>>4NE1:HELIX    6   6 SER D   31  GLU D   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 6 6 SER D 31 GLU D 60 1 30 ATOM 5211 N SER D 31 25.604 -20.439 -14.056 1.00391.09 N ANISOU 5211 N SER D 31 54482 44074 50040 -1933 -5540 8197 N ATOM 5212 CA SER D 31 25.961 -19.420 -13.037 1.00398.14 C ANISOU 5212 CA SER D 31 55476 44484 51313 -1967 -6075 8227 C ATOM 5213 C SER D 31 27.129 -19.900 -12.179 1.00400.69 C ANISOU 5213 C SER D 31 55672 45018 51551 -1887 -5826 8214 C ATOM 5214 O SER D 31 27.431 -21.103 -12.148 1.00407.94 O ANISOU 5214 O SER D 31 56478 46359 52162 -1696 -5224 8042 O ATOM 5215 CB SER D 31 24.760 -19.025 -12.146 1.00397.88 C ANISOU 5215 CB SER D 31 55726 43836 51612 -1616 -6343 7721 C ATOM 5216 OG SER D 31 24.540 -19.935 -11.069 1.00396.64 O ANISOU 5216 OG SER D 31 55635 43672 51398 -1163 -5925 7195 O ATOM 5217 N GLY D 32 27.774 -18.962 -11.482 1.00399.85 N ANISOU 5217 N GLY D 32 55587 44606 51731 -2029 -6306 8389 N ATOM 5218 CA GLY D 32 28.974 -19.255 -10.689 1.00399.36 C ANISOU 5218 CA GLY D 32 55396 44725 51615 -2008 -6146 8443 C ATOM 5219 C GLY D 32 28.810 -20.344 -9.637 1.00395.23 C ANISOU 5219 C GLY D 32 54929 44241 50999 -1530 -5642 7898 C ATOM 5220 O GLY D 32 29.546 -21.349 -9.644 1.00394.41 O ANISOU 5220 O GLY D 32 54655 44603 50600 -1468 -5129 7904 O ATOM 5221 N ASP D 33 27.850 -20.150 -8.744 1.00391.67 N ANISOU 5221 N ASP D 33 54701 43320 50793 -1195 -5798 7431 N ATOM 5222 CA ASP D 33 27.591 -21.092 -7.652 1.00385.55 C ANISOU 5222 CA ASP D 33 53987 42546 49958 -745 -5382 6911 C ATOM 5223 C ASP D 33 27.114 -22.465 -8.154 1.00378.40 C ANISOU 5223 C ASP D 33 53033 42031 48709 -536 -4726 6690 C ATOM 5224 O ASP D 33 27.520 -23.496 -7.610 1.00364.30 O ANISOU 5224 O ASP D 33 51169 40501 46744 -317 -4260 6493 O ATOM 5225 CB ASP D 33 26.592 -20.492 -6.643 1.00392.59 C ANISOU 5225 CB ASP D 33 55109 42878 51177 -449 -5739 6467 C ATOM 5226 CG ASP D 33 27.202 -19.442 -5.718 1.00403.10 C ANISOU 5226 CG ASP D 33 56475 43848 52835 -518 -6276 6534 C ATOM 5227 OD1 ASP D 33 28.394 -19.089 -5.877 1.00409.24 O ANISOU 5227 OD1 ASP D 33 57110 44770 53611 -828 -6414 6964 O ATOM 5228 OD2 ASP D 33 26.454 -18.954 -4.844 1.00410.61 O ANISOU 5228 OD2 ASP D 33 57591 44376 54045 -256 -6575 6145 O ATOM 5229 N ALA D 34 26.277 -22.474 -9.197 1.00385.22 N ANISOU 5229 N ALA D 34 53938 42935 49490 -612 -4710 6731 N ATOM 5230 CA ALA D 34 25.808 -23.718 -9.822 1.00386.32 C ANISOU 5230 CA ALA D 34 54027 43443 49312 -446 -4132 6552 C ATOM 5231 C ALA D 34 26.934 -24.615 -10.361 1.00379.17 C ANISOU 5231 C ALA D 34 52866 43132 48068 -570 -3679 6796 C ATOM 5232 O ALA D 34 26.877 -25.843 -10.215 1.00368.73 O ANISOU 5232 O ALA D 34 51494 42072 46535 -308 -3157 6525 O ATOM 5233 CB ALA D 34 24.815 -23.407 -10.926 1.00403.10 C ANISOU 5233 CB ALA D 34 56227 45509 51422 -563 -4263 6621 C ATOM 5234 N LEU D 35 27.941 -23.999 -10.988 1.00376.12 N ANISOU 5234 N LEU D 35 52310 42962 47636 -969 -3899 7305 N ATOM 5235 CA LEU D 35 29.070 -24.726 -11.579 1.00366.78 C ANISOU 5235 CA LEU D 35 50852 42386 46121 -1120 -3521 7569 C ATOM 5236 C LEU D 35 30.045 -25.251 -10.527 1.00358.21 C ANISOU 5236 C LEU D 35 49684 41400 45018 -962 -3302 7460 C ATOM 5237 O LEU D 35 30.586 -26.345 -10.676 