>>4NE1:HELIX   13  13 SER H   31  GLU H   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 13 13 SER H 31 GLU H 60 1 30 ATOM 6546 N SER H 31 -4.685 -44.608 -6.554 1.00369.67 N ANISOU 6546 N SER H 31 48111 50488 41856 6741 -4831 -5824 N ATOM 6547 CA SER H 31 -5.837 -45.032 -7.362 1.00389.49 C ANISOU 6547 CA SER H 31 49715 53870 44404 7485 -5289 -7248 C ATOM 6548 C SER H 31 -5.903 -46.574 -7.499 1.00403.45 C ANISOU 6548 C SER H 31 50534 56039 46716 6533 -4604 -7642 C ATOM 6549 O SER H 31 -4.868 -47.261 -7.443 1.00403.66 O ANISOU 6549 O SER H 31 50941 55563 46867 5647 -4010 -6593 O ATOM 6550 CB SER H 31 -5.847 -44.326 -8.729 1.00386.92 C ANISOU 6550 CB SER H 31 50240 53446 43325 8915 -6217 -7217 C ATOM 6551 OG SER H 31 -4.776 -44.753 -9.552 1.00376.57 O ANISOU 6551 OG SER H 31 49669 51612 41796 8632 -6002 -6149 O ATOM 6552 N GLY H 32 -7.118 -47.112 -7.651 1.00423.38 N ANISOU 6552 N GLY H 32 51828 59480 49558 6711 -4669 -9233 N ATOM 6553 CA GLY H 32 -7.355 -48.571 -7.663 1.00430.22 C ANISOU 6553 CA GLY H 32 51746 60759 50960 5713 -3904 -9839 C ATOM 6554 C GLY H 32 -6.742 -49.337 -8.830 1.00429.97 C ANISOU 6554 C GLY H 32 51964 60621 50782 5757 -3929 -9327 C ATOM 6555 O GLY H 32 -6.304 -50.487 -8.667 1.00412.31 O ANISOU 6555 O GLY H 32 49537 58239 48880 4679 -3135 -9009 O ATOM 6556 N ASP H 33 -6.731 -48.699 -10.001 1.00444.21 N ANISOU 6556 N ASP H 33 54280 62465 52033 7042 -4842 -9281 N ATOM 6557 CA ASP H 33 -6.054 -49.222 -11.190 1.00440.92 C ANISOU 6557 CA ASP H 33 54324 61843 51360 7225 -4959 -8653 C ATOM 6558 C ASP H 33 -4.534 -49.227 -11.024 1.00426.57 C ANISOU 6558 C ASP H 33 53627 59048 49401 6503 -4505 -6862 C ATOM 6559 O ASP H 33 -3.922 -50.238 -11.329 1.00423.91 O ANISOU 6559 O ASP H 33 53220 58586 49259 5797 -4012 -6403 O ATOM 6560 CB ASP H 33 -6.479 -48.488 -12.480 1.00450.89 C ANISOU 6560 CB ASP H 33 56013 63340 51965 8871 -6063 -9130 C ATOM 6561 CG ASP H 33 -7.833 -48.962 -13.037 1.00458.38 C ANISOU 6561 CG ASP H 33 55642 65415 53106 9556 -6495 -11030 C ATOM 6562 OD1 ASP H 33 -8.460 -49.876 -12.447 1.00456.48 O ANISOU 6562 OD1 ASP H 33 54108 65786 53545 8633 -5837 -12031 O ATOM 6563 OD2 ASP H 33 -8.282 -48.391 -14.059 1.00463.46 O ANISOU 6563 OD2 ASP H 33 56595 66320 53176 11051 -7489 -11605 O ATOM 6564 N ALA H 34 -3.936 -48.127 -10.539 1.00414.02 N ANISOU 6564 N ALA H 34 53013 56808 47485 6668 -4659 -5956 N ATOM 6565 CA ALA H 34 -2.496 -48.104 -10.203 1.00391.15 C ANISOU 6565 CA ALA H 34 51013 53069 44538 5876 -4161 -4446 C ATOM 6566 C ALA H 34 -2.115 -49.169 -9.155 1.00377.51 C ANISOU 6566 C ALA H 34 48751 51274 43410 4525 -3261 -4205 C ATOM 6567 O ALA H 34 -0.984 -49.661 -9.181 1.00360.16 O ANISOU 6567 O ALA H 34 46992 48610 41242 3894 -2858 -3241 O ATOM 6568 CB ALA H 34 -2.041 -46.714 -9.761 1.00384.84 C ANISOU 6568 CB ALA H 34 51241 51653 43327 6226 -4420 -3731 C ATOM 6569 N LEU H 35 -3.058 -49.521 -8.260 1.00380.84 N ANISOU 6569 N LEU H 35 48298 52146 44256 4122 -2946 -5147 N ATOM 6570 CA LEU H 35 -2.905 -50.634 -7.272 1.00382.03 C ANISOU 6570 CA LEU H 35 48050 52214 44889 2878 -2032 -5128 C ATOM 6571 C LEU H 35 -2.924 -52.035 -7.918 1.00381.22 C ANISOU 6571 C LEU H 35 47474 52375 44998 2412 -1624 -5444 C ATOM 6572 O LEU H 35 -2.064 -52.888 -7.630 1.00379.98 O ANISOU 6572 O LEU H 35 47638 51790 44944 1622 -1055 -4716 O ATOM 6573 CB LEU H 35 -3.960 -50.548 -6.149 1.00394.03 C ANISOU 6573 CB LEU H 35 48895 54080 46738 2532 -1717 -6131 C ATOM 6574 CG LEU H 35 -3.812 -51.496 -4.952 1.00399.37 C ANISOU 6574 CG LEU H 35 49494 54478 47768 1272 -726 -6061 C ATOM 6575 CD1 LEU H 35 -2.502 -51.260 -4.213 1.00396.62 C ANISOU 6575 CD1 LEU H 35 50122 53298 47274 871 -535 -4639 C ATOM 6576 CD2 LEU H 35 -4.985 -51.359 -3.997 1.00406.05 C ANISOU 6576 CD2 LEU H 35 49655 55721 48904 962 -392 -7243 C ATOM 6577 N GLN H 36 -3.914 -52.259 -8.782 1.00382.63 N ANISOU 6577 N GLN H 36 46898 53269 45213 2966 -1953 -6595 N ATOM 6578 CA GLN H 36 -3.968 -53.418 -9.678 0.50385.73 C ANISOU 6578 CA GLN H 36 46864 53968 45727 2766 -1745 -6942 C ATOM 6579 C GLN H 36 -2.695 -53.603 -10.525 1.00391.92 C ANISOU 6579 C GLN H 36 48460 54237 46215 2868 -1891 -5675 C ATOM 6580 O GLN H 36 -2.280 -54.735 -10.814 1.00396.63 O ANISOU 6580 O GLN H 36 48968 54771 46960 2275 -1428 -5476 O ATOM 6581 CB GLN H 36 -5.168 -53.256 -10.597 0.50381.75 C ANISOU 6581 CB GLN H 36 45524 54333 45191 3696 -2359 -8361 C ATOM 6582 CG GLN H 36 -6.458 -53.742 -9.983 0.50379.05 C ANISOU 6582 CG GLN H 36 43992 54711 45316 3230 -1905 -9988 C ATOM 6583 CD GLN H 36 -6.519 -55.247 -10.005 0.50378.13 C ANISOU 6583 CD GLN H 36 43388 54716 45566 2151 -999 -10381 C ATOM 6584 OE1 GLN H 36 -6.885 -55.879 -9.020 0.50379.17 O ANISOU 6584 OE1 GLN H 36 43198 54822 46043 1081 -92 -10889 O ATOM 6585 NE2 GLN H 36 -6.124 -55.833 -11.127 0.50374.53 N ANISOU 6585 NE2 GLN H 36 43010 54312 44983 2399 -1192 -10105 N ATOM 6586 N LEU H 37 -2.084 -52.474 -10.901 1.00398.23 N ANISOU 6586 N LEU H 37 50092 54642 46573 3587 -2485 -4875 N ATOM 6587 CA LEU H 37 -0.847 -52.423 -11.708 1.00393.61 C ANISOU 6587 CA LEU H 37 50356 53539 45657 3694 -2609 -3731 C ATOM 6588 C LEU H 37 0.463 -52.720 -10.932 1.00375.18 C ANISOU 6588 C LEU H 37 48563 50551 43436 2789 -2042 -2588 C ATOM 6589 O LEU H 37 1.383 -53.352 -11.470 1.00375.85 O ANISOU 6589 O LEU H 37 48916 50407 43481 2498 -1856 -1968 O ATOM 6590 CB LEU H 37 -0.763 -51.080 -12.470 1.00405.84 C ANISOU 6590 CB LEU H 37 52717 54872 46609 4788 -3372 -3463 C ATOM 6591 CG LEU H 37 -1.777 -50.873 -13.612 1.00417.02 C ANISOU 6591 CG LEU H 37 53873 56850 47723 5942 -4098 -4449 C ATOM 6592 CD1 LEU H 37 -1.515 -49.589 -14.389 1.00421.43 C ANISOU 6592 CD1 LEU H 37 55628 56968 47527 7024 -4788 -4005 C ATOM 6593 CD2 LEU H 37 -1.853 -52.078 -14.538 1.00416.08 C ANISOU 6593 CD2 LEU H 37 53205 57119 47765 5806 -3969 -4804 C ATOM 6594 N MET H 38 0.537 -52.269 -9.679 1.00351.71 N ANISOU 6594 N MET H 38 45721 47320 40592 2406 -1810 -2391 N ATOM 6595 CA MET H 38 1.658 -52.584 -8.785 1.00322.24 C ANISOU 6595 CA MET H 38 42413 43047 36973 1629 -1323 -1518 C ATOM 6596 C MET H 38 1.689 -54.055 -8.386 1.00304.87 C ANISOU 6596 C MET H 38 39862 40894 35079 844 -690 -1702 C ATOM 6597 O MET H 38 2.765 -54.604 -8.119 1.00292.70 O ANISOU 6597 O MET H 38 38719 38956 33534 394 -407 -993 O ATOM 6598 CB MET H 38 1.589 -51.713 -7.534 1.00320.53 C ANISOU 6598 CB MET H 38 42414 42579 36791 1503 -1278 -1385 C ATOM 6599 CG MET H 38 2.151 -50.328 -7.737 1.00316.64 C ANISOU 6599 CG