>>4NE1:HELIX   62  62 SER U   31  GLU U   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 62 62 SER U 31 GLU U 60 1 30 ATOM 15881 N SER U 31 112.636 -18.976 26.905 1.00311.09 N ANISOU15881 N SER U 31 40900 40316 36982 903 3116 -172 N ATOM 15882 CA SER U 31 113.351 -20.121 27.537 1.00337.34 C ANISOU15882 CA SER U 31 44222 43759 40193 880 3140 27 C ATOM 15883 C SER U 31 112.352 -21.148 28.116 1.00362.49 C ANISOU15883 C SER U 31 47486 46966 43275 841 3213 -85 C ATOM 15884 O SER U 31 111.214 -20.782 28.403 1.00376.18 O ANISOU15884 O SER U 31 49246 48688 44994 780 3240 -324 O ATOM 15885 CB SER U 31 114.429 -19.667 28.554 1.00329.08 C ANISOU15885 CB SER U 31 43109 42834 39089 721 3036 160 C ATOM 15886 OG SER U 31 113.899 -19.249 29.804 1.00322.51 O ANISOU15886 OG SER U 31 42309 42065 38163 541 2996 -33 O ATOM 15887 N GLY U 32 112.749 -22.422 28.235 1.00384.16 N ANISOU15887 N GLY U 32 50264 49745 45955 883 3233 92 N ATOM 15888 CA GLY U 32 111.838 -23.493 28.701 1.00402.03 C ANISOU15888 CA GLY U 32 52606 52016 48130 828 3268 36 C ATOM 15889 C GLY U 32 111.201 -23.212 30.056 1.00412.45 C ANISOU15889 C GLY U 32 53903 53483 49326 604 3265 -108 C ATOM 15890 O GLY U 32 109.979 -23.344 30.248 1.00418.89 O ANISOU15890 O GLY U 32 54740 54320 50100 548 3311 -275 O ATOM 15891 N ASP U 33 112.038 -22.806 31.002 1.00413.14 N ANISOU15891 N ASP U 33 53937 53693 49343 477 3207 -39 N ATOM 15892 CA ASP U 33 111.545 -22.402 32.310 1.00406.42 C ANISOU15892 CA ASP U 33 53064 53007 48350 281 3197 -190 C ATOM 15893 C ASP U 33 110.736 -21.110 32.301 1.00400.39 C ANISOU15893 C ASP U 33 52283 52233 47613 281 3205 -485 C ATOM 15894 O ASP U 33 109.754 -21.034 33.023 1.00388.30 O ANISOU15894 O ASP U 33 50742 50828 45964 195 3248 -672 O ATOM 15895 CB ASP U 33 112.663 -22.362 33.343 1.00408.13 C ANISOU15895 CB ASP U 33 53247 53350 48473 144 3115 -35 C ATOM 15896 CG ASP U 33 113.062 -23.746 33.803 1.00405.10 C ANISOU15896 CG ASP U 33 52884 53029 48006 90 3104 195 C ATOM 15897 OD1 ASP U 33 112.449 -24.732 33.335 1.00393.97 O ANISOU15897 OD1 ASP U 33 51528 51552 46610 155 3144 228 O ATOM 15898 OD2 ASP U 33 114.002 -23.862 34.611 1.00409.85 O ANISOU15898 OD2 ASP U 33 53456 53731 48536 -18 3034 352 O ATOM 15899 N ALA U 34 111.129 -20.110 31.500 1.00397.33 N ANISOU15899 N ALA U 34 51885 51709 47372 378 3156 -519 N ATOM 15900 CA ALA U 34 110.323 -18.886 31.344 1.00391.00 C ANISOU15900 CA ALA U 34 51085 50849 46626 406 3137 -805 C ATOM 15901 C ALA U 34 108.949 -19.222 30.754 1.00386.88 C ANISOU15901 C ALA U 34 50578 50284 46131 493 3243 -968 C ATOM 15902 O ALA U 34 107.943 -18.699 31.217 1.00385.23 O ANISOU15902 O ALA U 34 50356 50149 45864 470 3268 -1223 O ATOM 15903 CB ALA U 34 111.046 -17.822 30.525 1.00389.78 C ANISOU15903 CB ALA U 34 50919 50539 46637 473 3033 -763 C ATOM 15904 N LEU U 35 108.912 -20.136 29.780 1.00379.77 N ANISOU15904 N LEU U 35 49706 49280 45306 598 3299 -819 N ATOM 15905 CA LEU U 35 107.651 -20.616 29.191 1.00363.21 C ANISOU15905 CA LEU U 35 47633 47132 43237 663 3380 -929 C ATOM 15906 C LEU U 35 106.762 -21.245 30.257 1.00344.22 C ANISOU15906 C LEU U 35 45204 44923 40659 523 3432 -999 C ATOM 15907 O LEU U 35 105.560 -20.985 30.297 1.00342.34 O ANISOU15907 O LEU U 35 44933 44739 40400 522 3485 -1197 O ATOM 15908 CB LEU U 35 107.892 -21.599 28.024 1.00367.33 C ANISOU15908 CB LEU U 35 48219 