>>4NE1:HELIX   36  36 SER L   31  GLU L   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 36 36 SER L 31 GLU L 60 1 30 ATOM 10912 N SER L 31 111.834 17.717 35.840 1.00323.24 N ANISOU10912 N SER L 31 38299 44232 40285 452 -1554 -1806 N ATOM 10913 CA SER L 31 112.470 18.856 35.153 1.00317.64 C ANISOU10913 CA SER L 31 37525 43635 39527 263 -1859 -1494 C ATOM 10914 C SER L 31 111.429 19.823 34.574 1.00319.39 C ANISOU10914 C SER L 31 37530 43902 39920 149 -2185 -1083 C ATOM 10915 O SER L 31 110.279 19.432 34.377 1.00318.86 O ANISOU10915 O SER L 31 37354 43916 39881 114 -2153 -1074 O ATOM 10916 CB SER L 31 113.441 18.368 34.067 1.00313.00 C ANISOU10916 CB SER L 31 36880 43485 38559 -118 -1798 -1573 C ATOM 10917 OG SER L 31 112.761 17.773 32.974 1.00307.61 O ANISOU10917 OG SER L 31 35999 43261 37616 -475 -1765 -1606 O ATOM 10918 N GLY L 32 111.829 21.075 34.320 1.00323.08 N ANISOU10918 N GLY L 32 37901 44287 40567 91 -2509 -715 N ATOM 10919 CA GLY L 32 110.918 22.128 33.830 1.00333.68 C ANISOU10919 CA GLY L 32 38965 45578 42240 -6 -2873 -228 C ATOM 10920 C GLY L 32 110.099 21.734 32.609 1.00345.45 C ANISOU10920 C GLY L 32 40222 47586 43447 -412 -2972 20 C ATOM 10921 O GLY L 32 108.868 21.924 32.567 1.00350.68 O ANISOU10921 O GLY L 32 40711 48157 44371 -380 -3087 210 O ATOM 10922 N ASP L 33 110.778 21.170 31.618 1.00351.61 N ANISOU10922 N ASP L 33 40970 48941 43683 -814 -2915 -12 N ATOM 10923 CA ASP L 33 110.108 20.699 30.410 1.00355.53 C ANISOU10923 CA ASP L 33 41225 50071 43788 -1276 -2977 135 C ATOM 10924 C ASP L 33 109.344 19.402 30.544 1.00356.04 C ANISOU10924 C ASP L 33 41356 50224 43699 -1233 -2642 -339 C ATOM 10925 O ASP L 33 108.286 19.285 29.935 1.00357.07 O ANISOU10925 O ASP L 33 41274 50634 43759 -1453 -2755 -150 O ATOM 10926 CB ASP L 33 111.060 20.609 29.230 1.00353.15 C ANISOU10926 CB ASP L 33 40790 50467 42922 -1793 -3031 225 C ATOM 10927 CG ASP L 33 111.137 21.890 28.466 1.00352.89 C ANISOU10927 CG ASP L 33 40460 50667 42952 -2099 -3513 990 C ATOM 10928 OD1 ASP L 33 110.709 22.937 29.016 1.00352.33 O ANISOU10928 OD1 ASP L 33 40320 50043 43505 -1823 -3793 1397 O ATOM 10929 OD2 ASP L 33 111.706 21.881 27.360 1.00352.38 O ANISOU10929 OD2 ASP L 33 40202 51324 42361 -2616 -3607 1174 O ATOM 10930 N ALA L 34 109.874 18.435 31.305 1.00355.46 N ANISOU10930 N ALA L 34 41533 49919 43605 -977 -2255 -902 N ATOM 10931 CA ALA L 34 109.134 17.208 31.634 1.00357.61 C ANISOU10931 CA ALA L 34 41849 50134 43891 -866 -1937 -1325 C ATOM 10932 C ALA L 34 107.801 17.521 32.319 1.00366.09 C ANISOU10932 C ALA L 34 42903 50833 45360 -567 -2023 -1147 C ATOM 10933 O ALA L 34 106.810 16.826 32.063 1.00371.82 O ANISOU10933 O ALA L 34 43522 51703 46047 -654 -1930 -1253 O ATOM 10934 CB ALA L 34 109.962 16.281 32.503 1.00345.25 C ANISOU10934 CB ALA L 34 40506 48274 42398 -598 -1570 -1815 C ATOM 10935 N LEU L 35 107.788 18.563 33.172 1.00373.54 N ANISOU10935 N LEU L 35 43918 51306 46702 -233 -2187 -922 N ATOM 10936 CA LEU L 35 106.557 19.072 33.865 1.00374.01 C ANISOU10936 CA LEU L 35 43905 50980 47219 57 -2277 -775 C ATOM 10937 C LEU L 35 105.519 19.717 32.892 1.00378.14 C ANISOU10937 C LEU L 35 44101 51717 47856 -222 -2624 -273 C ATOM 10938 O LEU L 35 104.299 19.445 32.980 1.00405.25 O ANISOU10938 O LEU L 35 47424 55093 51459 -162 -2600 -253 O ATOM 10939 CB LEU L 35 106.906 20.021 35.053 