MET H 38 42635 41735 35939 2023 -1720 -782 C ATOM 6600 SD MET H 38 3.852 -50.552 -8.252 1.00305.83 S ANISOU 6600 SD MET H 38 41905 39880 34416 1691 -1559 272 S ATOM 6601 CE MET H 38 4.560 -51.215 -6.745 1.00305.54 C ANISOU 6601 CE MET H 38 41832 39559 34697 827 -1016 628 C ATOM 6602 N VAL H 39 0.496 -54.663 -8.327 1.00295.65 N ANISOU 6602 N VAL H 39 37985 40206 34143 699 -458 -2740 N ATOM 6603 CA VAL H 39 0.325 -56.118 -8.213 1.00284.91 C ANISOU 6603 CA VAL H 39 36332 38916 33003 -12 193 -3111 C ATOM 6604 C VAL H 39 1.022 -56.809 -9.389 1.00278.45 C ANISOU 6604 C VAL H 39 35619 38103 32076 113 74 -2703 C ATOM 6605 O VAL H 39 1.787 -57.738 -9.163 1.00270.78 O ANISOU 6605 O VAL H 39 34980 36787 31115 -414 488 -2223 O ATOM 6606 CB VAL H 39 -1.168 -56.530 -8.099 1.00292.33 C ANISOU 6606 CB VAL H 39 36401 40457 34214 -200 496 -4514 C ATOM 6607 CG1 VAL H 39 -1.398 -57.990 -8.501 1.00293.80 C ANISOU 6607 CG1 VAL H 39 36266 40806 34558 -783 1083 -5011 C ATOM 6608 CG2 VAL H 39 -1.677 -56.261 -6.689 1.00293.02 C ANISOU 6608 CG2 VAL H 39 36490 40394 34447 -699 939 -4861 C ATOM 6609 N GLU H 40 0.774 -56.331 -10.618 1.00279.81 N ANISOU 6609 N GLU H 40 35595 38627 32089 871 -517 -2899 N ATOM 6610 CA GLU H 40 1.489 -56.779 -11.839 1.00276.35 C ANISOU 6610 CA GLU H 40 35344 38167 31488 1092 -708 -2447 C ATOM 6611 C GLU H 40 3.010 -56.559 -11.732 1.00269.68 C ANISOU 6611 C GLU H 40 35273 36727 30466 922 -701 -1256 C ATOM 6612 O GLU H 40 3.787 -57.473 -12.027 1.00270.60 O ANISOU 6612 O GLU H 40 35514 36693 30606 578 -455 -865 O ATOM 6613 CB GLU H 40 0.956 -56.091 -13.120 1.00277.77 C ANISOU 6613 CB GLU H 40 35399 38732 31407 2067 -1408 -2842 C ATOM 6614 CG GLU H 40 -0.562 -56.082 -13.320 1.00278.28 C ANISOU 6614 CG GLU H 40 34613 39511 31608 2488 -1620 -4201 C ATOM 6615 CD GLU H 40 -1.117 -57.397 -13.860 1.00276.63 C ANISOU 6615 CD GLU H 40 33655 39785 31663 2155 -1279 -5001 C ATOM 6616 OE1 GLU H 40 -2.349 -57.592 -13.813 1.00275.04 O ANISOU 6616 OE1 GLU H 40 32595 40218 31687 2234 -1246 -6292 O ATOM 6617 OE2 GLU H 40 -0.316 -58.236 -14.326 1.00274.59 O ANISOU 6617 OE2 GLU H 40 33642 39294 31396 1795 -1023 -4410 O ATOM 6618 N LEU H 41 3.423 -55.360 -11.309 1.00261.65 N ANISOU 6618 N LEU H 41 34738 35402 29274 1159 -957 -776 N ATOM 6619 CA LEU H 41 4.850 -55.012 -11.176 1.00248.04 C ANISOU 6619 CA LEU H 41 33656 33181 27404 973 -929 173 C ATOM 6620 C LEU H 41 5.625 -55.899 -10.187 1.00239.13 C ANISOU 6620 C LEU H 41 32617 31775 26464 287 -465 515 C ATOM 6621 O LEU H 41 6.675 -56.463 -10.525 1.00236.01 O ANISOU 6621 O LEU H 41 32417 31223 26032 100 -376 967 O ATOM 6622 CB LEU H 41 5.024 -53.526 -10.799 1.00247.20 C ANISOU 6622 CB LEU H 41 34040 32799 27084 1286 -1208 482 C ATOM 6623 CG LEU H 41 6.348 -53.055 -10.148 1.00242.64 C ANISOU 6623 CG LEU H 41 33986 31744 26462 922 -1054 1239 C ATOM 6624 CD1 LEU H 41 7.604 -53.416 -10.941 1.00241.09 C ANISOU 6624 CD1 LEU H 41 34046 31392 26165 749 -966 1734 C ATOM 6625 CD2 LEU H 41 6.328 -51.562 -9.880 1.00246.92 C ANISOU 6625 CD2 LEU H 41 35016 32033 26768 1238 -1294 1420 C ATOM 6626 N LEU H 42 5.122 -55.998 -8.964 1.00233.34 N ANISOU 6626 N LEU H 42 31807 30963 25885 -33 -192 260 N ATOM 6627 CA LEU H 42 5.842 -56.746 -7.948 