47501 43848 800 3400 -739 C ATOM 15909 CG LEU U 35 106.769 -21.791 26.994 1.00365.88 C ANISOU15909 CG LEU U 35 48078 47185 43755 907 3447 -845 C ATOM 15910 CD1 LEU U 35 106.316 -20.442 26.455 1.00361.72 C ANISOU15910 CD1 LEU U 35 47514 46577 43345 969 3439 -1053 C ATOM 15911 CD2 LEU U 35 107.194 -22.721 25.862 1.00364.89 C ANISOU15911 CD2 LEU U 35 48038 46904 43698 1064 3441 -660 C ATOM 15912 N GLN U 36 107.356 -22.055 31.133 1.00326.23 N ANISOU15912 N GLN U 36 42927 42772 38251 401 3412 -823 N ATOM 15913 CA AGLN U 36 106.605 -22.687 32.214 0.50318.55 C ANISOU15913 CA AGLN U 36 41917 42023 37095 237 3449 -844 C ATOM 15914 CA BGLN U 36 106.595 -22.685 32.209 0.50317.75 C ANISOU15914 CA BGLN U 36 41815 41921 36994 238 3449 -845 C ATOM 15915 C GLN U 36 106.087 -21.673 33.227 1.00316.34 C ANISOU15915 C GLN U 36 41561 41951 36682 161 3471 -1095 C ATOM 15916 O GLN U 36 104.975 -21.811 33.718 1.00319.19 O ANISOU15916 O GLN U 36 41858 42496 36923 98 3537 -1217 O ATOM 15917 CB AGLN U 36 107.426 -23.776 32.900 0.50315.22 C ANISOU15917 CB AGLN U 36 41519 41675 36572 118 3399 -580 C ATOM 15918 CB BGLN U 36 107.384 -23.801 32.892 0.50313.24 C ANISOU15918 CB BGLN U 36 41268 41425 36321 117 3401 -581 C ATOM 15919 CG AGLN U 36 107.247 -25.153 32.284 0.50313.38 C ANISOU15919 CG AGLN U 36 41363 41322 36385 148 3377 -383 C ATOM 15920 CG BGLN U 36 107.093 -25.187 32.338 0.50310.30 C ANISOU15920 CG BGLN U 36 40967 40947 35982 134 3382 -395 C ATOM 15921 CD AGLN U 36 105.821 -25.672 32.395 0.50312.56 C ANISOU15921 CD AGLN U 36 41236 41305 36216 58 3415 -448 C ATOM 15922 CD BGLN U 36 105.632 -25.591 32.463 0.50308.54 C ANISOU15922 CD BGLN U 36 40713 40825 35693 45 3427 -480 C ATOM 15923 OE1AGLN U 36 105.247 -26.147 31.413 0.50313.23 O ANISOU15923 OE1AGLN U 36 41383 41220 36407 151 3410 -431 O ATOM 15924 OE1BGLN U 36 105.026 -26.055 31.495 0.50307.82 O ANISOU15924 OE1BGLN U 36 40680 40568 35708 134 3423 -466 O ATOM 15925 NE2AGLN U 36 105.242 -25.577 33.587 0.50311.54 N ANISOU15925 NE2AGLN U 36 41010 41459 35899 -124 3449 -514 N ATOM 15926 NE2BGLN U 36 105.058 -25.413 33.653 0.50307.52 N ANISOU15926 NE2BGLN U 36 40482 40982 35376 -128 3465 -560 N ATOM 15927 N LEU U 37 106.898 -20.655 33.525 1.00312.97 N ANISOU15927 N LEU U 37 41140 41502 36272 173 3402 -1166 N ATOM 15928 CA LEU U 37 106.465 -19.544 34.377 1.00316.52 C ANISOU15928 CA LEU U 37 41552 42099 36609 149 3389 -1446 C ATOM 15929 C LEU U 37 105.256 -18.861 33.769 1.00327.91 C ANISOU15929 C LEU U 37 42967 43494 38128 281 3441 -1712 C ATOM 15930 O LEU U 37 104.331 -18.489 34.480 1.00335.73 O ANISOU15930 O LEU U 37 43895 44692 38973 272 3490 -1940 O ATOM 15931 CB LEU U 37 107.556 -18.483 34.547 1.00306.16 C ANISOU15931 CB LEU U 37 40283 40687 35354 156 3257 -1471 C ATOM 15932 CG LEU U 37 108.895 -18.798 35.205 1.00301.99 C ANISOU15932 CG LEU U 37 39773 40203 34765 31 3173 -1234 C ATOM 15933 CD1 LEU U 37 109.733 -17.537 35.252 1.00299.68 C ANISOU15933 CD1 LEU U 37 39518 39795 34551 40 3019 -1296 C ATOM 15934 CD2 LEU U 37 108.732 -19.372 36.602 1.00305.38 C ANISOU15934 CD2 LEU U 37 40171 40919 34938 -135 3203 -1223 C ATOM 15935 N MET U 38 105.267 -18.682 32.453 1.00341.51 N ANISOU15935 N MET U 38 44729 44960 40070 413 3429 -1685 N ATOM 15936 CA MET U 38 104.175 -17.964 31.810 1.00358.51 C ANISOU15936 CA MET U 38 46859 47039 42318 541 3459 -1930 C ATOM 15937 C MET U 38 102.885 -18.780 31.713 1.00360.15 C ANISOU15937 C MET U 38 47003 47373 42462 529 3577 -1953 C ATOM 15938 O MET U 38 101.800 -18.209 31.791 1.00368.70 O ANISOU15938 O MET U 38 48020 48548 43520 594 3621 -2195 O ATOM 15939 CB MET U 38 104.604 -17.361 30.473 1.00371.60 C ANISOU15939 CB MET U 38 48573 48394 44221 673 3389 -1900 C ATOM 15940 CG MET U 38 105.675 -16.286 30.614 1.00384.60 C ANISOU15940 CG MET U 38 50259 49936 45932 669 3243 -1912 C ATOM 15941 SD MET U 38 105.191 -14.873 31.629 1.00386.88 S ANISOU15941 SD MET U 38 50551 50313 46131 681 3147 -2283 S ATOM 15942 CE MET U 38 104.013 -14.043 30.560 1.00392.33 C ANISOU15942 CE MET U 38 51235 50826 47003 861 3144 -2536 C ATOM 15943 N VAL U 39 103.019 -20.102 31.573 1.00353.54 N ANISOU15943 N VAL U 39 46184 46544 41599 447 3608 -1694 N ATOM 15944 CA VAL U 39 101.915 -21.064 31.751 1.00346.43 C ANISOU15944 CA VAL U 39 45223 45805 40600 363 3684 -1645 C ATOM 15945 C VAL U 39 101.185 -20.812 33.100 1.00350.58 C ANISOU15945 C VAL U 39 45620 46702 40881 260 3746 -1804 C ATOM 15946 O VAL U 39 99.952 -20.634 33.143 1.00356.44 O ANISOU15946 O VAL U 39 46258 47601 41569 286 3819 -1959 O ATOM 15947 CB VAL U 39 102.446 -22.522 31.613 1.00336.05 C ANISOU15947 CB VAL U 39 43979 44425 39278 267 3649 -1319 C ATOM 15948 CG1 VAL U 39 101.473 -23.548 32.185 1.00328.57 C ANISOU15948 CG1 VAL U 39 42964 43696 38182 104 3681 -1220 C ATOM 15949 CG2 VAL U 39 102.766 -22.835 30.155 1.00330.17 C ANISOU15949 CG2 VAL U 39 43346 43355 38748 414 3610 -1211 C ATOM 15950 N GLU U 40 101.971 -20.755 34.181 1.00345.62 N ANISOU15950 N GLU U 40 44992 46228 40097 157 3715 -1765 N ATOM 15951 CA GLU U 40 101.480 -20.479 35.545 1.00338.13 C ANISOU15951 CA GLU U 40 43934 45657 38881 68 3765 -1914 C ATOM 15952 C GLU U 40 100.881 -19.075 35.665 1.00343.82 C ANISOU15952 C GLU U 40 44613 46434 39589 234 3780 -2290 C ATOM 15953 O GLU U 40 99.836 -18.890 36.296 1.00344.17 O ANISOU15953 O GLU U 40 44528 46787 39452 246 3866 -2467 O ATOM 15954 CB GLU U 40 102.624 -20.597 36.572 1.00327.40 C ANISOU15954 CB GLU U 40 42617 44396 37383 -61 3701 -1798 C ATOM 15955 CG GLU U 40 103.458 -21.867 36.514 1.00313.54 C ANISOU15955 CG GLU U 40 40922 42553 35654 -200 3653 -1436 C ATOM 15956 CD GLU U 40 102.864 -22.969 37.373 1.00304.06 C ANISOU15956 CD GLU U 40 39632 41656 34238 -403 3694 -1272 C ATOM 15957 OE1 GLU U 40 103.257 -24.134 37.200 1.00299.06 O ANISOU15957 OE1 GLU U 40 39052 40932 33644 -509 3640 -979 O ATOM 15958 OE2 GLU U 40 101.983 -22.649 38.198 1.00297.82 O ANISOU15958 OE2 GLU U 40 38716 41203 33237 -449 3772 -1437 O ATOM 15959 N LEU U 41 101.573 -18.097 35.071 1.00345.67 N ANISOU15959 N LEU U 41 44952 46378 40007 363 3681 -2398 N ATOM 15960 CA LEU U 41 101.200 -16.675 35.140 1.00342.69 C ANISOU15960 CA LEU U 41 44579 45974 39652 530 3633 -2753 C ATOM 15961 C LEU U 41 99.901 -16.370 34.414 1.00346.53 C ANISOU15961 C LEU U 41 44989 46446 40229 677 3704 -2938 C ATOM 15962 O LEU U 41 99.066 -15.628 34.941 1.00347.10 O ANISOU15962 O LEU U 41 44985 46713 40181 788 3733 -3238 O ATOM 15963 CB LEU U 41 102.335 -15.774 34.633 1.00330.70 C ANISOU15963 CB LEU U 41 43197 44124 38328 591 3469 -2761 C ATOM 15964 CG LEU U 41 102.225 -14.259 34.391 1.00323.40 C ANISOU15964 CG LEU U 41 42334 43024 37519 757 3339 -3070 C ATOM 15965 CD1 LEU U 41 101.420 -13.464 