1.00357.10 C ANISOU10939 CB LEU L 35 41872 48302 45505 461 -2323 -792 C ATOM 10940 CG LEU L 35 105.843 20.339 36.131 1.00342.00 C ANISOU10940 CG LEU L 35 39921 45965 44057 835 -2263 -893 C ATOM 10941 CD1 LEU L 35 105.399 19.066 36.840 1.00331.48 C ANISOU10941 CD1 LEU L 35 38734 44653 42557 1003 -1890 -1276 C ATOM 10942 CD2 LEU L 35 106.297 21.407 37.121 1.00332.45 C ANISOU10942 CD2 LEU L 35 38744 44324 43246 1136 -2331 -969 C ATOM 10943 N GLN L 36 106.019 20.545 31.968 1.00358.82 N ANISOU10943 N GLN L 36 41473 49540 45320 -549 -2956 175 N ATOM 10944 CA AGLN L 36 105.190 21.196 30.952 0.50346.07 C ANISOU10944 CA AGLN L 36 39487 48210 43792 -896 -3345 783 C ATOM 10945 CA BGLN L 36 105.188 21.195 30.953 0.50346.09 C ANISOU10945 CA BGLN L 36 39490 48212 43795 -896 -3344 782 C ATOM 10946 C GLN L 36 104.655 20.216 29.892 1.00341.43 C ANISOU10946 C GLN L 36 38766 48310 42649 -1343 -3280 732 C ATOM 10947 O GLN L 36 103.617 20.461 29.273 1.00337.92 O ANISOU10947 O GLN L 36 38030 48076 42287 -1570 -3529 1145 O ATOM 10948 CB AGLN L 36 105.973 22.343 30.313 0.50341.09 C ANISOU10948 CB AGLN L 36 38665 47704 43229 -1144 -3729 1338 C ATOM 10949 CB BGLN L 36 105.964 22.348 30.316 0.50341.16 C ANISOU10949 CB BGLN L 36 38672 47710 43242 -1142 -3731 1340 C ATOM 10950 CG AGLN L 36 105.819 23.670 31.034 0.50339.32 C ANISOU10950 CG AGLN L 36 38315 46784 43826 -807 -3986 1648 C ATOM 10951 CG BGLN L 36 105.749 23.683 31.004 0.50339.56 C ANISOU10951 CG BGLN L 36 38327 46819 43870 -816 -4000 1672 C ATOM 10952 CD AGLN L 36 104.600 24.434 30.556 0.50341.53 C ANISOU10952 CD AGLN L 36 38161 46977 44626 -936 -4370 2277 C ATOM 10953 CD BGLN L 36 104.491 24.370 30.516 0.50341.76 C ANISOU10953 CD BGLN L 36 38179 47034 44638 -950 -4366 2280 C ATOM 10954 OE1AGLN L 36 103.831 24.964 31.354 0.50341.83 O ANISOU10954 OE1AGLN L 36 38100 46397 45381 -570 -4395 2246 O ATOM 10955 OE1BGLN L 36 103.730 24.934 31.296 0.50342.11 O ANISOU10955 OE1BGLN L 36 38115 46458 45410 -590 -4405 2272 O ATOM 10956 NE2AGLN L 36 104.411 24.479 29.244 0.50343.58 N ANISOU10956 NE2AGLN L 36 38118 47896 44528 -1486 -4667 2846 N ATOM 10957 NE2BGLN L 36 104.259 24.308 29.212 0.50343.84 N ANISOU10957 NE2BGLN L 36 38159 47981 44501 -1499 -4633 2802 N ATOM 10958 N LEU L 37 105.363 19.105 29.696 1.00339.48 N ANISOU10958 N LEU L 37 38696 48402 41886 -1478 -2945 201 N ATOM 10959 CA LEU L 37 104.914 18.037 28.800 1.00340.52 C ANISOU10959 CA LEU L 37 38696 49154 41529 -1882 -2801 -45 C ATOM 10960 C LEU L 37 103.866 17.101 29.390 1.00333.46 C ANISOU10960 C LEU L 37 37873 47995 40831 -1628 -2535 -412 C ATOM 10961 O LEU L 37 103.006 16.636 28.655 1.00328.91 O ANISOU10961 O LEU L 37 37086 47835 40048 -1941 -2574 -386 O ATOM 10962 CB LEU L 37 106.086 17.223 28.268 1.00351.08 C ANISOU10962 CB LEU L 37 40103 50955 42333 -2167 -2536 -527 C ATOM 10963 CG LEU L 37 106.474 17.615 26.844 1.00363.90 C ANISOU10963 CG LEU L 37 41427 53439 43396 -2822 -2794 -192 C ATOM 10964 CD1 LEU L 37 107.885 17.161 26.557 1.00372.00 C ANISOU10964 CD1 LEU L 37 42543 54764 44033 -3000 -2549 -633 C ATOM 10965 CD2 LEU L 37 105.496 17.071 25.809 1.00369.58 C ANISOU10965 CD2 LEU L 37 41841 54862 43719 -3318 -2848 -182 C ATOM 10966 N MET L 38 103.938 16.800 30.690 1.00329.68 N ANISOU10966 N MET L 38 37660 46886 40714 -1104 -2272 -738 N ATOM 10967 CA MET L 38 102.873 16.009 31.342 1.00323.92 