1.00228.18 C ANISOU 6627 CA LEU H 42 31461 29950 25283 -545 187 580 C ATOM 6628 C LEU H 42 5.724 -58.244 -8.221 1.00234.61 C ANISOU 6628 C LEU H 42 32158 30825 26156 -878 567 324 C ATOM 6629 O LEU H 42 6.612 -59.007 -7.890 1.00235.04 O ANISOU 6629 O LEU H 42 32589 30581 26133 -1105 742 691 O ATOM 6630 CB LEU H 42 5.379 -56.370 -6.541 1.00222.52 C ANISOU 6630 CB LEU H 42 30879 29035 24633 -782 398 422 C ATOM 6631 CG LEU H 42 5.657 -54.958 -6.001 1.00215.86 C ANISOU 6631 CG LEU H 42 30267 28027 23722 -541 90 753 C ATOM 6632 CD1 LEU H 42 5.093 -54.845 -4.592 1.00218.93 C ANISOU 6632 CD1 LEU H 42 30752 28236 24193 -840 379 512 C ATOM 6633 CD2 LEU H 42 7.137 -54.585 -6.025 1.00207.10 C ANISOU 6633 CD2 LEU H 42 29569 26630 22489 -505 -88 1470 C ATOM 6634 N LYS H 43 4.630 -58.645 -8.854 1.00241.24 N ANISOU 6634 N LYS H 43 32485 32066 27107 -855 666 -370 N ATOM 6635 CA LYS H 43 4.476 -59.984 -9.382 1.00242.29 C ANISOU 6635 CA LYS H 43 32462 32309 27286 -1141 1010 -665 C ATOM 6636 C LYS H 43 5.633 -60.289 -10.354 1.00245.20 C ANISOU 6636 C LYS H 43 33015 32622 27528 -925 742 -51 C ATOM 6637 O LYS H 43 6.359 -61.265 -10.149 1.00246.72 O ANISOU 6637 O LYS H 43 33545 32545 27651 -1199 991 226 O ATOM 6638 CB LYS H 43 3.090 -60.068 -10.014 1.00239.18 C ANISOU 6638 CB LYS H 43 31338 32482 27058 -1039 1041 -1637 C ATOM 6639 CG LYS H 43 2.701 -61.282 -10.816 1.00234.42 C ANISOU 6639 CG LYS H 43 30382 32150 26538 -1259 1339 -2142 C ATOM 6640 CD LYS H 43 1.225 -61.113 -11.159 1.00237.61 C ANISOU 6640 CD LYS H 43 29951 33186 27140 -1132 1339 -3317 C ATOM 6641 CE LYS H 43 0.819 -61.861 -12.424 1.00241.64 C ANISOU 6641 CE LYS H 43 29919 34176 27717 -983 1288 -3868 C ATOM 6642 NZ LYS H 43 0.254 -63.211 -12.141 1.00246.52 N ANISOU 6642 NZ LYS H 43 30339 34824 28503 -1794 2124 -4585 N ATOM 6643 N VAL H 44 5.849 -59.443 -11.370 1.00250.00 N ANISOU 6643 N VAL H 44 33505 33432 28052 -420 252 146 N ATOM 6644 CA VAL H 44 7.007 -59.629 -12.297 1.00250.77 C ANISOU 6644 CA VAL H 44 33805 33457 28020 -283 63 698 C ATOM 6645 C VAL H 44 8.352 -59.403 -11.599 1.00252.41 C ANISOU 6645 C VAL H 44 34469 33276 28156 -441 60 1333 C ATOM 6646 O VAL H 44 9.391 -59.909 -12.049 1.00252.11 O ANISOU 6646 O VAL H 44 34550 33175 28062 -488 43 1655 O ATOM 6647 CB VAL H 44 6.986 -58.742 -13.573 1.00250.33 C ANISOU 6647 CB VAL H 44 33734 33589 27788 259 -375 769 C ATOM 6648 CG1 VAL H 44 7.969 -59.280 -14.613 1.00247.97 C ANISOU 6648 CG1 VAL H 44 33551 33273 27393 260 -405 1137 C ATOM 6649 CG2 VAL H 44 5.607 -58.679 -14.180 1.00252.67 C ANISOU 6649 CG2 VAL H 44 33574 34322 28107 634 -548 25 C ATOM 6650 N PHE H 45 8.327 -58.639 -10.508 1.00254.53 N ANISOU 6650 N PHE H 45 34938 33335 28434 -498 58 1426 N ATOM 6651 CA PHE H 45 9.524 -58.358 -9.723 1.00252.17 C ANISOU 6651 CA PHE H 45 35002 32726 28083 -608 25 1882 C ATOM 6652 C PHE H 45 10.087 -59.623 -9.064 1.00253.73 C ANISOU 6652 C PHE H 45 35436 32719 28251 -838 253 1924 C ATOM 6653 O PHE H 45 11.280 -59.930 -9.198 1.00248.17 O ANISOU 6653 O PHE H 45 34860 31952 27479 -792 135 2184 O ATOM 6654 CB PHE H 45 9.231 -57.281 -8.677 1.00250.47 C ANISOU 6654 CB PHE H 45 34941 32344 27881 -597 -26 1908 C ATOM 6655 CG PHE H 45 10.357 -57.056 -7.715 1.00247.78 C ANISOU 6655 