1.00361.28 O ANISOU 5237 O LEU D 35 49908 42227 45134 -850 -2816 7391 O ATOM 5238 CB LEU D 35 29.805 -23.846 -12.584 1.00368.96 C ANISOU 5238 CB LEU D 35 50954 42890 46341 -1620 -3852 8171 C ATOM 5239 CG LEU D 35 30.695 -24.570 -13.586 1.00366.09 C ANISOU 5239 CG LEU D 35 50284 43242 45571 -1804 -3465 8451 C ATOM 5240 CD1 LEU D 35 29.897 -25.523 -14.461 1.00358.60 C ANISOU 5240 CD1 LEU D 35 49314 42576 44359 -1637 -3043 8224 C ATOM 5241 CD2 LEU D 35 31.389 -23.530 -14.442 1.00370.22 C ANISOU 5241 CD2 LEU D 35 50639 43952 46074 -2325 -3878 9076 C ATOM 5242 N GLN D 36 30.262 -24.449 -9.481 1.00344.53 N ANISOU 5242 N GLN D 36 48062 39256 43586 -952 -3684 7440 N ATOM 5243 CA GLN D 36 30.927 -24.881 -8.251 0.50333.20 C ANISOU 5243 CA GLN D 36 46610 37794 42197 -734 -3520 7241 C ATOM 5244 C GLN D 36 30.234 -26.101 -7.657 1.00329.42 C ANISOU 5244 C GLN D 36 46212 37325 41624 -289 -3043 6721 C ATOM 5245 O GLN D 36 30.895 -27.007 -7.154 1.00329.35 O ANISOU 5245 O GLN D 36 46095 37565 41477 -130 -2669 6607 O ATOM 5246 CB GLN D 36 30.903 -23.762 -7.208 0.50327.17 C ANISOU 5246 CB GLN D 36 46001 36499 41807 -736 -4054 7203 C ATOM 5247 CG GLN D 36 32.199 -22.997 -7.062 0.50325.87 C ANISOU 5247 CG GLN D 36 45700 36388 41725 -1060 -4368 7636 C ATOM 5248 CD GLN D 36 33.246 -23.801 -6.332 0.50321.62 C ANISOU 5248 CD GLN D 36 45019 36135 41045 -932 -3999 7578 C ATOM 5249 OE1 GLN D 36 34.384 -23.901 -6.778 0.50321.68 O ANISOU 5249 OE1 GLN D 36 44806 36540 40877 -1183 -3904 7947 O ATOM 5250 NE2 GLN D 36 32.866 -24.385 -5.207 0.50317.84 N ANISOU 5250 NE2 GLN D 36 44653 35477 40635 -544 -3793 7120 N ATOM 5251 N LEU D 37 28.900 -26.105 -7.691 1.00329.34 N ANISOU 5251 N LEU D 37 46393 37037 41702 -95 -3080 6414 N ATOM 5252 CA LEU D 37 28.115 -27.235 -7.175 1.00329.55 C ANISOU 5252 CA LEU D 37 46503 37065 41646 307 -2658 5938 C ATOM 5253 C LEU D 37 28.137 -28.438 -8.125 1.00327.64 C ANISOU 5253 C LEU D 37 46122 37288 41078 348 -2145 5929 C ATOM 5254 O LEU D 37 28.031 -29.597 -7.698 1.00324.54 O ANISOU 5254 O LEU D 37 45710 37033 40568 634 -1724 5633 O ATOM 5255 CB LEU D 37 26.682 -26.807 -6.828 1.00331.84 C ANISOU 5255 CB LEU D 37 47033 36912 42140 505 -2888 5605 C ATOM 5256 CG LEU D 37 26.481 -26.041 -5.508 1.00336.32 C ANISOU 5256 CG LEU D 37 47741 37036 43007 653 -3259 5388 C ATOM 5257 CD1 LEU D 37 24.996 -25.812 -5.244 1.00335.58 C ANISOU 5257 CD1 LEU D 37 47854 36595 43057 891 -3409 5009 C ATOM 5258 CD2 LEU D 37 27.137 -26.716 -4.301 1.00338.60 C ANISOU 5258 CD2 LEU D 37 47968 37413 43270 873 -3006 5200 C ATOM 5259 N MET D 38 28.297 -28.160 -9.413 1.00328.38 N ANISOU 5259 N MET D 38 46107 37633 41027 56 -2200 6260 N ATOM 5260 CA MET D 38 28.519 -29.217 -10.390 1.00326.13 C ANISOU 5260 CA MET D 38 45645 37853 40415 61 -1748 6291 C ATOM 5261 C MET D 38 29.907 -29.830 -10.244 1.00328.65 C ANISOU 5261 C MET D 38 45725 38590 40555 21 -1482 6437 C ATOM 5262 O MET D 38 30.068 -31.047 -10.351 1.00326.45 O ANISOU 5262 O MET D 38 45341 38618 40074 226 -1031 6241 O ATOM 5263 CB MET D 38 28.251 -28.714 -11.806 1.00324.19 C ANISOU 5263 CB MET D 38 45338 37788 40051 -238 -1894 6597 C ATOM 5264 CG MET D 38 26.766 -28.708 -12.132 1.00317.51 C ANISOU 5264 CG MET D 38 44695 36669 