C ANISOU10967 CA MET L 38 36966 45885 40223 -846 -2049 -989 C ATOM 10968 C MET L 38 101.564 16.803 31.423 1.00324.71 C ANISOU10968 C MET L 38 36876 45795 40701 -753 -2323 -535 C ATOM 10969 O MET L 38 100.491 16.208 31.493 1.00327.13 O ANISOU10969 O MET L 38 37102 46087 41103 -719 -2229 -622 O ATOM 10970 CB MET L 38 103.278 15.484 32.731 1.00315.62 C ANISOU10970 CB MET L 38 36195 44304 39422 -360 -1716 -1379 C ATOM 10971 CG MET L 38 103.867 14.077 32.770 1.00304.83 C ANISOU10971 CG MET L 38 34912 43032 37874 -412 -1343 -1910 C ATOM 10972 SD MET L 38 102.726 12.687 32.609 1.00291.89 S ANISOU10972 SD MET L 38 33125 41482 36296 -490 -1098 -2226 S ATOM 10973 CE MET L 38 101.553 12.998 33.932 1.00286.52 C ANISOU10973 CE MET L 38 32513 40275 36074 4 -1091 -2021 C ATOM 10974 N VAL L 39 101.676 18.136 31.410 1.00320.32 N ANISOU10974 N VAL L 39 36216 45061 40429 -713 -2661 -53 N ATOM 10975 CA VAL L 39 100.557 19.057 31.168 1.00312.79 C ANISOU10975 CA VAL L 39 34960 43984 39902 -744 -3012 494 C ATOM 10976 C VAL L 39 99.847 18.667 29.867 1.00309.67 C ANISOU10976 C VAL L 39 34280 44244 39135 -1271 -3191 763 C ATOM 10977 O VAL L 39 98.624 18.542 29.844 1.00308.60 O ANISOU10977 O VAL L 39 33976 44051 39227 -1252 -3249 901 O ATOM 10978 CB VAL L 39 101.049 20.538 31.127 1.00314.26 C ANISOU10978 CB VAL L 39 34997 43924 40480 -721 -3383 1000 C ATOM 10979 CG1 VAL L 39 100.117 21.453 30.334 1.00314.12 C ANISOU10979 CG1 VAL L 39 34533 43995 40822 -983 -3849 1740 C ATOM 10980 CG2 VAL L 39 101.266 21.080 32.534 1.00316.89 C ANISOU10980 CG2 VAL L 39 35507 43537 41357 -167 -3239 733 C ATOM 10981 N GLU L 40 100.627 18.463 28.801 1.00305.97 N ANISOU10981 N GLU L 40 33742 44442 38070 -1761 -3266 808 N ATOM 10982 CA GLU L 40 100.114 18.002 27.508 1.00306.79 C ANISOU10982 CA GLU L 40 33559 45342 37661 -2354 -3400 963 C ATOM 10983 C GLU L 40 99.514 16.585 27.550 1.00302.04 C ANISOU10983 C GLU L 40 33033 44884 36844 -2366 -3030 347 C ATOM 10984 O GLU L 40 98.443 16.370 26.990 1.00308.07 O ANISOU10984 O GLU L 40 33553 45950 37549 -2616 -3161 532 O ATOM 10985 CB GLU L 40 101.193 18.108 26.416 1.00309.63 C ANISOU10985 CB GLU L 40 33807 46459 37378 -2900 -3517 1064 C ATOM 10986 CG GLU L 40 101.834 19.488 26.297 1.00313.91 C ANISOU10986 CG GLU L 40 34233 46892 38145 -2933 -3906 1730 C ATOM 10987 CD GLU L 40 100.941 20.518 25.609 1.00320.12 C ANISOU10987 CD GLU L 40 34568 47865 39197 -3229 -4450 2661 C ATOM 10988 OE1 GLU L 40 101.257 21.727 25.671 1.00326.85 O ANISOU10988 OE1 GLU L 40 35266 48427 40495 -3171 -4800 3272 O ATOM 10989 OE2 GLU L 40 99.935 20.132 24.972 1.00320.49 O ANISOU10989 OE2 GLU L 40 34370 48351 39048 -3547 -4553 2820 O ATOM 10990 N LEU L 41 100.183 15.637 28.217 1.00291.67 N ANISOU10990 N LEU L 41 32015 43328 35478 -2105 -2594 -338 N ATOM 10991 CA LEU L 41 99.729 14.232 28.280 1.00284.39 C ANISOU10991 CA LEU L 41 31121 42473 34459 -2114 -2231 -939 C ATOM 10992 C LEU L 41 98.375 14.081 28.957 1.00281.06 C ANISOU10992 C LEU L 41 30676 41616 34494 -1791 -2210 -845 C ATOM 10993 O LEU L 41 97.484 13.419 28.427 1.00278.59 O ANISOU10993 O LEU L 41 30179 41605 34066 -2032 -2186 -945 O ATOM 10994 CB LEU L 41 100.774 13.326 28.952 1.00279.48 C ANISOU10994 CB LEU L 41 30763 41573 33852 -1868 -1805 -1585 C ATOM 10995 CG LEU L 41 100.495 11.820 29.111 1.00277.40 C ANISOU10995 CG LEU L 41 30491 41260 33648 -1845 -1408 -2224 C ATOM 10996 CD1 LEU L 41 100.079 11.138 27.813 1.00279.67 C ANISOU10996 CD1 LEU L 41 30470 42277 33513 -2433 -1400 -2483 C ATOM 10997 CD2 LEU L 41 101.703 11.115 29.679 1.00275.18 C ANISOU10997 CD2 LEU L 41 30395 40705 33455 -1651 -1066 -2719 C ATOM 10998 N LEU L 42 98.229 14.700 30.123 1.00279.34 N ANISOU10998 N LEU L 42 30623 40728 34783 -1268 -2210 -687 N ATOM 10999 CA LEU L 42 96.967 14.692 30.840 1.00279.85 C ANISOU10999 CA LEU L 42 30644 40379 35305 -946 -2185 -590 C ATOM 11000 C LEU L 42 95.862 15.416 30.065 1.00284.60 C ANISOU11000 C LEU L 42 30907 41200 36027 -1209 -2580 -8 C ATOM 11001 O LEU L 42 94.741 14.942 30.031 1.00280.40 O ANISOU11001 O LEU L 42 30243 40672 35622 -1217 -2548 -13 O ATOM 11002 CB LEU L 42 97.137 15.254 32.260 1.00278.66 C ANISOU11002 CB LEU L 42 30700 39555 35624 -377 -2076 -620 C ATOM 11003 CG LEU L 42 97.842 14.352 33.298 1.00273.55 C ANISOU11003 CG LEU L 42 30342 38640 34955 -58 -1662 -1140 C ATOM 11004 CD1 LEU L 42 98.167 15.082 34.603 1.00270.15 C ANISOU11004 CD1 LEU L 42 30079 37706 34858 403 -1604 -1143 C ATOM 11005 CD2 LEU L 42 97.039 13.089 33.590 1.00272.72 C ANISOU11005 CD2 LEU L 42 30210 38501 34909 9 -1381 -1440 C ATOM 11006 N LYS L 43 96.195 16.542 29.435 1.00293.74 N ANISOU11006 N LYS L 43 31893 42541 37174 -1442 -2967 530 N ATOM 11007 CA LYS L 43 95.269 17.296 28.576 1.00307.10 C ANISOU11007 CA LYS L 43 33186 44498 38998 -1772 -3414 1221 C ATOM 11008 C LYS L 43 94.706 16.397 27.482 1.00311.79 C ANISOU11008 C LYS L 43 33582 45834 39049 -2301 -3428 1147 C ATOM 11009 O LYS L 43 93.490 16.317 27.296 1.00308.96 O ANISOU11009 O LYS L 43 33000 45501 38890 -2368 -3556 1383 O ATOM 11010 CB LYS L 43 95.989 18.538 28.005 1.00319.71 C ANISOU11010 CB LYS L 43 34607 46246 40620 -2005 -3822 1828 C ATOM 11011 CG LYS L 43 95.258 19.453 27.016 1.00339.45 C ANISOU11011 CG LYS L 43 36618 49076 43280 -2425 -4370 2715 C ATOM 11012 CD LYS L 43 95.990 20.786 26.870 1.00352.96 C ANISOU11012 CD LYS L 43 38167 50632 45309 -2467 -4740 3317 C ATOM 11013 CE LYS L 43 95.607 21.555 25.602 1.00365.10 C ANISOU11013 CE LYS L 43 39171 52759 46792 -3072 -5318 4284 C ATOM 11014 NZ LYS L 43 94.422 22.454 25.736 1.00373.69 N ANISOU11014 NZ LYS L 43 39849 53349 48788 -2941 -5688 4969 N ATOM 11015 N VAL L 44 95.603 15.698 26.792 1.00321.32 N ANISOU11015 N VAL L 44 34853 47641 39593 -2678 -3273 758 N ATOM 11016 CA VAL L 44 95.222 14.822 25.691 1.00336.78 C ANISOU11016 CA VAL L 44 36588 50403 40969 -3250 -3251 552 C ATOM 11017 C VAL L 44 94.452 13.626 26.230 1.00339.19 C ANISOU11017 C VAL L 44 36994 50426 41456 -3008 -2886 -23 C ATOM 11018 O VAL L 44 93.489 13.172 25.614 1.00343.54 O ANISOU11018 O VAL L 44 37300 51363 41864 -3320 -2962 5 O ATOM 11019 CB VAL L 44 96.437 14.333 24.871 1.00342.47 C ANISOU11019 CB VAL L 44 37317 51830 40976 -3710 -3108 132 C ATOM 11020 CG1 VAL L 44 95.990 13.353 23.796 1.00350.26 C ANISOU11020 CG1 VAL L 44 38035 53660 41385 -4309 -3027 -240 C ATOM 11021 CG2 VAL L 44 97.161 15.499 24.217 1.00349.34 C ANISOU11021 CG2 VAL L 44 38030 53097 41603 -4032 -3500 775 C ATOM 11022 N PHE L 45 94.869 13.121 27.383 1.00341.91 N ANISOU11022 N PHE L 45 37668 50116 42123 -2475 -2508 -503 N ATOM 11023 CA PHE L 45 94.160 12.012 27.987 1.00355.59 C ANISOU11023 CA PHE L 45 39468 51533 44107 -2223 -2177 -963 C ATOM 11024 C PHE L 45 92.708 