>>4NE1:HELIX   65  65 SER V   31  GLU V   60  1                                  30    
SGDALQLMVELLKVFVVEAAVRGVRQAQAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 65 65 SER V 31 GLU V 60 1 30 ATOM 16478 N SER V 31 91.202 -43.902 19.294 1.00313.44 N ANISOU16478 N SER V 31 43914 44170 31009 1414 5521 -1307 N ATOM 16479 CA SER V 31 92.367 -44.627 18.709 1.00308.89 C ANISOU16479 CA SER V 31 43064 44236 30064 1449 5278 -1644 C ATOM 16480 C SER V 31 91.942 -45.946 18.058 1.00325.96 C ANISOU16480 C SER V 31 44994 46618 32236 1726 5036 -1891 C ATOM 16481 O SER V 31 90.854 -46.486 18.336 1.00329.51 O ANISOU16481 O SER V 31 45553 46674 32970 1903 5025 -1845 O ATOM 16482 CB SER V 31 93.500 -44.865 19.723 1.00283.62 C ANISOU16482 CB SER V 31 40013 41022 26727 1398 5246 -1925 C ATOM 16483 OG SER V 31 93.251 -46.040 20.470 1.00263.64 O ANISOU16483 OG SER V 31 37589 38223 24357 1625 5105 -2185 O ATOM 16484 N GLY V 32 92.806 -46.447 17.179 1.00336.85 N ANISOU16484 N GLY V 32 46043 48639 33302 1750 4849 -2165 N ATOM 16485 CA GLY V 32 92.470 -47.581 16.316 1.00348.65 C ANISOU16485 CA GLY V 32 47266 50439 34765 1971 4629 -2420 C ATOM 16486 C GLY V 32 92.039 -48.847 17.035 1.00348.28 C ANISOU16486 C GLY V 32 47344 50005 34980 2261 4469 -2692 C ATOM 16487 O GLY V 32 91.054 -49.507 16.625 1.00355.99 O ANISOU16487 O GLY V 32 48266 50877 36115 2422 4371 -2688 O ATOM 16488 N ASP V 33 92.783 -49.191 18.090 1.00337.61 N ANISOU16488 N ASP V 33 46151 48456 33669 2301 4417 -2906 N ATOM 16489 CA ASP V 33 92.519 -50.424 18.852 1.00320.80 C ANISOU16489 CA ASP V 33 44135 45966 31787 2541 4214 -3151 C ATOM 16490 C ASP V 33 91.176 -50.310 19.568 1.00304.76 C ANISOU16490 C ASP V 33 42416 43310 30066 2554 4340 -2848 C ATOM 16491 O ASP V 33 90.426 -51.273 19.560 1.00305.96 O ANISOU16491 O ASP V 33 42565 43271 30414 2750 4175 -2938 O ATOM 16492 CB ASP V 33 93.681 -50.854 19.789 1.00313.00 C ANISOU16492 CB ASP V 33 43208 44944 30770 2553 4081 -3418 C ATOM 16493 CG ASP V 33 94.745 -51.727 19.079 1.00308.41 C ANISOU16493 CG ASP V 33 42241 44900 30041 2718 3824 -3881 C ATOM 16494 OD1 ASP V 33 94.490 -52.210 17.948 1.00305.58 O ANISOU16494 OD1 ASP V 33 41594 44891 29619 2851 3730 -4060 O ATOM 16495 OD2 ASP V 33 95.861 -51.886 19.630 1.00302.19 O ANISOU16495 OD2 ASP V 33 41418 44207 29193 2699 3727 -4072 O ATOM 16496 N ALA V 34 90.850 -49.127 20.108 1.00276.18 N ANISOU16496 N ALA V 34 39040 39395 26500 2344 4636 -2503 N ATOM 16497 CA ALA V 34 89.530 -48.858 20.720 1.00250.65 C ANISOU16497 CA ALA V 34 36066 35598 23572 2342 4816 -2214 C ATOM 16498 C ALA V 34 88.368 -49.127 19.748 1.00245.88 C ANISOU16498 C ALA V 34 35289 35033 23101 2477 4770 -2059 C ATOM 16499 O ALA V 34 87.433 -49.879 20.064 1.00237.10 O ANISOU16499 O ALA V 34 34258 33608 22218 2625 4690 -2056 O ATOM 16500 CB ALA V 34 89.476 -47.435 21.257 1.00241.74 C ANISOU16500 CB ALA V 34 35161 34209 22480 2093 5159 -1915 C ATOM 16501 N LEU V 35 88.462 -48.540 18.556 1.00253.42 N ANISOU16501 N LEU V 35 35992 36406 23889 2395 4796 -1921 N ATOM 16502 CA LEU V 35 87.478 -48.755 17.487 1.00263.62 C ANISOU16502 CA LEU V 35 37076 37840 25245 2472 4722 -1757 C ATOM 16503 C LEU V 35 87.276 -50.248 17.185 1.00271.58 C ANISOU16503 C LEU V 35 37954 38966 26267 2712 4423 -2097 C ATOM 16504 O LEU V 35 86.139 -50.731 17.059 1.00273.76 O ANISOU16504 O LEU V 35 38243 39016 