39275 -92 -1929 6338 C ATOM 5265 SD MET D 38 25.866 -30.072 -11.348 1.00308.39 S ANISOU 5265 SD MET D 38 43669 35407 38096 416 -1472 5741 S ATOM 5266 CE MET D 38 26.445 -31.485 -12.277 1.00312.98 C ANISOU 5266 CE MET D 38 44001 36618 38297 466 -911 5742 C ATOM 5267 N VAL D 39 30.891 -28.975 -9.977 1.00331.29 N ANISOU 5267 N VAL D 39 45978 38916 40981 -236 -1784 6773 N ATOM 5268 CA VAL D 39 32.219 -29.391 -9.518 1.00325.63 C ANISOU 5268 CA VAL D 39 45068 38494 40163 -253 -1604 6887 C ATOM 5269 C VAL D 39 32.118 -30.366 -8.312 1.00313.58 C ANISOU 5269 C VAL D 39 43617 36836 38691 148 -1295 6456 C ATOM 5270 O VAL D 39 32.792 -31.411 -8.294 1.00306.14 O ANISOU 5270 O VAL D 39 42509 36251 37557 273 -903 6381 O ATOM 5271 CB VAL D 39 33.076 -28.139 -9.195 1.00331.55 C ANISOU 5271 CB VAL D 39 45782 39103 41087 -574 -2072 7278 C ATOM 5272 CG1 VAL D 39 34.264 -28.474 -8.303 1.00330.66 C ANISOU 5272 CG1 VAL D 39 45545 39126 40962 -517 -1941 7300 C ATOM 5273 CG2 VAL D 39 33.518 -27.454 -10.481 1.00336.90 C ANISOU 5273 CG2 VAL D 39 46289 40095 41623 -1006 -2281 7778 C ATOM 5274 N GLU D 40 31.268 -30.013 -7.333 1.00305.56 N ANISOU 5274 N GLU D 40 42838 35326 37934 343 -1488 6179 N ATOM 5275 CA GLU D 40 30.952 -30.857 -6.159 1.00295.39 C ANISOU 5275 CA GLU D 40 41639 33883 36709 718 -1239 5765 C ATOM 5276 C GLU D 40 30.300 -32.171 -6.584 1.00287.65 C ANISOU 5276 C GLU D 40 40648 33102 35543 968 -784 5479 C ATOM 5277 O GLU D 40 30.786 -33.245 -6.220 1.00284.00 O ANISOU 5277 O GLU D 40 40081 32855 34970 1151 -429 5337 O ATOM 5278 CB GLU D 40 30.022 -30.141 -5.156 1.00295.13 C ANISOU 5278 CB GLU D 40 41847 33325 36962 867 -1563 5519 C ATOM 5279 CG GLU D 40 30.631 -28.985 -4.371 1.00297.93 C ANISOU 5279 CG GLU D 40 42235 33415 37550 721 -2006 5685 C ATOM 5280 CD GLU D 40 31.340 -29.400 -3.098 1.00296.88 C ANISOU 5280 CD GLU D 40 42058 33278 37463 897 -1879 5546 C ATOM 5281 OE1 GLU D 40 31.991 -28.541 -2.467 1.00298.07 O ANISOU 5281 OE1 GLU D 40 42208 33260 37783 774 -2211 5695 O ATOM 5282 OE2 GLU D 40 31.250 -30.588 -2.740 1.00295.13 O ANISOU 5282 OE2 GLU D 40 41800 33221 37114 1151 -1462 5298 O ATOM 5283 N LEU D 41 29.209 -32.081 -7.351 1.00284.11 N ANISOU 5283 N LEU D 41 40305 32568 35074 972 -817 5399 N ATOM 5284 CA LEU D 41 28.440 -33.259 -7.780 1.00281.89 C ANISOU 5284 CA LEU D 41 40037 32424 34643 1208 -430 5115 C ATOM 5285 C LEU D 41 29.262 -34.233 -8.641 1.00287.88 C ANISOU 5285 C LEU D 41 40554 33705 35122 1177 -60 5215 C ATOM 5286 O LEU D 41 29.156 -35.461 -8.488 1.00286.12 O ANISOU 5286 O LEU D 41 40289 33616 34805 1433 303 4954 O ATOM 5287 CB LEU D 41 27.152 -32.824 -8.481 1.00276.47 C ANISOU 5287 CB LEU D 41 39507 31541 33995 1183 -583 5046 C ATOM 5288 CG LEU D 41 26.065 -33.836 -8.850 1.00270.52 C ANISOU 5288 CG LEU D 41 38826 30816 33144 1430 -273 4728 C ATOM 5289 CD1 LEU D 41 25.874 -34.964 -7.839 1.00264.43 C ANISOU 5289 CD1 LEU D 41 38085 29995 32391 1769 30 4380 C ATOM 5290 CD2 LEU D 41 24.766 -33.078 -9.021 1.00270.00 C ANISOU 5290 CD2 LEU D 41 38969 30397 33218 1426 -550 4632 C ATOM 5291 N LEU D 42 30.104 -33.676 -9.511 1.00299.07 N ANISOU 5291 N LEU D 42 41797 35423 36411 862 -176 5593 N ATOM 5292 CA LEU D 42 31.075 -34.462 -10.277 1.00310.75 C