12.376 28.323 1.00358.86 C ANISOU11024 C PHE L 45 39736 51649 44963 -2029 -2352 -542 C ATOM 11025 O PHE L 45 91.798 11.622 27.971 1.00364.32 O ANISOU11025 O PHE L 45 40261 52541 45620 -2206 -2298 -687 O ATOM 11026 CB PHE L 45 94.900 11.481 29.210 1.00363.57 C ANISOU11026 CB PHE L 45 40809 51932 45399 -1711 -1787 -1417 C ATOM 11027 CG PHE L 45 94.122 10.459 29.978 1.00381.05 C ANISOU11027 CG PHE L 45 43057 53757 47966 -1412 -1487 -1739 C ATOM 11028 CD1 PHE L 45 93.969 9.168 29.490 1.00386.93 C ANISOU11028 CD1 PHE L 45 43670 54754 48590 -1669 -1251 -2252 C ATOM 11029 CD2 PHE L 45 93.513 10.791 31.178 1.00386.92 C ANISOU11029 CD2 PHE L 45 43914 53904 49190 -900 -1438 -1541 C ATOM 11030 CE1 PHE L 45 93.240 8.219 30.193 1.00395.18 C ANISOU11030 CE1 PHE L 45 44704 55417 50027 -1404 -996 -2489 C ATOM 11031 CE2 PHE L 45 92.782 9.849 31.891 1.00393.12 C ANISOU11031 CE2 PHE L 45 44699 54387 50280 -652 -1172 -1775 C ATOM 11032 CZ PHE L 45 92.642 8.559 31.397 1.00396.48 C ANISOU11032 CZ PHE L 45 44998 55024 50623 -898 -965 -2209 C ATOM 11033 N VAL L 46 92.499 13.522 28.985 1.00356.52 N ANISOU11033 N VAL L 46 39469 50870 45121 -1680 -2553 -63 N ATOM 11034 CA VAL L 46 91.143 13.990 29.362 1.00356.58 C ANISOU11034 CA VAL L 46 39295 50529 45657 -1466 -2713 329 C ATOM 11035 C VAL L 46 90.284 14.339 28.144 1.00362.04 C ANISOU11035 C VAL L 46 39587 51765 46204 -1983 -3126 871 C ATOM 11036 O VAL L 46 89.121 13.932 28.076 1.00360.35 O ANISOU11036 O VAL L 46 39204 51551 46159 -2009 -3137 925 O ATOM 11037 CB VAL L 46 91.144 15.188 30.345 1.00351.98 C ANISOU11037 CB VAL L 46 38763 49287 45685 -990 -2814 630 C ATOM 11038 CG1 VAL L 46 89.715 15.587 30.690 1.00353.65 C ANISOU11038 CG1 VAL L 46 38731 49151 46488 -793 -2938 949 C ATOM 11039 CG2 VAL L 46 91.901 14.847 31.621 1.00343.79 C ANISOU11039 CG2 VAL L 46 38089 47785 44749 -506 -2416 119 C ATOM 11040 N VAL L 47 90.855 15.091 27.199 1.00364.46 N ANISOU11040 N VAL L 47 39719 52561 46197 -2410 -3478 1314 N ATOM 11041 CA VAL L 47 90.192 15.379 25.915 1.00368.22 C ANISOU11041 CA VAL L 47 39769 53742 46393 -3025 -3905 1891 C ATOM 11042 C VAL L 47 89.826 14.076 25.175 1.00374.31 C ANISOU11042 C VAL L 47 40462 55176 46582 -3455 -3719 1400 C ATOM 11043 O VAL L 47 88.708 13.965 24.676 1.00373.67 O ANISOU11043 O VAL L 47 40088 55359 46530 -3707 -3919 1692 O ATOM 11044 CB VAL L 47 91.008 16.358 25.020 1.00366.22 C ANISOU11044 CB VAL L 47 39316 54003 45826 -3468 -4309 2477 C ATOM 11045 CG1 VAL L 47 90.505 16.362 23.581 1.00369.05 C ANISOU11045 CG1 VAL L 47 39229 55356 45637 -4243 -4693 2970 C ATOM 11046 CG2 VAL L 47 90.956 17.767 25.588 1.00363.11 C ANISOU11046 CG2 VAL L 47 38819 52931 46213 -3113 -4613 3130 C ATOM 11047 N GLU L 48 90.736 13.090 25.138 1.00379.38 N ANISOU11047 N GLU L 48 41332 56038 46777 -3527 -3332 634 N ATOM 11048 CA GLU L 48 90.445 11.756 24.532 1.00384.28 C ANISOU11048 CA GLU L 48 41851 57184 46972 -3895 -3084 -1 C ATOM 11049 C GLU L 48 89.446 10.872 25.325 1.00380.42 C ANISOU11049 C GLU L 48 41439 56139 46965 -3500 -2800 -352 C ATOM 11050 O GLU L 48 88.618 10.178 24.714 1.00394.69 O ANISOU11050 O GLU L 48 43009 58351 48603 -3839 -2807 -510 O ATOM 11051 CB GLU L 48 91.730 10.966 24.187 1.00383.48 C ANISOU11051 CB GLU L 48 41877 57464 46360 -4126 -2751 -753 C ATOM 11052 CG GLU L 48 92.473 11.425 22.916 1.00386.01 C ANISOU11052 CG GLU L 48 