26756 2825 4367 -1977 O ATOM 16505 CB LEU V 35 87.886 -48.007 16.196 1.00268.02 C ANISOU16505 CB LEU V 35 37343 38965 25525 2294 4733 -1605 C ATOM 16506 CG LEU V 35 86.892 -48.058 15.014 1.00269.30 C ANISOU16506 CG LEU V 35 37275 39333 25714 2293 4658 -1360 C ATOM 16507 CD1 LEU V 35 85.611 -47.348 15.405 1.00272.97 C ANISOU16507 CD1 LEU V 35 37910 39237 26568 2274 4853 -891 C ATOM 16508 CD2 LEU V 35 87.420 -47.538 13.681 1.00269.55 C ANISOU16508 CD2 LEU V 35 36981 40045 25388 2078 4603 -1266 C ATOM 16509 N GLN V 36 88.388 -50.967 17.068 1.00279.03 N ANISOU16509 N GLN V 36 38758 40253 27006 2789 4226 -2524 N ATOM 16510 CA AGLN V 36 88.361 -52.379 16.708 0.50280.08 C ANISOU16510 CA AGLN V 36 38733 40516 27166 3020 3923 -2908 C ATOM 16511 CA BGLN V 36 88.366 -52.382 16.712 0.50279.90 C ANISOU16511 CA BGLN V 36 38711 40493 27144 3021 3923 -2909 C ATOM 16512 C GLN V 36 87.657 -53.226 17.761 1.00276.66 C ANISOU16512 C GLN V 36 38553 39501 27062 3176 3813 -2931 C ATOM 16513 O GLN V 36 86.854 -54.105 17.436 1.00276.29 O ANISOU16513 O GLN V 36 38453 39363 27158 3325 3636 -2992 O ATOM 16514 CB AGLN V 36 89.779 -52.876 16.446 0.50283.43 C ANISOU16514 CB AGLN V 36 38938 41395 27357 3075 3760 -3373 C ATOM 16515 CB BGLN V 36 89.787 -52.886 16.474 0.50282.98 C ANISOU16515 CB BGLN V 36 38885 41329 27304 3077 3758 -3375 C ATOM 16516 CG AGLN V 36 90.236 -52.586 15.028 0.50288.57 C ANISOU16516 CG AGLN V 36 39224 42757 27660 2973 3763 -3475 C ATOM 16517 CG BGLN V 36 90.262 -52.642 15.055 0.50287.82 C ANISOU16517 CG BGLN V 36 39130 42657 27572 2985 3753 -3496 C ATOM 16518 CD AGLN V 36 89.577 -53.523 14.036 0.50294.31 C ANISOU16518 CD AGLN V 36 39730 43703 28388 3110 3573 -3670 C ATOM 16519 CD BGLN V 36 89.618 -53.606 14.078 0.50293.34 C ANISOU16519 CD BGLN V 36 39609 43570 28276 3127 3558 -3704 C ATOM 16520 OE1AGLN V 36 89.061 -53.096 13.003 0.50300.73 O ANISOU16520 OE1AGLN V 36 40378 44851 29034 2967 3632 -3466 O ATOM 16521 OE1BGLN V 36 89.146 -53.207 13.016 0.50299.89 O ANISOU16521 OE1BGLN V 36 40260 44759 28926 2988 3611 -3524 O ATOM 16522 NE2AGLN V 36 89.574 -54.811 14.357 0.50294.44 N ANISOU16522 NE2AGLN V 36 39748 43519 28604 3366 3326 -4051 N ATOM 16523 NE2BGLN V 36 89.581 -54.881 14.441 0.50293.09 N ANISOU16523 NE2BGLN V 36 39592 43309 28457 3382 3313 -4067 N ATOM 16524 N LEU V 37 87.944 -52.947 19.019 1.00269.08 N ANISOU16524 N LEU V 37 37872 38165 26202 3107 3912 -2867 N ATOM 16525 CA LEU V 37 87.303 -53.700 20.065 1.00259.86 C ANISOU16525 CA LEU V 37 36945 36483 25306 3194 3808 -2858 C ATOM 16526 C LEU V 37 85.840 -53.309 20.178 1.00258.91 C ANISOU16526 C LEU V 37 36963 36012 25396 3158 3996 -2477 C ATOM 16527 O LEU V 37 85.030 -54.119 20.604 1.00255.52 O ANISOU16527 O LEU V 37 36636 35270 25179 3257 3862 -2464 O ATOM 16528 CB LEU V 37 88.043 -53.570 21.392 1.00254.32 C ANISOU16528 CB LEU V 37 36490 35525 24614 3084 3842 -2905 C ATOM 16529 CG LEU V 37 89.318 -54.410 21.491 1.00250.07 C ANISOU16529 CG LEU V 37 35813 35209 23993 3186 3541 -3304 C ATOM 16530 CD1 LEU V 37 90.025 -54.115 22.806 1.00245.48 C ANISOU16530 CD1 LEU V 37 35481 34394 23394 3013 3592 -3269 C ATOM 16531 CD2 LEU V 37 89.046 -55.897 21.322 1.00249.45 C ANISOU16531 CD2 LEU V 37 35622 35043 24115 3433 3159 -3568 C ATOM 16532 N MET V 38 85.490 -52.094 19.758 1.00260.75 N ANISOU16532 N MET V 38 37176 36301 25594 3018 4285 -2158 N ATOM 16533 CA MET V 38 84.082 -51.712 19.699 1.00262.21 C ANISOU16533 CA MET V 38 37419 36188 26020 3010 4453 -1792 C ATOM 16534 C MET V 38 83.230 -52.470 18.703 1.00259.55 C ANISOU16534 C MET V 38 36870 36007 25738 3148 4247 -1770 C ATOM 16535 O MET V 38 82.068 -52.788 18.982 1.00252.94 O ANISOU16535 O MET V 38 36114 34842 25146 3206 4255 -1587 O ATOM 16536 CB MET V 38 83.899 -50.220 19.522 1.00267.73 C ANISOU16536 CB MET V 38 38134 36848 26743 2835 4787 -1437 C ATOM 16537 CG MET V 38 83.654 -49.611 20.872 1.00274.93 C ANISOU16537 CG MET V 38 39365 37251 27842 2731 5066 -1320 C ATOM 16538 SD MET V 38 82.837 -50.833 21.924 1.00276.56 S ANISOU16538 SD MET V 38 39770 37047 28262 2848 4934 -1430 S ATOM 16539 CE MET V 38 81.126 -50.598 21.429 1.00278.33 C ANISOU16539 CE MET V 38 39899 37049 28804 2920 5067 -1046 C ATOM 16540 N VAL V 39 83.815 -52.760 17.548 1.00263.10 N ANISOU16540 N VAL V 39 37040 36982 25944 3178 4071 -1967 N ATOM 16541 CA VAL V 39 83.182 -53.645 16.566 1.00266.97 C ANISOU16541 CA VAL V 39 37319 37687 26429 3291 3832 -2048 C ATOM 16542 C VAL V 39 82.858 -55.003 17.189 1.00266.72 C ANISOU16542 C VAL V 39 37403 37351 26587 3474 3571 -2294 C ATOM 16543 O VAL V 39 81.759 -55.526 17.005 1.00266.93 O ANISOU16543 O VAL V 39 37426 37210 26782 3537 3475 -2159 O ATOM 16544 CB VAL V 39 84.048 -53.798 15.292 1.00272.58 C ANISOU16544 CB VAL V 39 37706 39067 26795 3266 3694 -2324 C ATOM 16545 CG1 VAL V 39 83.612 -54.994 14.439 1.00274.28 C ANISOU16545 CG1 VAL V 39 37728 39498 26986 3398 3404 -2577 C ATOM 16546 CG2 VAL V 39 83.984 -52.508 14.488 1.00276.32 C ANISOU16546 CG2 VAL V 39 38038 39843 27107 3043 3904 -1953 C ATOM 16547 N GLU V 40 83.815 -55.543 17.940 1.00268.61 N ANISOU16547 N GLU V 40 37738 37511 26809 3539 3440 -2621 N ATOM 16548 CA GLU V 40 83.656 -56.814 18.656 1.00271.20 C ANISOU16548 CA GLU V 40 38187 37515 27341 3685 3152 -2836 C ATOM 16549 C GLU V 40 82.574 -56.769 19.748 1.00263.86 C ANISOU16549 C GLU V 40 37543 36040 26670 3629 3259 -2512 C ATOM 16550 O GLU V 40 81.797 -57.728 19.917 1.00271.53 O ANISOU16550 O GLU V 40 38560 36779 27828 3718 3041 -2517 O ATOM 16551 CB GLU V 40 84.992 -57.232 19.292 1.00278.14 C ANISOU16551 CB GLU V 40 39094 38419 28166 3729 2996 -3187 C ATOM 16552 CG GLU V 40 86.079 -57.690 18.318 1.00288.05 C ANISOU16552 CG GLU V 40 40034 40182 29229 3844 2809 -3632 C ATOM 16553 CD GLU V 40 85.981 -59.154 17.915 1.00297.76 C ANISOU16553 CD GLU V 40 41121 41404 30611 4066 2420 -4006 C ATOM 16554 OE1 GLU V 40 86.815 -59.580 17.078 1.00302.79 O ANISOU16554 OE1 GLU V 40 41471 42459 31113 4174 2281 -4427 O ATOM 16555 OE2 GLU V 40 85.087 -59.871 18.431 1.00304.64 O ANISOU16555 OE2 GLU V 40 42153 41855 31738 4124 2255 -3897 O ATOM 16556 N LEU V 41 82.551 -55.661 20.494 1.00247.49 N ANISOU16556 N LEU V 41 35655 33776 24603 3466 3598 -2252 N ATOM 16557 CA LEU V 41 81.588 -55.488 21.581 1.00230.70 C ANISOU16557 CA LEU V 41 33787 31173 22695 3381 3767 -1981 C ATOM 16558 C LEU V 41 80.185 -55.352 21.033 1.00223.84 C ANISOU16558 C LEU V 41 32838 30215 21994 3411 3860 -1672 C ATOM 16559 O LEU V 41 79.290 -55.989 21.552 1.00219.56 O ANISOU16559 O LEU V 41 32399 29382 21639 3434 3775 -1579 O ATOM 16560 CB LEU V 41 81.945 -54.315 22.519 1.00223.89 C ANISOU16560 CB LEU V 41 33137 30130 21798 3187 4131 -1840 C ATOM 16561 CG LEU V 41 81.028 -53.824 