ANISOU 5292 CA LEU D 42 43003 37455 37611 810 132 5713 C ATOM 5293 C LEU D 42 32.214 -35.026 -9.428 1.00314.60 C ANISOU 5293 C LEU D 42 43357 38089 38087 913 304 5689 C ATOM 5294 O LEU D 42 32.676 -36.144 -9.659 1.00326.83 O ANISOU 5294 O LEU D 42 44743 39978 39460 1068 658 5558 O ATOM 5295 CB LEU D 42 31.673 -33.631 -11.411 1.00315.66 C ANISOU 5295 CB LEU D 42 43454 38399 38083 418 -65 6155 C ATOM 5296 CG LEU D 42 30.991 -33.495 -12.774 1.00318.31 C ANISOU 5296 CG LEU D 42 43762 38922 38259 276 -74 6250 C ATOM 5297 CD1 LEU D 42 31.995 -32.902 -13.748 1.00322.64 C ANISOU 5297 CD1 LEU D 42 44049 39938 38601 -110 -198 6720 C ATOM 5298 CD2 LEU D 42 30.457 -34.821 -13.293 1.00317.21 C ANISOU 5298 CD2 LEU D 42 43580 39006 37936 557 348 5912 C ATOM 5299 N LYS D 43 32.676 -34.231 -8.470 1.00309.73 N ANISOU 5299 N LYS D 43 42804 37215 37664 826 33 5812 N ATOM 5300 CA LYS D 43 33.669 -34.667 -7.503 1.00305.56 C ANISOU 5300 CA LYS D 43 42182 36751 37164 932 158 5778 C ATOM 5301 C LYS D 43 33.138 -35.860 -6.637 1.00307.63 C ANISOU 5301 C LYS D 43 42539 36862 37484 1326 462 5347 C ATOM 5302 O LYS D 43 33.867 -36.847 -6.447 1.00310.91 O ANISOU 5302 O LYS D 43 42800 37536 37793 1466 755 5261 O ATOM 5303 CB LYS D 43 34.121 -33.446 -6.697 1.00296.09 C ANISOU 5303 CB LYS D 43 41055 35263 36179 746 -245 5995 C ATOM 5304 CG LYS D 43 35.210 -33.661 -5.676 1.00287.70 C ANISOU 5304 CG LYS D 43 39900 34246 35164 802 -187 6016 C ATOM 5305 CD LYS D 43 35.583 -32.347 -5.041 1.00283.31 C ANISOU 5305 CD LYS D 43 39419 33401 34824 592 -632 6248 C ATOM 5306 CE LYS D 43 35.809 -32.500 -3.544 1.00278.93 C ANISOU 5306 CE LYS D 43 38944 32588 34446 803 -637 6042 C ATOM 5307 NZ LYS D 43 37.116 -33.100 -3.143 1.00277.16 N ANISOU 5307 NZ LYS D 43 38519 32668 34119 817 -418 6129 N ATOM 5308 N VAL D 44 31.877 -35.796 -6.171 1.00308.94 N ANISOU 5308 N VAL D 44 42939 36637 37807 1497 386 5088 N ATOM 5309 CA VAL D 44 31.197 -36.910 -5.418 1.00308.87 C ANISOU 5309 CA VAL D 44 43022 36487 37847 1848 651 4699 C ATOM 5310 C VAL D 44 31.004 -38.151 -6.279 1.00310.93 C ANISOU 5310 C VAL D 44 43178 37043 37915 1992 1015 4547 C ATOM 5311 O VAL D 44 31.121 -39.288 -5.813 1.00303.04 O ANISOU 5311 O VAL D 44 42133 36106 36902 2229 1286 4330 O ATOM 5312 CB VAL D 44 29.804 -36.505 -4.860 1.00308.80 C ANISOU 5312 CB VAL D 44 43267 36043 38017 1977 473 4469 C ATOM 5313 CG1 VAL D 44 29.057 -37.703 -4.269 1.00304.62 C ANISOU 5313 CG1 VAL D 44 42805 35434 37500 2303 755 4111 C ATOM 5314 CG2 VAL D 44 29.951 -35.419 -3.807 1.00314.40 C ANISOU 5314 CG2 VAL D 44 44079 36440 38938 1912 121 4530 C ATOM 5315 N PHE D 45 30.691 -37.902 -7.540 1.00323.87 N ANISOU 5315 N PHE D 45 44780 38856 39419 1842 994 4662 N ATOM 5316 CA PHE D 45 30.563 -38.937 -8.534 1.00337.89 C ANISOU 5316 CA PHE D 45 46433 40954 40993 1945 1300 4542 C ATOM 5317 C PHE D 45 31.852 -39.768 -8.688 1.00338.74 C ANISOU 5317 C PHE D 45 46276 41488 40940 1983 1549 4584 C ATOM 5318 O PHE D 45 31.809 -40.994 -8.543 1.00340.03 O ANISOU 5318 O PHE D 45 46392 41730 41074 2242 1827 4323 O ATOM 5319 CB PHE D 45 30.139 -38.288 -9.845 1.00351.88 C ANISOU 5319 CB PHE D 45 48191 42867 42640 1721 1177 4723 C ATOM 5320 CG PHE D 45 30.100 -39.223 -10.998 1.00361.18 C