41965 58768 45932 -4818 -3006 -561 C ATOM 11053 CD GLU L 48 91.794 11.037 21.591 1.00388.38 C ANISOU11053 CD GLU L 48 41833 60117 45615 -5591 -3191 -561 C ATOM 11054 OE1 GLU L 48 91.464 9.841 21.382 1.00388.18 O ANISOU11054 OE1 GLU L 48 41731 60288 45470 -5752 -2881 -1303 O ATOM 11055 OE2 GLU L 48 91.608 11.938 20.734 1.00388.14 O ANISOU11055 OE2 GLU L 48 41497 60753 45223 -6075 -3662 199 O ATOM 11056 N ALA L 49 89.525 10.889 26.661 1.00364.90 N ANISOU11056 N ALA L 49 39771 53308 45565 -2826 -2556 -470 N ATOM 11057 CA ALA L 49 88.510 10.241 27.512 1.00353.09 C ANISOU11057 CA ALA L 49 38314 51276 44568 -2429 -2334 -641 C ATOM 11058 C ALA L 49 87.113 10.852 27.303 1.00353.90 C ANISOU11058 C ALA L 49 38135 51368 44961 -2480 -2673 -21 C ATOM 11059 O ALA L 49 86.139 10.112 27.157 1.00359.43 O ANISOU11059 O ALA L 49 38683 52142 45741 -2570 -2607 -158 O ATOM 11060 CB ALA L 49 88.910 10.282 28.983 1.00344.22 C ANISOU11060 CB ALA L 49 37518 49357 43910 -1758 -2044 -803 C ATOM 11061 N ALA L 50 87.036 12.192 27.267 1.00350.71 N ANISOU11061 N ALA L 50 37625 50851 44777 -2435 -3043 662 N ATOM 11062 CA ALA L 50 85.786 12.957 27.017 1.00354.61 C ANISOU11062 CA ALA L 50 37778 51293 45665 -2500 -3427 1359 C ATOM 11063 C ALA L 50 85.231 12.849 25.572 1.00363.69 C ANISOU11063 C ALA L 50 38532 53319 46331 -3228 -3786 1708 C ATOM 11064 O ALA L 50 84.027 12.589 25.383 1.00375.63 O ANISOU11064 O ALA L 50 39808 54880 48034 -3321 -3891 1890 O ATOM 11065 CB ALA L 50 85.955 14.423 27.428 1.00348.18 C ANISOU11065 CB ALA L 50 36902 50021 45369 -2234 -3709 1959 C ATOM 11066 N VAL L 51 86.101 13.049 24.570 1.00362.43 N ANISOU11066 N VAL L 51 38282 53898 45526 -3764 -3974 1804 N ATOM 11067 CA VAL L 51 85.739 12.915 23.135 1.00365.69 C ANISOU11067 CA VAL L 51 38294 55347 45302 -4563 -4304 2088 C ATOM 11068 C VAL L 51 85.247 11.492 22.764 1.00375.21 C ANISOU11068 C VAL L 51 39457 56962 46141 -4829 -4011 1366 C ATOM 11069 O VAL L 51 84.202 11.347 22.108 1.00378.13 O ANISOU11069 O VAL L 51 39488 57770 46413 -5208 -4252 1653 O ATOM 11070 CB VAL L 51 86.860 13.443 22.186 1.00360.84 C ANISOU11070 CB VAL L 51 37573 55513 44016 -5104 -4537 2320 C ATOM 11071 CG1 VAL L 51 86.637 13.013 20.745 1.00361.37 C ANISOU11071 CG1 VAL L 51 37250 56819 43234 -5989 -4750 2357 C ATOM 11072 CG2 VAL L 51 86.950 14.963 22.257 1.00358.51 C ANISOU11072 CG2 VAL L 51 37111 54931 44172 -5005 -5000 3298 C ATOM 11073 N ARG L 52 85.970 10.457 23.209 1.00381.93 N ANISOU11073 N ARG L 52 40613 57626 46876 -4625 -3507 455 N ATOM 11074 CA ARG L 52 85.522 9.058 23.010 1.00384.02 C ANISOU11074 CA ARG L 52 40816 58091 47000 -4792 -3185 -301 C ATOM 11075 C ARG L 52 84.231 8.658 23.800 1.00378.65 C ANISOU11075 C ARG L 52 40137 56747 46986 -4356 -3085 -253 C ATOM 11076 O ARG L 52 83.473 7.778 23.361 1.00382.45 O ANISOU11076 O ARG L 52 40411 57530 47372 -4634 -3014 -574 O ATOM 11077 CB ARG L 52 86.677 8.049 23.179 1.00380.76 C ANISOU11077 CB ARG L 52 40630 57654 46387 -4746 -2699 -1259 C ATOM 11078 CG ARG L 52 87.700 8.116 22.051 1.00376.34 C ANISOU11078 CG ARG L 52 39925 58037 45027 -5396 -2767 -1482 C ATOM 11079 CD ARG L 52 88.498 6.834 21.864 1.00366.93 C ANISOU11079 CD ARG L 52 38760 57025 43631 -5557 -2285 -2579 C ATOM 11080 NE ARG L 52 89.695 7.098 21.059 1.00362.90 N ANISOU11080 NE ARG L 52 38185 57250 42449 -6028 -2305 -2768 N ATOM 11081 CZ ARG L 