35.411 1.00325.80 C ANISOU15965 CD1 LEU U 41 42595 43575 37618 855 3341 -3437 C ATOM 15966 CD2 LEU U 41 103.637 -13.716 34.321 1.00319.93 C ANISOU15966 CD2 LEU U 41 42014 42355 37190 704 3158 -2950 C ATOM 15967 N LEU U 42 99.717 -16.940 33.224 1.00351.77 N ANISOU15967 N LEU U 42 45673 46892 41091 691 3726 -2769 N ATOM 15968 CA LEU U 42 98.459 -16.712 32.524 1.00356.58 C ANISOU15968 CA LEU U 42 46204 47490 41788 813 3788 -2921 C ATOM 15969 C LEU U 42 97.282 -17.376 33.228 1.00366.95 C ANISOU15969 C LEU U 42 47346 49197 42882 740 3922 -2931 C ATOM 15970 O LEU U 42 96.199 -16.793 33.220 1.00375.41 O ANISOU15970 O LEU U 42 48308 50405 43926 867 3975 -3169 O ATOM 15971 CB LEU U 42 98.514 -17.051 31.037 1.00349.92 C ANISOU15971 CB LEU U 42 45435 46309 41207 859 3762 -2763 C ATOM 15972 CG LEU U 42 98.987 -15.850 30.223 1.00340.31 C ANISOU15972 CG LEU U 42 44314 44775 40211 1008 3643 -2903 C ATOM 15973 CD1 LEU U 42 99.068 -16.229 28.759 1.00338.62 C ANISOU15973 CD1 LEU U 42 44167 44266 40226 1052 3627 -2732 C ATOM 15974 CD2 LEU U 42 98.059 -14.664 30.428 1.00333.06 C ANISOU15974 CD2 LEU U 42 43335 43922 39290 1165 3625 -3266 C ATOM 15975 N LYS U 43 97.498 -18.552 33.849 1.00366.65 N ANISOU15975 N LYS U 43 47273 49350 42684 537 3965 -2668 N ATOM 15976 CA LYS U 43 96.484 -19.185 34.738 1.00358.47 C ANISOU15976 CA LYS U 43 46053 48758 41392 420 4077 -2637 C ATOM 15977 C LYS U 43 96.023 -18.246 35.871 1.00365.06 C ANISOU15977 C LYS U 43 46768 49953 41982 515 4132 -2956 C ATOM 15978 O LYS U 43 94.824 -18.018 36.048 1.00373.36 O ANISOU15978 O LYS U 43 47648 51284 42925 595 4228 -3116 O ATOM 15979 CB LYS U 43 96.954 -20.520 35.346 1.00337.89 C ANISOU15979 CB LYS U 43 43447 46289 38646 165 4072 -2293 C ATOM 15980 CG LYS U 43 95.892 -21.157 36.235 1.00317.53 C ANISOU15980 CG LYS U 43 40659 44188 35800 16 4171 -2224 C ATOM 15981 CD LYS U 43 96.458 -21.653 37.557 1.00301.46 C ANISOU15981 CD LYS U 43 38590 42452 33496 -176 4170 -2088 C ATOM 15982 CE LYS U 43 95.360 -21.800 38.602 1.00293.35 C ANISOU15982 CE LYS U 43 37316 41992 32149 -265 4288 -2128 C ATOM 15983 NZ LYS U 43 94.414 -22.897 38.263 1.00288.10 N ANISOU15983 NZ LYS U 43 36529 41450 31486 -436 4306 -1854 N ATOM 15984 N VAL U 44 96.981 -17.705 36.625 1.00362.43 N ANISOU15984 N VAL U 44 46526 49621 41556 518 4064 -3047 N ATOM 15985 CA VAL U 44 96.682 -16.820 37.774 1.00361.55 C ANISOU15985 CA VAL U 44 46343 49841 41188 622 4090 -3364 C ATOM 15986 C VAL U 44 95.990 -15.512 37.319 1.00359.97 C ANISOU15986 C VAL U 44 46137 49541 41093 910 4065 -3753 C ATOM 15987 O VAL U 44 95.060 -15.030 37.966 1.00359.25 O ANISOU15987 O VAL U 44 45902 49799 40795 1044 4145 -4017 O ATOM 15988 CB VAL U 44 97.946 -16.539 38.642 1.00362.59 C ANISOU15988 CB VAL U 44 46607 49949 41212 548 3986 -3361 C ATOM 15989 CG1 VAL U 44 97.601 -15.681 39.854 1.00367.40 C ANISOU15989 CG1 VAL U 44 47159 50910 41526 665 4000 -3701 C ATOM 15990 CG2 VAL U 44 98.591 -17.837 39.112 1.00362.62 C ANISOU15990 CG2 VAL U 44 46607 50057 41112 272 4002 -2978 C ATOM 15991 N PHE U 45 96.434 -14.965 36.191 1.00356.88 N ANISOU15991 N PHE U 45 45892 48685 41018 1008 3949 -3777 N ATOM 15992 CA PHE U 45 95.799 -13.806 35.579 1.00359.07 C ANISOU15992 CA PHE U 45 46181 48799 41449 1262 3895 -4099 C ATOM 15993 C PHE U 45 94.323 -14.063 35.247 1.00361.84 C ANISOU15993 C PHE U 45 46332 49376 