ANISOU 5320 CG PHE D 45 49210 44437 43581 1793 1464 4628 C ATOM 5321 CD1 PHE D 45 29.095 -40.178 -11.100 1.00361.59 C ANISOU 5321 CD1 PHE D 45 49364 44378 43645 2058 1669 4292 C ATOM 5322 CD2 PHE D 45 31.066 -39.148 -11.993 1.00366.66 C ANISOU 5322 CD2 PHE D 45 49641 45636 44035 1595 1517 4872 C ATOM 5323 CE1 PHE D 45 29.052 -41.048 -12.181 1.00364.13 C ANISOU 5323 CE1 PHE D 45 49537 45057 43758 2139 1915 4180 C ATOM 5324 CE2 PHE D 45 31.030 -40.013 -13.079 1.00367.04 C ANISOU 5324 CE2 PHE D 45 49523 46083 43850 1679 1775 4753 C ATOM 5325 CZ PHE D 45 30.022 -40.966 -13.173 1.00365.62 C ANISOU 5325 CZ PHE D 45 49457 45760 43701 1959 1970 4397 C ATOM 5326 N VAL D 46 32.981 -39.104 -8.962 1.00338.47 N ANISOU 5326 N VAL D 46 46068 41721 40813 1729 1433 4909 N ATOM 5327 CA VAL D 46 34.298 -39.771 -9.106 1.00330.73 C ANISOU 5327 CA VAL D 46 44813 41180 39667 1745 1642 4971 C ATOM 5328 C VAL D 46 34.760 -40.511 -7.838 1.00322.01 C ANISOU 5328 C VAL D 46 43720 39928 38699 1980 1773 4784 C ATOM 5329 O VAL D 46 35.207 -41.661 -7.927 1.00320.01 O ANISOU 5329 O VAL D 46 43317 39916 38354 2179 2047 4606 O ATOM 5330 CB VAL D 46 35.416 -38.791 -9.555 1.00334.82 C ANISOU 5330 CB VAL D 46 45143 42007 40065 1394 1453 5395 C ATOM 5331 CG1 VAL D 46 36.779 -39.471 -9.519 1.00332.54 C ANISOU 5331 CG1 VAL D 46 44576 42151 39622 1435 1662 5434 C ATOM 5332 CG2 VAL D 46 35.128 -38.226 -10.939 1.00337.97 C ANISOU 5332 CG2 VAL D 46 45463 42671 40278 1147 1359 5609 C ATOM 5333 N VAL D 47 34.664 -39.832 -6.684 1.00314.31 N ANISOU 5333 N VAL D 47 42912 38568 37942 1956 1560 4824 N ATOM 5334 CA VAL D 47 34.985 -40.376 -5.346 1.00308.19 C ANISOU 5334 CA VAL D 47 42175 37604 37318 2158 1638 4666 C ATOM 5335 C VAL D 47 34.177 -41.641 -5.044 1.00308.74 C ANISOU 5335 C VAL D 47 42324 37545 37438 2483 1883 4301 C ATOM 5336 O VAL D 47 34.735 -42.640 -4.619 1.00310.69 O ANISOU 5336 O VAL D 47 42463 37903 37682 2662 2088 4171 O ATOM 5337 CB VAL D 47 34.835 -39.294 -4.227 1.00302.55 C ANISOU 5337 CB VAL D 47 41637 36492 36824 2069 1327 4755 C ATOM 5338 CG1 VAL D 47 34.484 -39.889 -2.869 1.00298.97 C ANISOU 5338 CG1 VAL D 47 41303 35751 36540 2329 1400 4495 C ATOM 5339 CG2 VAL D 47 36.107 -38.464 -4.119 1.00300.25 C ANISOU 5339 CG2 VAL D 47 41207 36360 36512 1816 1151 5089 C ATOM 5340 N GLU D 48 32.874 -41.619 -5.297 1.00307.89 N ANISOU 5340 N GLU D 48 42396 37211 37377 2553 1851 4144 N ATOM 5341 CA GLU D 48 32.050 -42.802 -5.072 1.00308.21 C ANISOU 5341 CA GLU D 48 42508 37131 37464 2838 2062 3823 C ATOM 5342 C GLU D 48 32.290 -43.960 -6.049 1.00320.34 C ANISOU 5342 C GLU D 48 43870 39005 38836 2962 2336 3696 C ATOM 5343 O GLU D 48 32.360 -45.130 -5.635 1.00314.54 O ANISOU 5343 O GLU D 48 43093 38267 38149 3196 2526 3485 O ATOM 5344 CB GLU D 48 30.581 -42.406 -5.015 1.00297.91 C ANISOU 5344 CB GLU D 48 41442 35493 36256 2873 1937 3695 C ATOM 5345 CG GLU D 48 30.130 -42.119 -3.598 1.00288.76 C ANISOU 5345 CG GLU D 48 40446 33974 35295 2964 1802 3601 C ATOM 5346 CD GLU D 48 30.458 -43.273 -2.667 1.00282.93 C ANISOU 5346 CD GLU D 48 39649 33233 34617 3186 2000 3438 C ATOM 5347 OE1 GLU D 48 29.967 -44.397 -2.908 1.00278.85 O ANISOU 5347 OE1 GLU D 48 39122 32745 34080 3371 2205 3240 O ATOM 5348 