -6683 N ATOM 8085 CA ALA B 57 33.638 -77.693 5.709 1.00384.92 C ANISOU 8085 CA ALA B 57 41031 43598 61623 -2424 6436 -7007 C ATOM 8086 C ALA B 57 32.797 -77.361 6.938 1.00398.25 C ANISOU 8086 C ALA B 57 42349 45091 63874 -3105 7370 -8234 C ATOM 8087 O ALA B 57 32.537 -76.194 7.221 1.00401.72 O ANISOU 8087 O ALA B 57 41950 45009 65674 -3247 7808 -8844 O ATOM 8088 CB ALA B 57 32.758 -78.251 4.607 1.00373.16 C ANISOU 8088 CB ALA B 57 39403 41870 60507 -2065 5937 -6356 C ATOM 8089 N GLN B 58 32.392 -78.413 7.655 1.00412.60 N ANISOU 8089 N GLN B 58 44791 47339 64637 -3552 7672 -8594 N ATOM 8090 CA GLN B 58 31.736 -78.332 8.973 1.00437.97 C ANISOU 8090 CA GLN B 58 47883 50606 67918 -4360 8591 -9793 C ATOM 8091 C GLN B 58 32.557 -77.470 9.939 1.00452.18 C ANISOU 8091 C GLN B 58 49581 52587 69640 -4802 9108 -10483 C ATOM 8092 O GLN B 58 32.010 -76.600 10.626 1.00462.19 O ANISOU 8092 O GLN B 58 50142 53499 71970 -5273 9868 -11513 O ATOM 8093 CB GLN B 58 31.577 -79.742 9.619 1.00439.86 C ANISOU 8093 CB GLN B 58 49063 51504 66559 -4803 8675 -9847 C ATOM 8094 CG GLN B 58 30.472 -80.676 9.088 1.00442.00 C ANISOU 8094 CG GLN B 58 49429 51637 66872 -4662 8483 -9579 C ATOM 8095 CD GLN B 58 30.342 -82.022 9.838 1.00440.67 C ANISOU 8095 CD GLN B 58 50163 52106 65163 -5170 8607 -9683 C ATOM 8096 OE1 GLN B 58 31.305 -82.790 9.967 1.00432.98 O ANISOU 8096 OE1 GLN B 58 50015 51705 62792 -5145 8215 -9139 O ATOM 8097 NE2 GLN B 58 29.130 -82.315 10.311 1.00442.22 N ANISOU 8097 NE2 GLN B 58 50165 52169 65687 -5637 9132 -10357 N ATOM 8098 N ALA B 59 33.868 -77.742 9.982 1.00457.76 N ANISOU 8098 N ALA B 59 50979 53848 69099 -4669 8702 -9931 N ATOM 8099 CA ALA B 59 34.766 -77.255 11.039 1.00467.68 C ANISOU 8099 CA ALA B 59 52417 55512 69765 -5204 9138 -10505 C ATOM 8100 C ALA B 59 34.991 -75.752 11.023 1.00470.82 C ANISOU 8100 C ALA B 59 51926 55390 71572 -5125 9449 -10964 C ATOM 8101 O ALA B 59 34.864 -75.099 12.056 1.00480.01 O ANISOU 8101 O ALA B 59 52752 56566 73064 -5808 10249 -12033 O ATOM 8102 CB ALA B 59 36.099 -78.001 11.022 1.00463.89 C ANISOU 8102 CB ALA B 59 52890 55722 67645 -5040 8544 -9703 C ATOM 8103 N GLU B 60 35.323 -75.191 9.869 1.00462.39 N ATOM 8104 CA GLU B 60 35.445 -73.738 9.789 1.00452.63 C ATOM 8105 C GLU B 60 34.085 -73.144 9.460 1.00436.35 C ATOM 8106 O GLU B 60 33.953 -71.928 9.295 1.00424.44 O ATOM 8107 CB GLU B 60 36.507 -73.326 8.778 1.00469.58 C ATOM 8108 CG GLU B 60 36.412 -74.062 7.451 1.00484.23 C ATOM 8109 CD GLU B 60 37.714 -74.045 6.657 1.00489.22 C ATOM 8110 OE1 GLU B 60 37.773 -73.307 5.646 1.00495.77 O ATOM 8111 OE2 GLU B 60 38.674 -74.765 7.035 1.00485.45 O