52 90.644 6.209 20.762 1.00359.70 C ANISOU11081 CZ ARG L 52 37755 57098 41813 -6239 -1915 -3696 C ATOM 11082 NH1 ARG L 52 90.562 4.954 21.192 1.00356.11 N ANISOU11082 NH1 ARG L 52 37313 56179 41812 -6023 -1479 -4525 N ATOM 11083 NH2 ARG L 52 91.685 6.583 20.023 1.00359.12 N ANISOU11083 NH2 ARG L 52 37603 57740 41106 -6680 -1963 -3784 N ATOM 11084 N GLY L 53 83.969 9.318 24.934 1.00366.21 N ANISOU11084 N GLY L 53 38755 54317 46071 -3709 -3078 124 N ATOM 11085 CA GLY L 53 82.670 9.207 25.638 1.00344.38 C ANISOU11085 CA GLY L 53 35926 50992 43931 -3331 -3053 326 C ATOM 11086 C GLY L 53 81.485 9.730 24.825 1.00336.96 C ANISOU11086 C GLY L 53 34569 50455 43005 -3721 -3513 1006 C ATOM 11087 O GLY L 53 80.467 9.034 24.690 1.00325.86 O ANISOU11087 O GLY L 53 32991 49113 41708 -3817 -3474 889 O ATOM 11088 N VAL L 54 81.629 10.946 24.278 1.00338.80 N ANISOU11088 N VAL L 54 34606 50955 43164 -3962 -3966 1754 N ATOM 11089 CA VAL L 54 80.653 11.534 23.331 1.00344.47 C ANISOU11089 CA VAL L 54 34850 52189 43844 -4453 -4492 2542 C ATOM 11090 C VAL L 54 80.486 10.693 22.062 1.00352.07 C ANISOU11090 C VAL L 54 35550 54218 44001 -5231 -4574 2276 C ATOM 11091 O VAL L 54 79.368 10.516 21.609 1.00364.69 O ANISOU11091 O VAL L 54 36830 56087 45647 -5503 -4788 2560 O ATOM 11092 CB VAL L 54 80.954 13.020 22.965 1.00344.50 C ANISOU11092 CB VAL L 54 34631 52274 43989 -4598 -4994 3474 C ATOM 11093 CG1 VAL L 54 80.359 13.407 21.605 1.00350.60 C ANISOU11093 CG1 VAL L 54 34865 53983 44364 -5382 -5559 4241 C ATOM 11094 CG2 VAL L 54 80.438 13.952 24.052 1.00340.59 C ANISOU11094 CG2 VAL L 54 34146 50745 44518 -3927 -5045 3904 C ATOM 11095 N ARG L 55 81.575 10.175 21.495 1.00349.67 N ANISOU11095 N ARG L 55 35349 54535 42973 -5604 -4394 1695 N ATOM 11096 CA ARG L 55 81.473 9.316 20.298 1.00350.11 C ANISOU11096 CA ARG L 55 35123 55668 42235 -6379 -4407 1264 C ATOM 11097 C ARG L 55 80.764 7.975 20.585 1.00347.57 C ANISOU11097 C ARG L 55 34829 55119 42112 -6254 -4025 485 C ATOM 11098 O ARG L 55 80.172 7.371 19.677 1.00354.16 O ANISOU11098 O ARG L 55 35330 56722 42509 -6851 -4119 284 O ATOM 11099 CB ARG L 55 82.841 9.044 19.662 1.00346.31 C ANISOU11099 CB ARG L 55 34709 55889 40982 -6799 -4242 703 C ATOM 11100 CG ARG L 55 83.653 10.259 19.241 1.00339.59 C ANISOU11100 CG ARG L 55 33795 55407 39827 -7025 -4608 1420 C ATOM 11101 CD ARG L 55 84.822 9.806 18.385 1.00333.51 C ANISOU11101 CD ARG L 55 32985 55577 38155 -7608 -4440 788 C ATOM 11102 NE ARG L 55 86.090 10.404 18.781 1.00319.96 N ANISOU11102 NE ARG L 55 31556 53555 36458 -7330 -4359 829 N ATOM 11103 CZ ARG L 55 87.222 9.723 18.934 1.00311.57 C ANISOU11103 CZ ARG L 55 30746 52480 35156 -7258 -3909 -65 C ATOM 11104 NH1 ARG L 55 87.260 8.415 18.711 1.00308.97 N ANISOU11104 NH1 ARG L 55 30385 52402 34607 -7448 -3492 -1099 N ATOM 11105 NH2 ARG L 55 88.319 10.363 19.293 1.00305.04 N ANISOU11105 NH2 ARG L 55 30160 51372 34368 -7009 -3887 77 N ATOM 11106 N GLN L 56 80.828 7.506 21.831 1.00335.99 N ANISOU11106 N GLN L 56 33721 52644 41296 -5516 -3608 64 N ATOM 11107 CA GLN L 56 80.076 6.316 22.199 1.00329.34 C ANISOU11107 CA GLN L 56 32868 51483 40783 -5349 -3287 -522 C ATOM 11108 C GLN L 56 78.605 6.624 22.448 1.00340.01 C ANISOU11108 C GLN L 56 34024 52521 42642 -5183 -3534 105 C ATOM 11109 O GLN L 56 77.749 5.873 21.978 1.00342.19 O ANISOU11109 O GLN L 56 34047 53116 