OE2 GLU D 48 31.222 -43.055 -1.710 1.00279.40 O ANISOU 5348 OE2 GLU D 48 39161 32752 34245 3169 1937 3518 O ATOM 5349 N ALA D 49 32.414 -43.630 -7.335 1.00341.29 N ANISOU 5349 N ALA D 49 46416 41954 41303 2806 2336 3823 N ATOM 5350 CA ALA D 49 32.817 -44.594 -8.362 1.00361.90 C ANISOU 5350 CA ALA D 49 48814 44969 43722 2903 2572 3718 C ATOM 5351 C ALA D 49 34.112 -45.295 -7.943 1.00371.74 C ANISOU 5351 C ALA D 49 49847 46457 44938 2998 2712 3706 C ATOM 5352 O ALA D 49 34.243 -46.522 -8.064 1.00382.64 O ANISOU 5352 O ALA D 49 51125 47958 46302 3237 2918 3466 O ATOM 5353 CB ALA D 49 33.002 -43.893 -9.703 1.00368.17 C ANISOU 5353 CB ALA D 49 49481 46113 44292 2659 2511 3933 C ATOM 5354 N ALA D 50 35.053 -44.497 -7.437 1.00371.60 N ANISOU 5354 N ALA D 50 49767 46493 44931 2813 2578 3964 N ATOM 5355 CA ALA D 50 36.337 -44.975 -6.912 1.00362.67 C ANISOU 5355 CA ALA D 50 48444 45566 43785 2871 2676 3994 C ATOM 5356 C ALA D 50 36.251 -45.842 -5.623 1.00344.90 C ANISOU 5356 C ALA D 50 46285 43010 41748 3125 2756 3777 C ATOM 5357 O ALA D 50 36.897 -46.907 -5.560 1.00346.15 O ANISOU 5357 O ALA D 50 46282 43349 41886 3311 2935 3629 O ATOM 5358 CB ALA D 50 37.279 -43.793 -6.711 1.00370.23 C ANISOU 5358 CB ALA D 50 49329 46634 44706 2580 2482 4350 C ATOM 5359 N VAL D 51 35.478 -45.393 -4.617 1.00321.46 N ANISOU 5359 N VAL D 51 43556 39606 38977 3133 2614 3759 N ATOM 5360 CA VAL D 51 35.355 -46.101 -3.329 1.00303.41 C ANISOU 5360 CA VAL D 51 41353 37047 36882 3338 2663 3595 C ATOM 5361 C VAL D 51 34.818 -47.500 -3.580 1.00305.58 C ANISOU 5361 C VAL D 51 41611 37314 37179 3603 2865 3304 C ATOM 5362 O VAL D 51 35.375 -48.492 -3.099 1.00305.01 O ANISOU 5362 O VAL D 51 41436 37284 37170 3775 2988 3189 O ATOM 5363 CB VAL D 51 34.452 -45.376 -2.308 1.00291.53 C ANISOU 5363 CB VAL D 51 40093 35123 35550 3310 2474 3595 C ATOM 5364 CG1 VAL D 51 34.691 -45.952 -0.933 1.00282.40 C ANISOU 5364 CG1 VAL D 51 38956 33793 34550 3463 2509 3507 C ATOM 5365 CG2 VAL D 51 34.764 -43.902 -2.222 1.00292.51 C ANISOU 5365 CG2 VAL D 51 40261 35206 35673 3047 2222 3858 C ATOM 5366 N ARG D 52 33.765 -47.565 -4.386 1.00312.98 N ANISOU 5366 N ARG D 52 42643 38203 38070 3627 2881 3194 N ATOM 5367 CA ARG D 52 33.127 -48.825 -4.760 1.00326.59 C ANISOU 5367 CA ARG D 52 44366 39903 39819 3864 3043 2918 C ATOM 5368 C ARG D 52 33.966 -49.799 -5.602 1.00340.99 C ANISOU 5368 C ARG D 52 45940 42101 41520 3989 3219 2805 C ATOM 5369 O ARG D 52 33.769 -51.008 -5.502 1.00349.52 O ANISOU 5369 O ARG D 52 46993 43118 42689 4223 3330 2571 O ATOM 5370 CB ARG D 52 31.858 -48.541 -5.528 1.00325.32 C ANISOU 5370 CB ARG D 52 44354 39635 39617 3835 3008 2848 C ATOM 5371 CG ARG D 52 30.916 -47.641 -4.792 1.00326.21 C ANISOU 5371 CG ARG D 52 44706 39392 39847 3745 2828 2909 C ATOM 5372 CD ARG D 52 29.574 -47.768 -5.447 1.00329.50 C ANISOU 5372 CD ARG D 52 45263 39679 40252 3796 2837 2763 C ATOM 5373 NE ARG D 52 28.996 -46.459 -5.675 1.00327.87 N ANISOU 5373 NE ARG D 52 45195 39359 40022 3597 2643 2909 N ATOM 5374 CZ ARG D 52 27.698 -46.227 -5.814 1.00326.72 C ANISOU 5374 CZ ARG D 52 45232 38987 39917 3616 2576 2811 C ATOM 5375 NH1 ARG D 52 26.820 -47.219 -5.735 1.00329.83 N ANISOU 5375 NH1 ARG D 52 45696 39252 40372 3816 