23.666 1.00217.71 C ANISOU16561 CG LEU V 41 32611 28899 21207 3049 4426 -1588 C ATOM 16562 CD1 LEU V 41 80.417 -54.922 24.530 1.00215.59 C ANISOU16562 CD1 LEU V 41 32493 28343 21077 3054 4219 -1615 C ATOM 16563 CD2 LEU V 41 81.797 -52.858 24.556 1.00216.29 C ANISOU16563 CD2 LEU V 41 32633 28626 20921 2848 4708 -1604 C ATOM 16564 N LEU V 42 79.999 -54.558 19.981 1.00219.56 N ANISOU16564 N LEU V 42 32097 29939 21386 3391 4006 -1493 N ATOM 16565 CA LEU V 42 78.679 -54.410 19.381 1.00218.90 C ANISOU16565 CA LEU V 42 31899 29796 21475 3411 4066 -1162 C ATOM 16566 C LEU V 42 78.178 -55.715 18.796 1.00224.45 C ANISOU16566 C LEU V 42 32484 30598 22199 3539 3702 -1299 C ATOM 16567 O LEU V 42 77.005 -56.037 18.941 1.00224.31 O ANISOU16567 O LEU V 42 32492 30345 22388 3559 3685 -1078 O ATOM 16568 CB LEU V 42 78.653 -53.311 18.335 1.00216.06 C ANISOU16568 CB LEU V 42 31331 29724 21038 3331 4241 -910 C ATOM 16569 CG LEU V 42 78.581 -51.930 18.969 1.00212.27 C ANISOU16569 CG LEU V 42 30980 28976 20695 3205 4640 -636 C ATOM 16570 CD1 LEU V 42 78.485 -50.900 17.868 1.00213.44 C ANISOU16570 CD1 LEU V 42 30900 29386 20812 3115 4750 -331 C ATOM 16571 CD2 LEU V 42 77.402 -51.810 19.925 1.00208.06 C ANISOU16571 CD2 LEU V 42 30613 27938 20501 3212 4846 -409 C ATOM 16572 N LYS V 43 79.083 -56.457 18.154 1.00231.10 N ANISOU16572 N LYS V 43 33187 31782 22835 3620 3419 -1681 N ATOM 16573 CA LYS V 43 78.827 -57.824 17.674 1.00234.67 C ANISOU16573 CA LYS V 43 33545 32305 23313 3751 3037 -1929 C ATOM 16574 C LYS V 43 78.268 -58.703 18.808 1.00229.17 C ANISOU16574 C LYS V 43 33080 31132 22860 3794 2881 -1923 C ATOM 16575 O LYS V 43 77.123 -59.189 18.732 1.00228.45 O ANISOU16575 O LYS V 43 32994 30873 22932 3808 2787 -1733 O ATOM 16576 CB LYS V 43 80.124 -58.426 17.065 1.00241.51 C ANISOU16576 CB LYS V 43 34245 33560 23956 3841 2800 -2434 C ATOM 16577 CG LYS V 43 80.148 -59.927 16.732 1.00244.56 C ANISOU16577 CG LYS V 43 34549 33962 24409 4003 2382 -2821 C ATOM 16578 CD LYS V 43 81.575 -60.488 16.829 1.00242.45 C ANISOU16578 CD LYS V 43 34211 33850 24060 4117 2190 -3332 C ATOM 16579 CE LYS V 43 81.710 -61.952 16.422 1.00239.99 C ANISOU16579 CE LYS V 43 33779 33545 23858 4300 1772 -3779 C ATOM 16580 NZ LYS V 43 81.931 -62.061 14.954 1.00239.34 N ANISOU16580 NZ LYS V 43 33383 34020 23534 4318 1734 -4061 N ATOM 16581 N VAL V 44 79.058 -58.877 19.869 1.00222.25 N ANISOU16581 N VAL V 44 32388 30055 21998 3781 2848 -2096 N ATOM 16582 CA VAL V 44 78.696 -59.843 20.919 1.00215.98 C ANISOU16582 CA VAL V 44 31798 28864 21401 3787 2623 -2116 C ATOM 16583 C VAL V 44 77.459 -59.352 21.706 1.00218.09 C ANISOU16583 C VAL V 44 32236 28794 21832 3655 2888 -1699 C ATOM 16584 O VAL V 44 76.626 -60.145 22.125 1.00220.93 O ANISOU16584 O VAL V 44 32679 28909 22355 3647 2708 -1602 O ATOM 16585 CB VAL V 44 79.888 -60.241 21.829 1.00212.02 C ANISOU16585 CB VAL V 44 31426 28257 20873 3779 2459 -2388 C ATOM 16586 CG1 VAL V 44 79.512 -61.453 22.662 1.00210.62 C ANISOU16586 CG1 VAL V 44 31400 27721 20904 3782 2107 -2411 C ATOM 16587 CG2 VAL V 44 81.128 -60.566 21.003 1.00209.56 C ANISOU16587 CG2 VAL V 44 30893 28311 20416 3921 2262 -2806 C ATOM 16588 N PHE V 45 77.359 -58.031 21.855 1.00218.53 N ANISOU16588 N PHE V 45 32323 28853 21855 3551 3315 -1468 N ATOM 16589 CA PHE V 45 76.204 -57.267 22.368 1.00218.35 C ANISOU16589 CA PHE V 45 32385 