41773 1343 4038 -4161 C ATOM 15994 O PHE U 45 93.470 -13.258 35.604 1.00360.21 O ANISOU15994 O PHE U 45 46027 49371 41465 1550 4066 -4488 O ATOM 15995 CB PHE U 45 96.565 -13.392 34.321 1.00357.43 C ANISOU15995 CB PHE U 45 46150 48064 41592 1296 3748 -4018 C ATOM 15996 CG PHE U 45 95.785 -12.487 33.428 1.00362.80 C ANISOU15996 CG PHE U 45 46825 48546 42474 1513 3699 -4257 C ATOM 15997 CD1 PHE U 45 95.640 -11.148 33.740 1.00370.24 C ANISOU15997 CD1 PHE U 45 47821 49434 43417 1723 3574 -4628 C ATOM 15998 CD2 PHE U 45 95.162 -12.982 32.297 1.00362.01 C ANISOU15998 CD2 PHE U 45 46675 48312 42560 1512 3761 -4117 C ATOM 15999 CE1 PHE U 45 94.895 -10.311 32.929 1.00379.20 C ANISOU15999 CE1 PHE U 45 48952 50379 44746 1929 3511 -4849 C ATOM 16000 CE2 PHE U 45 94.419 -12.157 31.475 1.00369.45 C ANISOU16000 CE2 PHE U 45 47607 49077 43691 1705 3711 -4328 C ATOM 16001 CZ PHE U 45 94.283 -10.815 31.791 1.00379.06 C ANISOU16001 CZ PHE U 45 48868 50238 44917 1914 3586 -4692 C ATOM 16002 N VAL U 46 94.035 -15.165 34.550 1.00366.13 N ANISOU16002 N VAL U 46 46823 49877 42413 1190 4110 -3851 N ATOM 16003 CA VAL U 46 92.660 -15.503 34.144 1.00369.95 C ANISOU16003 CA VAL U 46 47117 50550 42894 1228 4223 -3850 C ATOM 16004 C VAL U 46 91.820 -15.864 35.369 1.00372.48 C ANISOU16004 C VAL U 46 47201 51467 42857 1178 4369 -3887 C ATOM 16005 O VAL U 46 90.676 -15.432 35.462 1.00379.88 O ANISOU16005 O VAL U 46 47955 52669 43712 1336 4452 -4092 O ATOM 16006 CB VAL U 46 92.592 -16.650 33.092 1.00367.71 C ANISOU16006 CB VAL U 46 46864 50049 42799 1060 4228 -3491 C ATOM 16007 CG1 VAL U 46 91.182 -17.230 32.992 1.00366.30 C ANISOU16007 CG1 VAL U 46 46462 50170 42544 1019 4341 -3421 C ATOM 16008 CG2 VAL U 46 93.066 -16.187 31.717 1.00362.59 C ANISOU16008 CG2 VAL U 46 46397 48878 42493 1164 4113 -3498 C ATOM 16009 N VAL U 47 92.389 -16.648 36.293 1.00364.74 N ANISOU16009 N VAL U 47 46210 50712 41659 963 4397 -3678 N ATOM 16010 CA VAL U 47 91.727 -17.009 37.558 1.00356.75 C ANISOU16010 CA VAL U 47 44971 50306 40270 887 4529 -3680 C ATOM 16011 C VAL U 47 91.394 -15.750 38.355 1.00365.60 C ANISOU16011 C VAL U 47 46032 51684 41195 1162 4554 -4126 C ATOM 16012 O VAL U 47 90.288 -15.614 38.872 1.00361.41 O ANISOU16012 O VAL U 47 45260 51621 40437 1265 4682 -4268 O ATOM 16013 CB VAL U 47 92.564 -18.027 38.378 1.00346.72 C ANISOU16013 CB VAL U 47 43737 49173 38824 596 4519 -3366 C ATOM 16014 CG1 VAL U 47 92.144 -18.074 39.842 1.00345.09 C ANISOU16014 CG1 VAL U 47 43333 49586 38197 551 4630 -3439 C ATOM 16015 CG2 VAL U 47 92.446 -19.404 37.754 1.00338.63 C ANISOU16015 CG2 VAL U 47 42701 48043 37920 340 4510 -2940 C ATOM 16016 N GLU U 48 92.338 -14.815 38.410 1.00380.25 N ANISOU16016 N GLU U 48 48108 53228 43141 1292 4415 -4345 N ATOM 16017 CA GLU U 48 92.089 -13.512 39.012 1.00401.12 C ANISOU16017 CA GLU U 48 50758 55999 45649 1589 4379 -4804 C ATOM 16018 C GLU U 48 90.905 -12.754 38.383 1.00407.54 C ANISOU16018 C GLU U 48 51455 56822 46568 1875 4411 -5087 C ATOM 16019 O GLU U 48 90.012 -12.289 39.103 1.00411.72 O ANISOU16019 O GLU U 48 51804 57792 46839 2079 4505 -5366 O ATOM 16020 CB GLU U 48 93.369 -12.672 39.008 1.00411.33 C ANISOU16020 CB GLU U 48 52339 56865 47082 1643 4170 -4938 C ATOM 16021 CG GLU U 48 94.255 -12.984 40.203 1.00426.44 C ANISOU16021 CG GLU U 48 54311 58984 48732 1477 4151 -4853 C ATOM 16022 