2694 2580 N ATOM 5376 NH2 ARG D 52 27.276 -44.991 -6.018 1.00323.67 N ANISOU 5376 NH2 ARG D 52 44958 38497 39522 3431 2371 2949 N ATOM 5377 N GLY D 53 34.853 -49.279 -6.460 1.00354.22 N ANISOU 5377 N GLY D 53 47425 44172 42988 3834 3229 2963 N ATOM 5378 CA GLY D 53 35.789 -50.104 -7.268 1.00365.73 C ANISOU 5378 CA GLY D 53 48601 46065 44291 3948 3386 2854 C ATOM 5379 C GLY D 53 36.777 -50.910 -6.426 1.00369.97 C ANISOU 5379 C GLY D 53 49010 46624 44936 4107 3454 2782 C ATOM 5380 O GLY D 53 36.925 -52.124 -6.646 1.00377.32 O ANISOU 5380 O GLY D 53 49825 47638 45899 4353 3574 2527 O ATOM 5381 N VAL D 54 37.441 -50.219 -5.477 1.00362.04 N ANISOU 5381 N VAL D 54 48026 45536 43996 3968 3359 3003 N ATOM 5382 CA VAL D 54 38.287 -50.804 -4.395 1.00347.71 C ANISOU 5382 CA VAL D 54 46140 43650 42321 4086 3388 2979 C ATOM 5383 C VAL D 54 37.515 -51.875 -3.581 1.00345.79 C ANISOU 5383 C VAL D 54 46038 43027 42318 4329 3419 2745 C ATOM 5384 O VAL D 54 38.030 -52.993 -3.363 1.00349.34 O ANISOU 5384 O VAL D 54 46361 43521 42850 4537 3504 2578 O ATOM 5385 CB VAL D 54 38.911 -49.701 -3.459 1.00336.36 C ANISOU 5385 CB VAL D 54 44749 42128 40924 3868 3248 3270 C ATOM 5386 CG1 VAL D 54 39.501 -50.297 -2.184 1.00329.64 C ANISOU 5386 CG1 VAL D 54 43880 41113 40252 3997 3264 3234 C ATOM 5387 CG2 VAL D 54 39.980 -48.906 -4.184 1.00328.43 C ANISOU 5387 CG2 VAL D 54 43539 41551 39697 3649 3224 3510 C ATOM 5388 N ARG D 55 36.288 -51.536 -3.158 1.00333.05 N ANISOU 5388 N ARG D 55 44672 41055 40814 4298 3335 2737 N ATOM 5389 CA ARG D 55 35.392 -52.446 -2.406 1.00314.98 C ANISOU 5389 CA ARG D 55 42526 38415 38734 4488 3343 2554 C ATOM 5390 C ARG D 55 35.079 -53.775 -3.143 1.00316.92 C ANISOU 5390 C ARG D 55 42694 38714 39007 4724 3456 2278 C ATOM 5391 O ARG D 55 34.915 -54.811 -2.493 1.00305.52 O ANISOU 5391 O ARG D 55 41263 37070 37748 4904 3469 2140 O ATOM 5392 CB ARG D 55 34.098 -51.729 -1.999 1.00298.12 C ANISOU 5392 CB ARG D 55 40647 35963 36662 4396 3231 2595 C ATOM 5393 CG ARG D 55 34.298 -50.418 -1.256 1.00284.17 C ANISOU 5393 CG ARG D 55 38968 34107 34895 4188 3082 2827 C ATOM 5394 CD ARG D 55 32.964 -49.933 -0.723 1.00271.56 C ANISOU 5394 CD ARG D 55 37608 32184 33385 4163 2970 2798 C ATOM 5395 NE ARG D 55 32.893 -48.494 -0.428 1.00263.18 N ANISOU 5395 NE ARG D 55 36649 31046 32299 3958 2790 2980 N ATOM 5396 CZ ARG D 55 31.987 -47.652 -0.935 1.00259.75 C ANISOU 5396 CZ ARG D 55 36356 30515 31821 3852 2680 3000 C ATOM 5397 NH1 ARG D 55 31.075 -48.082 -1.794 1.00261.89 N ANISOU 5397 NH1 ARG D 55 36682 30775 32047 3922 2751 2859 N ATOM 5398 NH2 ARG D 55 31.990 -46.371 -0.580 1.00254.18 N ANISOU 5398 NH2 ARG D 55 35736 29711 31126 3678 2480 3157 N ATOM 5399 N GLN D 56 35.020 -53.739 -4.484 1.00327.07 N ANISOU 5399 N GLN D 56 43886 40272 40111 4718 3519 2203 N ATOM 5400 CA GLN D 56 34.802 -54.943 -5.327 1.00327.67 C ANISOU 5400 CA GLN D 56 43860 40447 40190 4950 3614 1917 C ATOM 5401 C GLN D 56 36.040 -55.853 -5.487 1.00323.99 C ANISOU 5401 C GLN D 56 43128 40255 39717 5123 3690 1786 C ATOM 5402 O GLN D 56 35.910 -57.073 -5.342 1.00324.89 O ANISOU 5402 O GLN D 56 43210 40235 39997 5360 3705 1555 O ATOM 5403 CB GLN D 56 34.183 -54.592 -6.701 1.00328.70 C ANISOU 5403 CB GLN