28571 22006 3447 3665 -1090 C ATOM 16590 C PHE V 45 74.888 -57.681 21.704 1.00220.87 C ANISOU16590 C PHE V 45 32559 28873 22485 3510 3571 -855 C ATOM 16591 O PHE V 45 73.935 -58.141 22.351 1.00223.70 O ANISOU16591 O PHE V 45 33015 28967 23012 3466 3547 -697 O ATOM 16592 CB PHE V 45 76.518 -55.818 21.993 1.00214.52 C ANISOU16592 CB PHE V 45 31829 28218 21459 3393 4046 -951 C ATOM 16593 CG PHE V 45 75.732 -54.778 22.702 1.00214.28 C ANISOU16593 CG PHE V 45 31903 27891 21621 3284 4476 -655 C ATOM 16594 CD1 PHE V 45 76.083 -54.356 23.983 1.00218.70 C ANISOU16594 CD1 PHE V 45 32714 28208 22173 3138 4710 -720 C ATOM 16595 CD2 PHE V 45 74.687 -54.147 22.045 1.00212.84 C ANISOU16595 CD2 PHE V 45 31546 27688 21633 3315 4660 -318 C ATOM 16596 CE1 PHE V 45 75.358 -53.361 24.617 1.00223.99 C ANISOU16596 CE1 PHE V 45 33464 28605 23035 3039 5143 -504 C ATOM 16597 CE2 PHE V 45 73.960 -53.156 22.666 1.00215.75 C ANISOU16597 CE2 PHE V 45 31974 27759 22239 3242 5072 -73 C ATOM 16598 CZ PHE V 45 74.290 -52.767 23.953 1.00221.52 C ANISOU16598 CZ PHE V 45 32959 28240 22968 3111 5327 -191 C ATOM 16599 N VAL V 46 74.845 -57.506 20.393 1.00220.35 N ANISOU16599 N VAL V 46 32250 29127 22345 3584 3511 -820 N ATOM 16600 CA VAL V 46 73.635 -57.758 19.649 1.00218.72 C ANISOU16600 CA VAL V 46 31881 28956 22267 3614 3434 -561 C ATOM 16601 C VAL V 46 73.386 -59.264 19.529 1.00221.02 C ANISOU16601 C VAL V 46 32180 29224 22573 3685 2991 -756 C ATOM 16602 O VAL V 46 72.251 -59.712 19.638 1.00221.87 O ANISOU16602 O VAL V 46 32287 29162 22848 3668 2918 -534 O ATOM 16603 CB VAL V 46 73.681 -57.067 18.278 1.00215.70 C ANISOU16603 CB VAL V 46 31230 28955 21769 3613 3494 -431 C ATOM 16604 CG1 VAL V 46 72.487 -57.475 17.441 1.00213.41 C ANISOU16604 CG1 VAL V 46 30759 28747 21580 3622 3345 -176 C ATOM 16605 CG2 VAL V 46 73.700 -55.557 18.446 1.00212.87 C ANISOU16605 CG2 VAL V 46 30864 28529 21486 3531 3917 -151 C ATOM 16606 N VAL V 47 74.450 -60.040 19.337 1.00222.18 N ANISOU16606 N VAL V 47 32326 29519 22570 3763 2691 -1175 N ATOM 16607 CA VAL V 47 74.354 -61.502 19.291 1.00224.75 C ANISOU16607 CA VAL V 47 32671 29764 22957 3842 2241 -1414 C ATOM 16608 C VAL V 47 73.816 -62.059 20.600 1.00230.13 C ANISOU16608 C VAL V 47 33591 30015 23830 3770 2160 -1289 C ATOM 16609 O VAL V 47 73.025 -62.999 20.625 1.00225.02 O ANISOU16609 O VAL V 47 32964 29217 23316 3769 1887 -1226 O ATOM 16610 CB VAL V 47 75.730 -62.123 18.975 1.00222.87 C ANISOU16610 CB VAL V 47 32375 29722 22580 3957 1972 -1920 C ATOM 16611 CG1 VAL V 47 75.834 -63.572 19.439 1.00222.34 C ANISOU16611 CG1 VAL V 47 32404 29400 22673 4033 1517 -2176 C ATOM 16612 CG2 VAL V 47 76.018 -61.991 17.493 1.00225.80 C ANISOU16612 CG2 VAL V 47 32470 30573 22750 4009 1940 -2090 C ATOM 16613 N GLU V 48 74.242 -61.470 21.695 1.00245.52 N ANISOU16613 N GLU V 48 35724 31786 25774 3674 2394 -1244 N ATOM 16614 CA GLU V 48 73.715 -61.898 22.949 1.00263.30 C ANISOU16614 CA GLU V 48 38193 33688 28158 3545 2353 -1101 C ATOM 16615 C GLU V 48 72.231 -61.567 23.103 1.00257.20 C ANISOU16615 C GLU V 48 37407 32780 27534 3458 2580 -699 C ATOM 16616 O GLU V 48 71.475 -62.383 23.645 1.00256.84 O ANISOU16616 O GLU V 48 37449 32530 27607 3381 2380 -582 O ATOM 16617 CB GLU V 48 74.574 -61.368 24.075 1.00288.07 C ANISOU16617 CB GLU V 48 41528 36709 31213 3423 2542 -1175 C ATOM 16618 CG GLU V 48 75.757 -62.284 24.312 1.00320.58 C ANISOU16618 CG GLU V 48 45697 40821 35288 3476 2135 -1523 C ATOM 16619 CD GLU V 48 75.329 -63.648 24.842 1.00339.16 C ANISOU16619 CD GLU V 48 48146 42913 37803 3438 1683 -1519 C ATOM 16620 OE1 GLU V 48 74.443 -63.701 25.734 1.00354.29 O ANISOU16620 OE1 GLU V 48 50213 44606 39791 3252 1765 -1242 O ATOM 16621 OE2 GLU V 48 75.889 -64.674 24.387 1.00349.91 O ANISOU16621 OE2 GLU V 48 49426 44290 39233 3584 1240 -1802 O ATOM 16622 N ALA V 49 71.802 -60.411 22.595 1.00253.25 N ANISOU16622 N ALA V 49 36775 32395 27051 3468 2969 -476 N ATOM 16623 CA ALA V 49 70.365 -60.078 22.593 1.00252.11 C ANISOU16623 CA ALA V 49 36552 32140 27098 3420 3177 -89 C ATOM 16624 C ALA V 49 69.569 -61.153 21.828 1.00254.69 C ANISOU16624 C ALA V 49 36752 32531 27487 3474 2793 -22 C ATOM 16625 O ALA V 49 68.519 -61.646 22.275 1.00255.47 O ANISOU16625 O ALA V 49 36884 32452 27730 3397 2730 193 O ATOM 16626 CB ALA V 49 70.126 -58.678 22.027 1.00249.33 C ANISOU16626 CB ALA V 49 36037 31892 26803 3444 3597 139 C ATOM 16627 N ALA V 50 70.122 -61.541 20.690 1.00256.71 N ANISOU16627 N ALA V 50 36865 33060 27614 3586 2531 -236 N ATOM 16628 CA ALA V 50 69.566 -62.593 19.884 1.00259.75 C ANISOU16628 CA ALA V 50 37138 33534 28018 3629 2142 -261 C ATOM 16629 C ALA V 50 69.606 -63.953 20.592 1.00260.61 C ANISOU16629 C ALA V 50 37424 33396 28199 3607 1727 -442 C ATOM 16630 O ALA V 50 68.592 -64.645 20.608 1.00268.72 O ANISOU16630 O ALA V 50 38447 34305 29347 3551 1533 -254 O ATOM 16631 CB ALA V 50 70.301 -62.646 18.564 1.00259.78 C ANISOU16631 CB ALA V 50 36953 33921 27829 3726 1993 -526 C ATOM 16632 N VAL V 51 70.762 -64.322 21.164 1.00255.60 N ANISOU16632 N VAL V 51 36929 32681 27504 3639 1573 -775 N ATOM 16633 CA VAL V 51 70.952 -65.585 21.911 1.00256.13 C ANISOU16633 CA VAL V 51 37164 32479 27675 3606 1140 -933 C ATOM 16634 C VAL V 51 69.963 -65.719 23.038 1.00271.37 C ANISOU16634 C VAL V 51 39254 34126 29728 3413 1201 -588 C ATOM 16635 O VAL V 51 69.347 -66.772 23.206 1.00278.89 O ANISOU16635 O VAL V 51 40255 34910 30800 3352 838 -519 O ATOM 16636 CB VAL V 51 72.355 -65.692 22.543 1.00244.43 C ANISOU16636 CB VAL V 51 35799 30936 26135 3637 1043 -1256 C ATOM 16637 CG1 VAL V 51 72.391 -66.704 23.699 1.00238.63 C ANISOU16637 CG1 VAL V 51 35273 29856 25540 3518 684 -1250 C ATOM 16638 CG2 VAL V 51 73.376 -66.034 21.479 1.00242.45 C ANISOU16638 CG2 VAL V 51 35379 30937 25803 3837 827 -1689 C ATOM 16639 N ARG V 52 69.834 -64.650 23.814 1.00284.94 N ANISOU16639 N ARG V 52 41050 35801 31412 3299 1662 -390 N ATOM 16640 CA ARG V 52 68.926 -64.660 24.944 1.00294.20 C ANISOU16640 CA ARG V 52 42359 36756 32668 3085 1795 -95 C ATOM 16641 C ARG V 52 67.478 -64.789 24.464 1.00294.56 C ANISOU16641 C ARG V 52 42260 36817 32842 3067 1821 228 C ATOM 16642 O ARG V 52 66.718 -65.586 25.025 1.00291.18 O ANISOU16642 O ARG V 52 41908 36231 32497 2921 1602 393 O ATOM 16643 CB ARG V 52 69.145 -63.445 25.859 1.00298.30 C ANISOU16643 CB ARG V 52 42980 37237 33119 2963 2320 -21 C ATOM 16644 CG ARG V 52 70.489 -63.458 26.576 1.00304.34 C ANISOU16644 CG ARG V 52 43924 37961 33749 2907 2247 -292 C ATOM 16645 CD ARG V 52 70.691 -62.276 27.518 1.00307.62 C ANISOU16645 CD ARG V 52 44464 38339 34078 2747 2763 -237 C ATOM 16646 NE ARG V 52 72.014 -61.654 27.338 1.00312.96 N ANISOU16646 NE ARG V 52 45159 39136 34614 2827 2865 -490 N ATOM 16647 CZ ARG V 52 72.844 -61.329 28.331 1.00314.35 C ANISOU16647 CZ ARG V 52 45524 39255 34659 2660 2978 -601 C ATOM 16648 NH1 ARG V 52 72.489 -61.564 29.579 1.00316.67 N ANISOU16648 NH1 ARG V 52 46007 39387 34925 2385 3007 -488 N ATOM 16649 NH2 ARG V 52 74.019 -60.751 28.091 1.00310.22 N ANISOU16649 NH2 ARG V 52 44996 38863 34007 2732 3065 -813 N ATOM 16650 N GLY V 53 67.117 -64.040 23.415 1.00294.31 N ANISOU16650 N GLY V 53 42010 36986 32825 3193 2053 338 N ATOM 16651 CA GLY V 53 65.799 -64.157 22.772 1.00293.37 C ANISOU16651 CA GLY V 53 41711 36923 32833 3188 2040 657 C ATOM 16652 C GLY V 53 65.453 -65.590 22.367 1.00299.81 C ANISOU16652 C GLY V 53 42532 37704 33675 3177 1483 599 C ATOM 16653 O GLY V 53 64.340 -66.070 22.627 1.00299.18 O ANISOU16653 O GLY V 53 42440 37524 33708 3057 1386 876 O ATOM 16654 N VAL V 54 66.410 -66.278 21.735 1.00303.95 N ANISOU16654 N VAL V 54 43065 38310 34111 3298 1119 225 N ATOM 16655 CA VAL V 54 66.221 -67.682 21.297 1.00299.89 C ANISOU16655 CA VAL V 54 42562 37731 33652 3307 561 86 C ATOM 16656 C VAL V 54 66.058 -68.643 22.483 1.00298.59 C ANISOU16656 C VAL V 54 42615 37236 33597 3151 252 133 C ATOM 16657 O VAL V 54 65.220 -69.557 22.418 1.00303.92 O ANISOU16657 O VAL V 54 43298 37801 34376 3059 -79 280 O ATOM 16658 CB VAL V 54 67.340 -68.168 20.328 1.00293.23 C ANISOU16658 CB VAL V 54 41647 37052 32712 3487 273 -396 C ATOM 16659 CG1 VAL V 54 67.363 -69.685 20.212 1.00288.52 C ANISOU16659 CG1 VAL V 54 41117 36272 32234 3498 -319 -626 C ATOM 16660 CG2 VAL V 54 67.162 -67.552 18.947 1.00287.03 C ANISOU16660 CG2 VAL V 54 40614 36644 31798 3564 442 -379 C ATOM 16661 N ARG V 55 66.846 -68.427 23.547 1.00285.67 N ANISOU16661 N ARG V 55 41152 35459 31927 3089 345 35 N ATOM 16662 CA ARG V 55 66.734 -69.207 24.789 1.00271.14 C ANISOU16662 CA ARG V 55 39522 33335 30161 2878 78 135 C ATOM 16663 C ARG V 55 65.327 -69.120 25.298 1.00273.49 C ANISOU16663 C ARG V 55 39816 33589 30508 2667 241 568 C ATOM 16664 O ARG V 55 64.752 -70.122 25.700 1.00269.69 O ANISOU16664 O ARG V 55 39415 32940 30115 2505 -137 713 O ATOM 16665 CB ARG V 55 67.581 -68.639 25.917 1.00259.11 C ANISOU16665 CB ARG V 55 38163 31740 28544 2774 305 71 C ATOM 16666 CG ARG V 55 69.072 -68.694 25.748 1.00252.37 C ANISOU16666 CG ARG V 55 37337 30907 27643 2934 158 -327 C ATOM 16667 CD ARG V 55 69.703 -68.433 27.098 1.00248.72 C ANISOU16667 CD ARG V 55 37077 30319 27105 2733 258 -302 C ATOM 16668 NE ARG V 55 71.046 -67.910 26.952 1.00247.88 N ANISOU16668 NE ARG V 55 36961 30319 26902 2875 366 -613 N ATOM 16669 CZ ARG V 55 71.515 -66.863 27.618 1.00247.10 C ANISOU16669 CZ ARG V 55 36947 30288 26650 2772 793 -592 C ATOM 16670 NH1 ARG V 55 70.753 -66.234 28.506 1.00244.39 N ANISOU16670 NH1 ARG V 55 36705 29907 26243 2531 1169 -310 N ATOM 16671 NH2 ARG V 55 72.764 -66.470 27.403 1.00247.95 N ANISOU16671 NH2 ARG V 55 37031 30506 26671 2902 841 -875 N ATOM 16672 N GLN V 56 64.807 -67.895 25.332 1.00280.81 N ANISOU16672 N GLN V 56 40642 34657 31396 2660 810 773 N ATOM 16673 CA GLN V 56 63.460 -67.645 25.814 1.00292.19 C ANISOU16673 CA GLN V 56 42029 36085 32905 2481 1055 1168 C ATOM 16674 C GLN V 56 62.389 -68.293 24.922 1.00301.35 C ANISOU16674 C GLN V 56 43027 37301 34171 2503 790 1375 C ATOM 16675 O GLN V 56 61.501 -68.942 25.458 1.00307.23 O ANISOU16675 O GLN V 56 43809 37948 34974 