CD GLU U 48 93.526 -12.757 41.522 1.00439.20 C ANISOU16022 CD GLU U 48 55753 61202 49920 1595 4268 -5103 C ATOM 16023 OE1 GLU U 48 93.160 -11.588 41.790 1.00449.47 O ANISOU16023 OE1 GLU U 48 57088 62537 51153 1902 4204 -5534 O ATOM 16024 OE2 GLU U 48 93.305 -13.735 42.283 1.00441.53 O ANISOU16024 OE2 GLU U 48 55877 61941 49941 1390 4412 -4873 O ATOM 16025 N ALA U 49 90.900 -12.641 37.050 1.00410.71 N ANISOU16025 N ALA U 49 51951 56762 47337 1899 4332 -5014 N ATOM 16026 CA ALA U 49 89.797 -11.982 36.317 1.00416.26 C ANISOU16026 CA ALA U 49 52550 57422 48185 2148 4346 -5243 C ATOM 16027 C ALA U 49 88.419 -12.622 36.606 1.00419.97 C ANISOU16027 C ALA U 49 52688 58438 48443 2137 4554 -5172 C ATOM 16028 O ALA U 49 87.470 -11.904 36.940 1.00430.50 O ANISOU16028 O ALA U 49 53857 60070 49641 2410 4614 -5492 O ATOM 16029 CB ALA U 49 90.081 -11.922 34.810 1.00409.51 C ANISOU16029 CB ALA U 49 51852 55992 47749 2121 4230 -5107 C ATOM 16030 N ALA U 50 88.331 -13.957 36.497 1.00409.86 N ANISOU16030 N ALA U 50 51309 57290 47130 1828 4647 -4750 N ATOM 16031 CA ALA U 50 87.092 -14.700 36.772 1.00397.30 C ANISOU16031 CA ALA U 50 49395 56221 45340 1746 4819 -4595 C ATOM 16032 C ALA U 50 86.706 -14.592 38.250 1.00390.57 C ANISOU16032 C ALA U 50 48328 56030 44038 1806 4951 -4745 C ATOM 16033 O ALA U 50 85.565 -14.262 38.551 1.00395.00 O ANISOU16033 O ALA U 50 48624 57033 44423 1993 5071 -4923 O ATOM 16034 CB ALA U 50 87.203 -16.161 36.330 1.00392.01 C ANISOU16034 CB ALA U 50 48715 55481 44750 1378 4829 -4093 C ATOM 16035 N VAL U 51 87.662 -14.833 39.154 1.00375.70 N ANISOU16035 N VAL U 51 46556 54225 41966 1664 4926 -4680 N ATOM 16036 CA VAL U 51 87.441 -14.709 40.603 1.00369.59 C ANISOU16036 CA VAL U 51 45611 54071 40743 1717 5038 -4827 C ATOM 16037 C VAL U 51 86.952 -13.309 40.975 1.00372.31 C ANISOU16037 C VAL U 51 45925 54566 40967 2154 5038 -5370 C ATOM 16038 O VAL U 51 85.945 -13.178 41.676 1.00377.56 O ANISOU16038 O VAL U 51 46301 55839 41313 2308 5193 -5519 O ATOM 16039 CB VAL U 51 88.700 -15.094 41.422 1.00362.80 C ANISOU16039 CB VAL U 51 44930 53171 39745 1500 4972 -4685 C ATOM 16040 CG1 VAL U 51 88.563 -14.683 42.875 1.00364.77 C ANISOU16040 CG1 VAL U 51 45058 53996 39540 1621 5056 -4931 C ATOM 16041 CG2 VAL U 51 88.961 -16.591 41.340 1.00359.32 C ANISOU16041 CG2 VAL U 51 44449 52756 39320 1081 4993 -4151 C ATOM 16042 N ARG U 52 87.652 -12.281 40.492 1.00369.64 N ANISOU16042 N ARG U 52 45879 53685 40882 2355 4852 -5653 N ATOM 16043 CA ARG U 52 87.280 -10.883 40.753 1.00372.31 C ANISOU16043 CA ARG U 52 46251 54052 41157 2786 4788 -6189 C ATOM 16044 C ARG U 52 85.869 -10.559 40.245 1.00375.20 C ANISOU16044 C ARG U 52 46362 54636 41559 3038 4891 -6351 C ATOM 16045 O ARG U 52 85.050 -9.993 40.976 1.00382.49 O ANISOU16045 O ARG U 52 47092 56048 42188 3337 4986 -6677 O ATOM 16046 CB ARG U 52 88.293 -9.912 40.138 1.00367.84 C ANISOU16046 CB ARG U 52 46054 52785 40921 2900 4523 -6388 C ATOM 16047 CG ARG U 52 89.535 -9.672 40.979 1.00369.24 C ANISOU16047 CG ARG U 52 46470 52855 40969 2821 4390 -6444 C ATOM 16048 CD ARG U 52 90.461 -8.625 40.375 1.00372.05 C ANISOU16048 CD ARG U 52 47167 52545 41647 2935 4102 -6635 C ATOM 16049 NE ARG U 52 91.853 -9.097 40.366 1.00381.70 N ANISOU16049 NE ARG U 52 48601 53448 42977 2625 3992 -6328 N ATOM 16050 CZ ARG U 52 92.932 -8.363 40.655 1.00388.89 C