D 56 43988 40777 40123 4893 3650 1861 C ATOM 5404 CG GLN D 56 34.047 -55.769 -7.666 1.00323.66 C ANISOU 5404 CG GLN D 56 43218 40294 39463 5134 3740 1551 C ATOM 5405 CD GLN D 56 32.713 -56.505 -7.652 1.00320.85 C ANISOU 5405 CD GLN D 56 43046 39587 39274 5281 3720 1352 C ATOM 5406 OE1 GLN D 56 31.710 -56.033 -7.102 1.00321.36 O ANISOU 5406 OE1 GLN D 56 43346 39328 39429 5183 3651 1448 O ATOM 5407 NE2 GLN D 56 32.695 -57.676 -8.294 1.00315.56 N ANISOU 5407 NE2 GLN D 56 42256 38998 38644 5524 3768 1062 N ATOM 5408 N ALA D 57 37.216 -55.282 -5.781 1.00315.65 N ANISOU 5408 N ALA D 57 41877 39576 38478 5007 3721 1930 N ATOM 5409 CA ALA D 57 38.454 -56.083 -5.923 1.00307.36 C ANISOU 5409 CA ALA D 57 40553 38825 37402 5173 3789 1802 C ATOM 5410 C ALA D 57 38.789 -56.927 -4.682 1.00305.13 C ANISOU 5410 C ALA D 57 40293 38250 37392 5329 3752 1743 C ATOM 5411 O ALA D 57 39.041 -58.111 -4.817 1.00306.13 O ANISOU 5411 O ALA D 57 40296 38391 37626 5579 3775 1491 O ATOM 5412 CB ALA D 57 39.635 -55.220 -6.319 1.00304.18 C ANISOU 5412 CB ALA D 57 39944 38876 36752 4987 3817 2013 C ATOM 5413 N GLN D 58 38.765 -56.327 -3.491 1.00303.57 N ANISOU 5413 N GLN D 58 40246 37787 37309 5186 3678 1966 N ATOM 5414 CA GLN D 58 39.004 -57.054 -2.223 1.00302.19 C ANISOU 5414 CA GLN D 58 40103 37326 37388 5302 3632 1949 C ATOM 5415 C GLN D 58 37.921 -58.075 -1.832 1.00292.24 C ANISOU 5415 C GLN D 58 38991 35677 36368 5476 3586 1770 C ATOM 5416 O GLN D 58 38.193 -58.994 -1.062 1.00288.76 O ANISOU 5416 O GLN D 58 38516 35060 36138 5620 3546 1701 O ATOM 5417 CB GLN D 58 39.169 -56.076 -1.061 1.00313.58 C ANISOU 5417 CB GLN D 58 41668 38606 38869 5095 3558 2231 C ATOM 5418 CG GLN D 58 40.569 -55.550 -0.810 1.00328.92 C ANISOU 5418 CG GLN D 58 43438 40823 40713 4990 3570 2406 C ATOM 5419 CD GLN D 58 40.617 -54.544 0.334 1.00340.26 C ANISOU 5419 CD GLN D 58 45014 42068 42201 4790 3474 2668 C ATOM 5420 OE1 GLN D 58 40.031 -53.440 0.274 1.00349.55 O ANISOU 5420 OE1 GLN D 58 46338 43173 43299 4597 3405 2817 O ATOM 5421 NE2 GLN D 58 41.323 -54.918 1.393 1.00342.88 N ANISOU 5421 NE2 GLN D 58 45294 42314 42670 4841 3455 2716 N ATOM 5422 N ALA D 59 36.700 -57.896 -2.331 1.00282.47 N ANISOU 5422 N ALA D 59 37916 34304 35104 5447 3577 1715 N ATOM 5423 CA ALA D 59 35.600 -58.810 -2.031 1.00277.36 C ANISOU 5423 CA ALA D 59 37409 33307 34668 5587 3526 1566 C ATOM 5424 C ALA D 59 35.828 -60.161 -2.686 1.00283.05 C ANISOU 5424 C ALA D 59 37975 34087 35484 5854 3540 1274 C ATOM 5425 O ALA D 59 35.640 -61.194 -2.052 1.00278.86 O ANISOU 5425 O ALA D 59 37462 33290 35201 6002 3465 1182 O ATOM 5426 CB ALA D 59 34.279 -58.219 -2.483 1.00270.11 C ANISOU 5426 CB ALA D 59 36689 32265 33675 5486 3516 1578 C ATOM 5427 N GLU D 60 36.230 -60.131 -3.959 1.00295.28 N ATOM 5428 CA GLU D 60 36.693 -61.320 -4.705 1.00309.24 C ATOM 5429 C GLU D 60 38.194 -61.568 -4.472 1.00326.35 C ATOM 5430 O GLU D 60 38.845 -62.317 -5.218 1.00332.97 O ATOM 5431 CB GLU D 60 36.353 -61.239 -6.227 1.00301.71 C ATOM 5432 CG GLU D 60 36.776 -59.975 -6.998 1.00289.53 C ATOM 5433 CD GLU D 60 36.143 -59.866 -8.392 1.00283.03 C ATOM 5434 OE1 GLU D 60 36.745 -60.378 -9.354 1.00279.92 O ATOM 5435 OE2 GLU D 60 35.063 -59.248 -8.546 1.00278.47 O