CG PHE H 45 34920 31720 27503 -703 -55 2243 C ATOM 6656 CD1 PHE H 45 11.346 -56.125 -7.996 1.00247.97 C ANISOU 6656 CD1 PHE H 45 35024 31711 27481 -634 -245 2530 C ATOM 6657 CD2 PHE H 45 10.445 -57.783 -6.529 1.00249.61 C ANISOU 6657 CD2 PHE H 45 35435 31701 27705 -869 132 2197 C ATOM 6658 CE1 PHE H 45 12.400 -55.920 -7.116 1.00251.91 C ANISOU 6658 CE1 PHE H 45 35692 32042 27977 -715 -292 2679 C ATOM 6659 CE2 PHE H 45 11.495 -57.584 -5.643 1.00252.99 C ANISOU 6659 CE2 PHE H 45 36154 31909 28061 -834 9 2415 C ATOM 6660 CZ PHE H 45 12.473 -56.646 -5.936 1.00254.17 C ANISOU 6660 CZ PHE H 45 36193 32140 28237 -751 -227 2614 C ATOM 6661 N VAL H 46 9.212 -60.334 -8.350 1.00258.56 N ANISOU 6661 N VAL H 46 36160 33208 28871 -1072 599 1593 N ATOM 6662 CA VAL H 46 9.538 -61.615 -7.720 1.00261.40 C ANISOU 6662 CA VAL H 46 36995 33248 29074 -1266 894 1578 C ATOM 6663 C VAL H 46 9.876 -62.680 -8.770 1.00274.28 C ANISOU 6663 C VAL H 46 38526 35022 30667 -1244 925 1565 C ATOM 6664 O VAL H 46 10.847 -63.418 -8.582 1.00276.65 O ANISOU 6664 O VAL H 46 39214 35111 30786 -1149 866 1769 O ATOM 6665 CB VAL H 46 8.394 -62.136 -6.806 1.00254.82 C ANISOU 6665 CB VAL H 46 36429 32181 28208 -1651 1430 1138 C ATOM 6666 CG1 VAL H 46 8.763 -63.472 -6.170 1.00252.31 C ANISOU 6666 CG1 VAL H 46 36899 31378 27587 -1827 1791 1152 C ATOM 6667 CG2 VAL H 46 8.037 -61.124 -5.724 1.00248.12 C ANISOU 6667 CG2 VAL H 46 35688 31188 27397 -1686 1420 1128 C ATOM 6668 N VAL H 47 9.078 -62.750 -9.852 1.00286.08 N ANISOU 6668 N VAL H 47 39505 36886 32305 -1263 969 1272 N ATOM 6669 CA VAL H 47 9.265 -63.719 -10.978 1.00289.10 C ANISOU 6669 CA VAL H 47 39713 37456 32675 -1246 1002 1218 C ATOM 6670 C VAL H 47 10.622 -63.572 -11.685 1.00290.90 C ANISOU 6670 C VAL H 47 39923 37757 32847 -975 622 1666 C ATOM 6671 O VAL H 47 11.273 -64.580 -11.964 1.00300.67 O ANISOU 6671 O VAL H 47 41326 38932 33982 -969 659 1741 O ATOM 6672 CB VAL H 47 8.068 -63.742 -11.995 1.00285.58 C ANISOU 6672 CB VAL H 47 38666 37448 32391 -1249 1072 707 C ATOM 6673 CG1 VAL H 47 8.461 -64.243 -13.391 1.00277.90 C ANISOU 6673 CG1 VAL H 47 37434 36743 31412 -1069 899 788 C ATOM 6674 CG2 VAL H 47 6.945 -64.595 -11.442 1.00288.27 C ANISOU 6674 CG2 VAL H 47 39019 37729 32779 -1697 1652 80 C ATOM 6675 N GLU H 48 11.058 -62.335 -11.942 1.00281.82 N ANISOU 6675 N GLU H 48 38624 36715 31740 -786 310 1902 N ATOM 6676 CA GLU H 48 12.377 -62.112 -12.553 1.00268.47 C ANISOU 6676 CA GLU H 48 36908 35090 30008 -662 74 2202 C ATOM 6677 C GLU H 48 13.562 -62.216 -11.588 1.00258.99 C ANISOU 6677 C GLU H 48 35979 33685 28737 -638 -27 2346 C ATOM 6678 O GLU H 48 14.657 -62.639 -12.005 1.00257.21 O ANISOU 6678 O GLU H 48 35690 33559 28477 -558 -156 2388 O ATOM 6679 CB GLU H 48 12.410 -60.821 -13.376 1.00269.28 C ANISOU 6679 CB GLU H 48 36877 35328 30110 -539 -100 2326 C ATOM 6680 CG GLU H 48 11.711 -60.960 -14.728 1.00276.13 C ANISOU 6680 CG GLU H 48 37529 36441 30944 -381 -136 2183 C ATOM 6681 CD GLU H 48 12.479 -61.818 -15.739 1.00277.28 C ANISOU 6681 CD GLU H 48 37570 36722 31062 -403 -122 2258 C ATOM 6682 OE1 GLU H 48 13.708 -61.618 -15.924 1.00280.73 O ANISOU 6682 OE1 GLU H 48 38076 37121 31466 -480 -157 2455 O ATOM 6683 OE2 GLU H 48 11.844 -62.693 -16.370 1.00274.74 O ANISOU 6683 OE2 GLU H 48 37049 36576 30764 -364 -55 2042 O ATOM 6684 N ALA H 49 13.332 -61.836 -10.323 1.00249.37 N ANISOU 6684 N ALA H 49 35035 32221 27490 -666 3 2342 N ATOM 6685 CA ALA H 49 14.253 -62.117 -9.216 1.00244.67 C ANISOU 6685 CA ALA H 49 34804 31397 26762 -537 -123 2371 C ATOM 6686 C ALA H 49 14.531 -63.635 -9.103 1.00250.13 C ANISOU 6686 C ALA H 49 35877 31924 27236 -415 -60 2273 C ATOM 6687 O ALA H 49 15.693 -64.069 -9.077 1.00244.30 O ANISOU 6687 O ALA H 49 35208 31231 26384 -143 -327 2239 O ATOM 6688 CB ALA H 49 13.704 -61.553 -7.911 1.00238.17 C ANISOU 6688 CB ALA H 49 34300 30291 25904 -590 -44 2368 C ATOM 6689 N ALA H 50 13.456 -64.432 -9.085 1.00263.02 N ANISOU 6689 N ALA H 50 37754 33384 28798 -616 308 2145 N ATOM 6690 CA ALA H 50 13.519 -65.915 -9.132 1.00276.83 C ANISOU 6690 CA ALA H 50 39988 34903 30292 -583 495 2040 C ATOM 6691 C ALA H 50 14.144 -66.504 -10.433 1.00290.17 C ANISOU 6691 C ALA H 50 41295 36919 32035 -460 333 2060 C ATOM 6692 O ALA H 50 15.102 -67.294 -10.359 1.00293.89 O ANISOU 6692 O ALA H 50 42082 37299 32284 -152 127 2055 O ATOM 6693 CB ALA H 50 12.130 -66.504 -8.885 1.00272.39 C ANISOU 6693 CB ALA H 50 39709 34103 29682 -993 1074 1783 C ATOM 6694 N VAL H 51 13.600 -66.106 -11.599 1.00300.08 N ANISOU 6694 N VAL H 51 41919 38549 33547 -633 390 2041 N ATOM 6695 CA VAL H 51 13.986 -66.607 -12.946 1.00296.22 C ANISOU 6695 CA VAL H 51 41055 38373 33121 -575 303 2050 C ATOM 6696 C VAL H 51 15.481 -66.546 -13.185 1.00293.87 C ANISOU 6696 C VAL H 51 40638 38226 32791 -312 -58 2146 C ATOM 6697 O VAL H 51 16.087 -67.539 -13.559 1.00296.89 O ANISOU 6697 O VAL H 51 41113 38638 33050 -153 -133 2083 O ATOM 6698 CB VAL H 51 13.261 -65.859 -14.098 1.00291.43 C ANISOU 6698 CB VAL H 51 39873 38122 32732 -676 314 2022 C ATOM 6699 CG1 VAL H 51 14.058 -65.934 -15.375 1.00285.50 C ANISOU 6699 CG1 VAL H 51 38802 37657 32015 -567 135 2125 C ATOM 6700 CG2 VAL H 51 11.884 -66.463 -14.356 1.00289.77 C ANISOU 6700 CG2 VAL H 51 39572 37957 32570 -878 652 1695 C ATOM 6701 N ARG H 52 16.063 -65.380 -12.957 1.00283.46 N ANISOU 6701 N ARG H 52 39101 37017 31583 -288 -253 2216 N ATOM 6702 CA ARG H 52 17.483 -65.205 -13.171 1.00268.89 C ANISOU 6702 CA ARG H 52 37011 35394 29760 -134 -525 2125 C ATOM 6703 C ARG H 52 18.333 -65.826 -12.051 1.00256.28 C ANISOU 6703 C ARG H 52 35788 33637 27948 245 -797 1936 C ATOM 6704 O ARG H 52 19.437 -66.282 -12.313 1.00251.17 O ANISOU 6704 O ARG H 52 34961 33213 27256 499 -1055 1697 O ATOM 6705 CB ARG H 52 17.818 -63.736 -13.424 1.00273.38 C ANISOU 6705 CB ARG H 52 37247 36123 30502 -334 -529 2170 C ATOM 6706 CG ARG H 52 17.149 -63.182 -14.673 1.00278.76 C ANISOU 6706 CG ARG H 52 37742 36915 31256 -543 -341 2323 C ATOM 6707 CD ARG H 52 17.686 -61.802 -15.035 1.00281.73 C ANISOU 6707 CD ARG H 52 38017 37344 31682 -749 -278 2351 C ATOM 6708 NE ARG H 52 16.882 -61.142 -16.073 1.00283.65 N ANISOU 6708 NE ARG H 52 38362 37554 31857 -812 -143 2520 N ATOM 6709 CZ ARG H 52 16.995 -59.862 -16.439 1.00282.48 C ANISOU 6709 CZ ARG H 52 38415 37290 31624 -959 -22 2604 C ATOM 6710 NH1 ARG H 52 17.879 -59.057 -15.854 1.00279.14 N ANISOU 6710 NH1 ARG H 52 38010 36807 31242 -1183 57 2512 N ATOM 6711 NH2 ARG