ANISOU16050 CZ ARG U 52 49783 54036 43939 2645 3762 -6462 C ATOM 16051 NH1 ARG U 52 92.810 -7.092 41.009 1.00393.86 N ANISOU16051 NH1 ARG U 52 50540 54587 44521 2961 3589 -6919 N ATOM 16052 NH2 ARG U 52 94.142 -8.915 40.616 1.00392.55 N ANISOU16052 NH2 ARG U 52 50391 54263 44495 2348 3689 -6133 N ATOM 16053 N GLY U 53 85.594 -10.922 38.992 1.00372.81 N ANISOU16053 N GLY U 53 46060 53982 41609 2927 4870 -6122 N ATOM 16054 CA GLY U 53 84.259 -10.753 38.396 1.00374.46 C ANISOU16054 CA GLY U 53 46018 54370 41888 3111 4962 -6201 C ATOM 16055 C GLY U 53 83.117 -11.386 39.189 1.00379.31 C ANISOU16055 C GLY U 53 46216 55785 42119 3087 5205 -6095 C ATOM 16056 O GLY U 53 82.064 -10.759 39.385 1.00387.25 O ANISOU16056 O GLY U 53 46990 57162 42984 3413 5292 -6387 O ATOM 16057 N VAL U 54 83.334 -12.624 39.649 1.00376.51 N ANISOU16057 N VAL U 54 45759 55706 41590 2703 5303 -5668 N ATOM 16058 CA VAL U 54 82.336 -13.379 40.430 1.00375.13 C ANISOU16058 CA VAL U 54 45177 56316 41039 2593 5518 -5468 C ATOM 16059 C VAL U 54 82.053 -12.660 41.743 1.00373.17 C ANISOU16059 C VAL U 54 44777 56667 40342 2897 5623 -5853 C ATOM 16060 O VAL U 54 80.892 -12.454 42.099 1.00368.24 O ANISOU16060 O VAL U 54 43808 56633 39473 3111 5781 -5985 O ATOM 16061 CB VAL U 54 82.767 -14.859 40.640 1.00377.43 C ANISOU16061 CB VAL U 54 45440 56700 41264 2087 5546 -4910 C ATOM 16062 CG1 VAL U 54 82.073 -15.516 41.826 1.00379.03 C ANISOU16062 CG1 VAL U 54 45268 57757 40988 1954 5736 -4731 C ATOM 16063 CG2 VAL U 54 82.499 -15.661 39.378 1.00379.39 C ANISOU16063 CG2 VAL U 54 45707 56572 41872 1841 5487 -4534 C ATOM 16064 N ARG U 55 83.114 -12.243 42.434 1.00374.51 N ANISOU16064 N ARG U 55 45208 56685 40402 2936 5527 -6043 N ATOM 16065 CA ARG U 55 82.954 -11.514 43.689 1.00381.75 C ANISOU16065 CA ARG U 55 46038 58123 40886 3244 5596 -6443 C ATOM 16066 C ARG U 55 82.164 -10.209 43.472 1.00380.27 C ANISOU16066 C ARG U 55 45805 57954 40724 3781 5572 -6980 C ATOM 16067 O ARG U 55 81.337 -9.851 44.307 1.00380.84 O ANISOU16067 O ARG U 55 45605 58690 40406 4070 5720 -7239 O ATOM 16068 CB ARG U 55 84.302 -11.199 44.367 1.00391.86 C ANISOU16068 CB ARG U 55 47661 59134 42093 3198 5447 -6573 C ATOM 16069 CG ARG U 55 85.243 -12.361 44.690 1.00399.09 C ANISOU16069 CG ARG U 55 48664 59997 42974 2711 5439 -6098 C ATOM 16070 CD ARG U 55 86.381 -11.860 45.591 1.00407.41 C ANISOU16070 CD ARG U 55 49994 60942 43859 2750 5313 -6313 C ATOM 16071 NE ARG U 55 87.734 -12.289 45.186 1.00408.09 N ANISOU16071 NE ARG U 55 50401 60418 44236 2433 5141 -6034 N ATOM 16072 CZ ARG U 55 88.651 -11.512 44.595 1.00406.86 C ANISOU16072 CZ ARG U 55 50596 59583 44407 2531 4914 -6212 C ATOM 16073 NH1 ARG U 55 88.393 -10.239 44.304 1.00410.25 N ANISOU16073 NH1 ARG U 55 51140 59790 44947 2927 4798 -6675 N ATOM 16074 NH2 ARG U 55 89.842 -12.014 44.287 1.00401.60 N ANISOU16074 NH2 ARG U 55 50165 58463 43961 2230 4788 -5912 N ATOM 16075 N GLN U 56 82.421 -9.502 42.368 1.00377.11 N ANISOU16075 N GLN U 56 45665 56847 40773 3923 5378 -7145 N ATOM 16076 CA GLN U 56 81.716 -8.242 42.095 1.00378.69 C ANISOU16076 CA GLN U 56 45853 56988 41041 4430 5312 -7651 C ATOM 16077 C GLN U 56 80.234 -8.476 41.806 1.00380.48 C ANISOU16077 C GLN U 56 45653 57714 41195 4555 5511 -7592 C ATOM 16078 O GLN U 56 79.383 -7.745 42.308 1.00381.91 O ANISOU16078 O GLN U 56 45632 58347 41127 4981 