42851 -5493 -3540 -116 O ATOM 11110 CB GLN L 56 80.686 5.564 23.373 1.00312.38 C ANISOU11110 CB GLN L 56 31098 48485 39105 -4712 -2756 -1182 C ATOM 11111 CG GLN L 56 80.099 4.160 23.530 1.00301.26 C ANISOU11111 CG GLN L 56 29595 46898 37971 -4690 -2418 -1878 C ATOM 11112 CD GLN L 56 80.321 3.240 22.322 1.00299.34 C ANISOU11112 CD GLN L 56 29052 47532 37148 -5421 -2341 -2617 C ATOM 11113 OE1 GLN L 56 81.307 3.354 21.596 1.00298.98 O ANISOU11113 OE1 GLN L 56 28973 48121 36504 -5842 -2347 -2904 O ATOM 11114 NE2 GLN L 56 79.395 2.302 22.119 1.00295.36 N ANISOU11114 NE2 GLN L 56 28303 47077 36841 -5583 -2246 -2980 N ATOM 11115 N ALA L 57 78.314 7.719 23.161 1.00354.33 N ANISOU11115 N ALA L 57 35918 53718 44991 -4716 -3730 842 N ATOM 11116 CA ALA L 57 76.924 8.214 23.323 1.00381.68 C ANISOU11116 CA ALA L 57 39125 56901 48993 -4588 -4018 1533 C ATOM 11117 C ALA L 57 76.224 8.544 21.982 1.00413.59 C ANISOU11117 C ALA L 57 42675 61867 52601 -5352 -4544 2120 C ATOM 11118 O ALA L 57 75.049 8.199 21.801 1.00420.00 O ANISOU11118 O ALA L 57 43230 62734 53616 -5472 -4656 2275 O ATOM 11119 CB ALA L 57 76.851 9.386 24.309 1.00375.89 C ANISOU11119 CB ALA L 57 38509 55341 48969 -3972 -4108 2122 C ATOM 11120 N GLN L 58 76.957 9.184 21.054 1.00441.83 N ANISOU11120 N GLN L 58 46103 66208 55563 -5890 -4867 2463 N ATOM 11121 CA GLN L 58 76.554 9.374 19.620 1.00468.90 C ANISOU11121 CA GLN L 58 49035 70805 58319 -6788 -5357 2950 C ATOM 11122 C GLN L 58 76.165 8.040 18.892 1.00492.44 C ANISOU11122 C GLN L 58 51846 74528 60727 -7326 -5171 2169 C ATOM 11123 O GLN L 58 75.136 7.990 18.185 1.00505.75 O ANISOU11123 O GLN L 58 53122 76768 62272 -7802 -5506 2567 O ATOM 11124 CB GLN L 58 77.653 10.137 18.792 1.00460.99 C ANISOU11124 CB GLN L 58 47932 70590 56632 -7302 -5645 3311 C ATOM 11125 CG GLN L 58 77.775 11.669 18.971 1.00447.38 C ANISOU11125 CG GLN L 58 46090 68505 55387 -7115 -6094 4420 C ATOM 11126 CD GLN L 58 79.006 12.292 18.298 1.00438.53 C ANISOU11126 CD GLN L 58 44931 68067 53623 -7546 -6291 4661 C ATOM 11127 OE1 GLN L 58 79.925 11.592 17.862 1.00432.02 O ANISOU11127 OE1 GLN L 58 44255 67878 52015 -7876 -6008 3892 O ATOM 11128 NE2 GLN L 58 79.024 13.618 18.227 1.00434.49 N ANISOU11128 NE2 GLN L 58 44181 67390 53514 -7538 -6772 5730 N ATOM 11129 N ALA L 59 76.985 6.987 19.082 1.00506.00 N ANISOU11129 N ALA L 59 53842 76222 62192 -7250 -4647 1068 N ATOM 11130 CA ALA L 59 76.870 5.663 18.400 1.00519.30 C ANISOU11130 CA ALA L 59 55351 78569 63387 -7762 -4391 113 C ATOM 11131 C ALA L 59 75.551 4.916 18.667 1.00521.75 C ANISOU11131 C ALA L 59 55520 78529 64192 -7620 -4317 -25 C ATOM 11132 O ALA L 59 74.914 4.409 17.741 1.00537.47 O ANISOU11132 O ALA L 59 57129 81339 65745 -8269 -4469 -195 O ATOM 11133 CB ALA L 59 78.079 4.773 18.724 1.00514.27 C ANISOU11133 CB ALA L 59 55021 77731 62645 -7583 -3827 -996 C ATOM 11134 N GLU L 60 75.141 4.870 19.931 1.00505.37 N ATOM 11135 CA GLU L 60 73.895 4.207 20.335 1.00486.63 C ATOM 11136 C GLU L 60 72.690 5.187 20.416 1.00470.87 C ATOM 11137 O GLU L 60 71.638 4.853 20.979 1.00465.43 O ATOM 11138 CB GLU L 60 74.122 3.415 21.649 1.00479.83 C ATOM 11139 CG GLU L 60 74.938 4.152 22.725 1.00465.31 C ATOM 11140 CD GLU L 60 75.703 3.236 23.686 1.00454.20 C ATOM 11141 OE1 GLU L 60 75.179 2.982 24.794 1.00450.66 O ATOM 11142 OE2 GLU L 60 76.828 2.787 23.350 1.00445.86 O