H 52 16.209 -59.377 -17.395 1.00282.65 N ANISOU 6711 NH2 ARG H 52 38689 37232 31471 -849 20 2730 N ATOM 6712 N GLY H 53 17.807 -65.874 -10.824 1.00244.83 N ANISOU 6712 N GLY H 53 34897 31800 26327 334 -756 1982 N ATOM 6713 CA GLY H 53 18.430 -66.644 -9.738 1.00239.01 C ANISOU 6713 CA GLY H 53 34802 30777 25234 818 -1020 1809 C ATOM 6714 C GLY H 53 18.493 -68.110 -10.126 1.00241.42 C ANISOU 6714 C GLY H 53 35541 30932 25255 1043 -996 1744 C ATOM 6715 O GLY H 53 19.558 -68.733 -10.069 1.00240.28 O ANISOU 6715 O GLY H 53 35513 30880 24902 1553 -1392 1493 O ATOM 6716 N VAL H 54 17.344 -68.635 -10.559 1.00246.10 N ANISOU 6716 N VAL H 54 36325 31333 25846 670 -534 1891 N ATOM 6717 CA VAL H 54 17.198 -70.002 -11.108 1.00254.14 C ANISOU 6717 CA VAL H 54 37726 32200 26635 725 -368 1841 C ATOM 6718 C VAL H 54 18.085 -70.233 -12.351 1.00258.74 C ANISOU 6718 C VAL H 54 37635 33287 27385 869 -641 1761 C ATOM 6719 O VAL H 54 18.847 -71.214 -12.405 1.00260.32 O ANISOU 6719 O VAL H 54 38172 33435 27302 1305 -890 1602 O ATOM 6720 CB VAL H 54 15.703 -70.329 -11.422 1.00252.25 C ANISOU 6720 CB VAL H 54 37590 31781 26470 163 255 1876 C ATOM 6721 CG1 VAL H 54 15.533 -71.614 -12.223 1.00249.92 C ANISOU 6721 CG1 VAL H 54 37499 31429 26028 106 482 1791 C ATOM 6722 CG2 VAL H 54 14.910 -70.446 -10.139 1.00253.37 C ANISOU 6722 CG2 VAL H 54 38582 31338 26345 -5 630 1832 C ATOM 6723 N ARG H 55 17.987 -69.333 -13.338 1.00262.07 N ANISOU 6723 N ARG H 55 37205 34156 28212 537 -591 1842 N ATOM 6724 CA ARG H 55 18.801 -69.405 -14.572 1.00265.66 C ANISOU 6724 CA ARG H 55 37029 35073 28836 565 -754 1753 C ATOM 6725 C ARG H 55 20.321 -69.383 -14.317 1.00263.46 C ANISOU 6725 C ARG H 55 36546 35050 28507 981 -1212 1424 C ATOM 6726 O ARG H 55 21.091 -69.945 -15.113 1.00269.24 O ANISOU 6726 O ARG H 55 36963 36084 29251 1131 -1367 1218 O ATOM 6727 CB ARG H 55 18.435 -68.285 -15.555 1.00272.25 C ANISOU 6727 CB ARG H 55 37228 36213 30001 159 -585 1895 C ATOM 6728 CG ARG H 55 17.268 -68.561 -16.496 1.00279.80 C ANISOU 6728 CG ARG H 55 38084 37193 31031 -96 -281 2022 C ATOM 6729 CD ARG H 55 17.403 -67.709 -17.757 1.00287.80 C ANISOU 6729 CD ARG H 55 38591 38532 32227 -270 -261 2094 C ATOM 6730 NE ARG H 55 16.487 -66.558 -17.867 1.00287.94 N ANISOU 6730 NE ARG H 55 38555 38517 32329 -425 -150 2217 N ATOM 6731 CZ ARG H 55 16.814 -65.265 -17.726 1.00286.73 C ANISOU 6731 CZ ARG H 55 38361 38359 32222 -510 -187 2293 C ATOM 6732 NH1 ARG H 55 18.054 -64.881 -17.422 1.00291.27 N ANISOU 6732 NH1 ARG H 55 38838 39003 32825 -547 -281 2197 N ATOM 6733 NH2 ARG H 55 15.877 -64.334 -17.883 1.00279.14 N ANISOU 6733 NH2 ARG H 55 37465 37333 31260 -544 -126 2385 N ATOM 6734 N GLN H 56 20.740 -68.728 -13.226 1.00255.43 N ANISOU 6734 N GLN H 56 35642 33960 27447 1173 -1434 1290 N ATOM 6735 CA GLN H 56 22.158 -68.665 -12.842 1.00250.73 C ANISOU 6735 CA GLN H 56 34777 33675 26810 1627 -1913 791 C ATOM 6736 C GLN H 56 22.638 -69.992 -12.243 1.00252.92 C ANISOU 6736 C GLN H 56 35752 33728 26617 2376 -2309 540 C ATOM 6737 O GLN H 56 23.702 -70.480 -12.629 1.00258.55 O ANISOU 6737 O GLN H 56 36129 34817 27289 2780 -2680 82 O ATOM 6738 CB GLN H 56 22.458 -67.462 -11.925 1.00248.49 C ANISOU 6738 CB GLN H 56 34319 33440 26652 1587 -2027 653 C ATOM 6739 CG GLN H 56 23.944 -67.197 -11.651 1.00249.27 C ANISOU 6739 CG GLN H 56 33877 34018 26815 1952 -2478 -49 C ATOM 6740 CD GLN H 56 24.762 -66.754 -12.860 1.00248.08 C ANISOU 6740 CD GLN H 56 32789 34450 27017 1541 -2330 -406 C ATOM 6741 OE1 GLN H 56 24.234 -66.211 -13.829 1.00245.42 O ANISOU 6741 OE1 GLN H 56 32230 34119 26897 912 -1864 -50 O ATOM 6742 NE2 GLN H 56 26.073 -66.971 -12.791 1.00250.68 N ANISOU 6742 NE2 GLN H 56 32603 35272 27370 1924 -2726 -1198 N ATOM 6743 N ALA H 57 21.846 -70.579 -11.337 1.00248.85 N ANISOU 6743 N ALA H 57 36266 32577 25707 2558 -2196 792 N ATOM 6744 CA ALA H 57 22.137 -71.896 -10.742 1.00248.21 C ANISOU 6744 CA ALA H 57 37221 32069 25016 3283 -2481 628 C ATOM 6745 C ALA H 57 22.337 -72.958 -11.806 1.00249.26 C ANISOU 6745 C ALA H 57 37294 32337 25077 3368 -2468 575 C ATOM 6746 O ALA H 57 23.291 -73.717 -11.765 1.00247.06 O ANISOU 6746 O ALA H 57 37226 32161 24484 4093 -2973 174 O ATOM 6747 CB ALA H 57 21.028 -72.312 -9.792 1.00245.60 C ANISOU 6747 CB ALA H 57 38113 30929 24275 3185 -2085 962 C ATOM 6748 N GLN H 58 21.439 -72.981 -12.774 1.00256.79 N ANISOU 6748 N GLN H 58 37923 33328 26318 2677 -1930 922 N ATOM 6749 CA GLN H 58 21.564 -73.876 -13.906 1.00275.42 C ANISOU 6749 CA GLN H 58 40095 35867 28684 2657 -1868 896 C ATOM 6750 C GLN H 58 22.683 -73.538 -14.927 1.00297.98 C ANISOU 6750 C GLN H 58 41844 39474 31898 2709 -2183 563 C ATOM 6751 O GLN H 58 23.273 -74.467 -15.485 1.00306.24 O ANISOU 6751 O GLN H 58 42902 40668 32787 3066 -2404 336 O ATOM 6752 CB GLN H 58 20.223 -73.993 -14.607 1.00267.66 C ANISOU 6752 CB GLN H 58 39080 34728 27891 1941 -1218 1270 C ATOM 6753 CG GLN H 58 19.076 -74.326 -13.670 1.00261.05 C ANISOU 6753 CG GLN H 58 39231 33204 26753 1728 -764 1449 C ATOM 6754 CD GLN H 58 17.738 -73.869 -14.223 1.00258.41 C ANISOU 6754 CD GLN H 58 38458 32939 26787 966 -185 1632 C ATOM 6755 OE1 GLN H 58 17.678 -73.167 -15.247 1.00262.58 O ANISOU 6755 OE1 GLN H 58 38027 33989 27751 691 -199 1691 O ATOM 6756 NE2 GLN H 58 16.655 -74.262 -13.554 1.00253.23 N ANISOU 6756 NE2 GLN H 58 38545 31751 25918 643 338 1644 N ATOM 6757 N ALA H 59 22.983 -72.247 -15.173 1.00314.37 N ANISOU 6757 N ALA H 59 43044 41985 34416 2326 -2152 490 N ATOM 6758 CA ALA H 59 24.046 -71.821 -16.156 1.00322.32 C ANISOU 6758 CA ALA H 59 43037 43666 35762 2197 -2278 90 C ATOM 6759 C ALA H 59 25.513 -72.142 -15.758 1.00330.82 C ANISOU 6759 C ALA H 59 43838 45143 36715 2892 -2893 -682 C ATOM 6760 O ALA H 59 26.383 -72.366 -16.622 1.00324.37 O ANISOU 6760 O ALA H 59 42346 44841 36056 2915 -3009 -1130 O ATOM 6761 CB ALA H 59 23.905 -70.341 -16.526 1.00311.97 C ANISOU 6761 CB ALA H 59 41086 42581 34867 1521 -1943 204 C ATOM 6762 N GLU H 60 25.768 -72.151 -14.449 1.00338.70 N ATOM 6763 CA GLU H 60 27.073 -72.525 -13.861 1.00343.54 C ATOM 6764 C GLU H 60 27.038 -73.942 -13.215 1.00348.93 C ATOM 6765 O GLU H 60 27.938 -74.362 -12.460 1.00356.69 O ATOM 6766 CB GLU H 60 27.539 -71.441 -12.868 1.00334.07 C ATOM 6767 CG GLU H 60 26.680 -71.306 -11.615 1.00318.38 C ATOM 6768 CD GLU H 60 27.127 -70.182 -10.690 1.00309.30 C ATOM 6769 OE1 GLU H 60 27.623 -70.494 -9.583 1.00312.47 O ATOM 6770 OE2 GLU H 60 26.978 -68.993 -11.060 1.00296.55 O