5589 -7980 O ATOM 16079 CB GLN U 56 82.378 -7.443 40.964 1.00377.62 C ANISOU16079 CB GLN U 56 46099 55965 41412 4514 5032 -7802 C ATOM 16080 CG GLN U 56 81.792 -6.051 40.744 1.00378.23 C ANISOU16080 CG GLN U 56 46227 55907 41577 5043 4901 -8352 C ATOM 16081 CD GLN U 56 81.822 -5.179 41.984 1.00379.65 C ANISOU16081 CD GLN U 56 46450 56433 41365 5429 4866 -8852 C ATOM 16082 OE1 GLN U 56 82.728 -5.280 42.808 1.00380.61 O ANISOU16082 OE1 GLN U 56 46747 56579 41287 5301 4816 -8852 O ATOM 16083 NE2 GLN U 56 80.831 -4.308 42.114 1.00379.11 N ANISOU16083 NE2 GLN U 56 46230 56629 41184 5919 4879 -9290 N ATOM 16084 N ALA U 57 79.932 -9.501 41.016 1.00380.91 N ANISOU16084 N ALA U 57 45571 57700 41456 4192 5582 -7105 N ATOM 16085 CA ALA U 57 78.542 -9.831 40.713 1.00386.01 C ANISOU16085 CA ALA U 57 45800 58820 42045 4246 5756 -6974 C ATOM 16086 C ALA U 57 77.777 -10.176 41.964 1.00394.02 C ANISOU16086 C ALA U 57 46400 60800 42507 4306 6002 -6960 C ATOM 16087 O ALA U 57 76.685 -9.659 42.213 1.00396.62 O ANISOU16087 O ALA U 57 46416 61646 42635 4669 6127 -7216 O ATOM 16088 CB ALA U 57 78.484 -10.992 39.764 1.00383.18 C ANISOU16088 CB ALA U 57 45405 58216 41970 3787 5760 -6414 C ATOM 16089 N GLN U 58 78.364 -11.061 42.750 1.00401.20 N ANISOU16089 N GLN U 58 47300 61969 43165 3949 6068 -6649 N ATOM 16090 CA GLN U 58 77.746 -11.449 43.989 1.00420.84 C ANISOU16090 CA GLN U 58 49402 65394 45104 3957 6294 -6590 C ATOM 16091 C GLN U 58 77.692 -10.272 44.986 1.00444.53 C ANISOU16091 C GLN U 58 52414 68742 47745 4485 6320 -7202 C ATOM 16092 O GLN U 58 76.725 -10.156 45.735 1.00465.57 O ANISOU16092 O GLN U 58 54685 72221 49990 4726 6522 -7329 O ATOM 16093 CB GLN U 58 78.433 -12.691 44.555 1.00409.63 C ANISOU16093 CB GLN U 58 47993 64122 43525 3425 6327 -6091 C ATOM 16094 CG GLN U 58 78.261 -13.924 43.678 1.00390.13 C ANISOU16094 CG GLN U 58 45450 61443 41339 2936 6308 -5488 C ATOM 16095 CD GLN U 58 79.200 -15.062 44.051 1.00381.19 C ANISOU16095 CD GLN U 58 44459 60212 40163 2427 6256 -5032 C ATOM 16096 OE1 GLN U 58 80.198 -14.874 44.769 1.00380.17 O ANISOU16096 OE1 GLN U 58 44564 59988 39895 2417 6200 -5167 O ATOM 16097 NE2 GLN U 58 78.891 -16.261 43.555 1.00372.57 N ANISOU16097 NE2 GLN U 58 43233 59125 39199 1996 6252 -4484 N ATOM 16098 N ALA U 59 78.688 -9.378 44.966 1.00451.05 N ANISOU16098 N ALA U 59 53684 68961 48733 4682 6104 -7582 N ATOM 16099 CA ALA U 59 78.683 -8.193 45.852 1.00459.82 C ANISOU16099 CA ALA U 59 54870 70305 49533 5207 6070 -8200 C ATOM 16100 C ALA U 59 77.520 -7.234 45.562 1.00467.43 C ANISOU16100 C ALA U 59 55630 71478 50492 5758 6107 -8632 C ATOM 16101 O ALA U 59 76.928 -6.681 46.495 1.00479.57 O ANISOU16101 O ALA U 59 56963 73661 51590 6173 6224 -9010 O ATOM 16102 CB ALA U 59 80.018 -7.451 45.819 1.00450.91 C ANISOU16102 CB ALA U 59 54281 68422 48621 5262 5782 -8477 C ATOM 16103 N GLU U 60 77.192 -7.039 44.281 1.00460.39 N ATOM 16104 CA GLU U 60 76.012 -6.222 43.910 1.00454.83 C ATOM 16105 C GLU U 60 74.749 -7.075 43.657 1.00456.88 C ATOM 16106 O GLU U 60 73.712 -6.591 43.166 1.00455.62 O ATOM 16107 CB GLU U 60 76.317 -5.215 42.782 1.00436.86 C ATOM 16108 CG GLU U 60 76.776 -5.799 41.459 1.00410.00 C ATOM 16109 CD GLU U 60 77.361 -4.744 40.554 1.00392.25 C ATOM 16110 OE1 GLU U 60 76.651 -4.289 39.632 1.00382.10 O ATOM 16111 OE2 GLU U 60 78.530 -4.374 40.776 1.00384.52 O