2301 616 1622 O ATOM 16676 CB GLN V 56 63.208 -66.138 26.048 1.00290.64 C ANISOU16676 CB GLN V 56 41736 35987 32707 2500 1738 1298 C ATOM 16677 CG GLN V 56 61.873 -65.761 26.698 1.00299.21 C ANISOU16677 CG GLN V 56 42741 37054 33892 2321 2075 1659 C ATOM 16678 CD GLN V 56 61.691 -66.240 28.132 1.00311.76 C ANISOU16678 CD GLN V 56 44530 38517 35407 2005 2029 1725 C ATOM 16679 OE1 GLN V 56 62.659 -66.465 28.863 1.00331.05 O ANISOU16679 OE1 GLN V 56 47188 40877 37716 1901 1903 1518 O ATOM 16680 NE2 GLN V 56 60.442 -66.394 28.540 1.00310.94 N ANISOU16680 NE2 GLN V 56 44338 38424 35378 1825 2126 2033 N ATOM 16681 N ALA V 57 62.477 -68.150 23.591 1.00310.09 N ANISOU16681 N ALA V 57 43956 38584 35277 2709 741 1282 N ATOM 16682 CA ALA V 57 61.489 -68.771 22.682 1.00313.31 C ANISOU16682 CA ALA V 57 44211 39074 35758 2703 472 1472 C ATOM 16683 C ALA V 57 61.461 -70.276 22.846 1.00310.33 C ANISOU16683 C ALA V 57 43978 38506 35424 2600 -147 1374 C ATOM 16684 O ALA V 57 60.390 -70.850 23.026 1.00311.70 O ANISOU16684 O ALA V 57 44135 38619 35677 2431 -321 1671 O ATOM 16685 CB ALA V 57 61.756 -68.413 21.238 1.00318.26 C ANISOU16685 CB ALA V 57 44641 39959 36323 2895 487 1343 C ATOM 16686 N GLN V 58 62.643 -70.894 22.796 1.00299.42 N ANISOU16686 N GLN V 58 42726 37021 34016 2701 -481 964 N ATOM 16687 CA GLN V 58 62.809 -72.317 23.078 1.00290.46 C ANISOU16687 CA GLN V 58 41746 35628 32986 2618 -1098 831 C ATOM 16688 C GLN V 58 62.246 -72.699 24.436 1.00302.43 C ANISOU16688 C GLN V 58 43426 36929 34554 2328 -1182 1143 C ATOM 16689 O GLN V 58 61.525 -73.689 24.542 1.00298.24 O ANISOU16689 O GLN V 58 42939 36256 34121 2166 -1589 1318 O ATOM 16690 CB GLN V 58 64.284 -72.695 23.090 1.00275.82 C ANISOU16690 CB GLN V 58 39991 33664 31142 2778 -1347 356 C ATOM 16691 CG GLN V 58 64.895 -73.028 21.749 1.00267.59 C ANISOU16691 CG GLN V 58 38817 32764 30091 3020 -1555 -60 C ATOM 16692 CD GLN V 58 66.261 -73.641 21.915 1.00267.14 C ANISOU16692 CD GLN V 58 38848 32536 30118 3161 -1883 -524 C ATOM 16693 OE1 GLN V 58 67.176 -73.025 22.461 1.00263.61 O ANISOU16693 OE1 GLN V 58 38452 32103 29602 3212 -1655 -644 O ATOM 16694 NE2 GLN V 58 66.397 -74.873 21.474 1.00272.35 N ANISOU16694 NE2 GLN V 58 39518 33010 30949 3218 -2431 -787 N ATOM 16695 N ALA V 59 62.605 -71.922 25.468 1.00322.77 N ANISOU16695 N ALA V 59 46094 39498 37043 2235 -805 1200 N ATOM 16696 CA ALA V 59 62.262 -72.220 26.877 1.00345.77 C ANISOU16696 CA ALA V 59 49177 42256 39944 1910 -856 1450 C ATOM 16697 C ALA V 59 60.765 -72.210 27.128 1.00361.00 C ANISOU16697 C ALA V 59 51017 44256 41891 1691 -716 1886 C ATOM 16698 O ALA V 59 60.255 -73.044 27.885 1.00363.65 O ANISOU16698 O ALA V 59 51462 44459 42250 1405 -1038 2106 O ATOM 16699 CB ALA V 59 62.952 -71.259 27.842 1.00340.09 C ANISOU16699 CB ALA V 59 48557 41572 39087 1841 -413 1388 C ATOM 16700 N GLU V 60 60.066 -71.258 26.507 1.00376.36 N ATOM 16701 CA GLU V 60 58.598 -71.204 26.611 1.00383.12 C ATOM 16702 C GLU V 60 57.893 -71.905 25.427 1.00383.42 C ATOM 16703 O GLU V 60 56.650 -71.893 25.319 1.00397.19 O ATOM 16704 CB GLU V 60 58.049 -69.778 26.956 1.00376.97 C ATOM 16705 CG GLU V 60 58.052 -68.677 25.880 1.00360.58 C ATOM 16706 CD GLU V 60 57.569 -67.329 26.426 1.00349.55 C ATOM 16707 OE1 GLU V 60 56.461 -66.890 26.048 1.00350.04 O ATOM 16708 OE2 GLU V 60 58.290 -66.710 27.241 1.00338.96 O