SNSLLKYITDKSEEIAQASGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQASYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKSSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDFSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
Search OCA for entries with sequence similar to this one (with E=10)

ATOM 6211 N SER G 89 14.166 -51.871 -17.812 1.00262.69 N ANISOU 6211 N SER G 89 32777 36568 30461 154 -1480 -1872 N ATOM 6212 CA SER G 89 14.359 -52.907 -18.815 1.00265.21 C ANISOU 6212 CA SER G 89 32972 37129 30665 182 -1522 -1764 C ATOM 6213 C SER G 89 13.154 -52.902 -19.737 1.00272.42 C ANISOU 6213 C SER G 89 33576 38072 31857 342 -1596 -1956 C ATOM 6214 O SER G 89 12.025 -52.603 -19.303 1.00278.14 O ANISOU 6214 O SER G 89 34184 38647 32848 393 -1473 -2267 O ATOM 6215 CB SER G 89 14.511 -54.281 -18.175 1.00260.89 C ANISOU 6215 CB SER G 89 32519 36668 29937 51 -1219 -1854 C ATOM 6216 OG SER G 89 13.319 -54.645 -17.507 1.00260.51 O ANISOU 6216 OG SER G 89 32385 36517 30077 39 -940 -2223 O ATOM 6217 N ASN G 90 13.387 -53.236 -21.003 1.00276.37 N ANISOU 6217 N ASN G 90 33942 38764 32301 417 -1795 -1780 N ATOM 6218 CA ASN G 90 12.312 -53.209 -22.001 1.00282.35 C ANISOU 6218 CA ASN G 90 34410 39558 33311 574 -1910 -1929 C ATOM 6219 C ASN G 90 11.144 -54.221 -21.889 1.00293.74 C ANISOU 6219 C ASN G 90 35659 41035 34912 599 -1644 -2270 C ATOM 6220 O ASN G 90 10.018 -53.859 -22.251 1.00301.86 O ANISOU 6220 O ASN G 90 36468 41988 36238 727 -1695 -2494 O ATOM 6221 CB ASN G 90 12.872 -53.122 -23.419 1.00272.06 C ANISOU 6221 CB ASN G 90 33028 38432 31908 643 -2226 -1639 C ATOM 6222 CG ASN G 90 13.370 -51.738 -23.738 1.00266.10 C ANISOU 6222 CG ASN G 90 32357 37574 31173 683 -2544 -1419 C ATOM 6223 OD1 ASN G 90 14.248 -51.211 -23.051 1.00261.08 O ANISOU 6223 OD1 ASN G 90 31948 36861 30387 589 -2554 -1262 O ATOM 6224 ND2 ASN G 90 12.794 -51.122 -24.759 1.00265.55 N ANISOU 6224 ND2 ASN G 90 32115 37490 31291 821 -2811 -1411 N ATOM 6225 N SER G 91 11.393 -55.453 -21.394 1.00297.45 N ANISOU 6225 N SER G 91 36210 41611 35195 479 -1374 -2317 N ATOM 6226 CA SER G 91 10.318 -56.479 -21.179 1.00296.46 C ANISOU 6226 CA SER G 91 35928 41516 35196 476 -1090 -2647 C ATOM 6227 C SER G 91 9.351 -56.083 -20.064 1.00302.88 C ANISOU 6227 C SER G 91 36737 42111 36232 448 -858 -2995 C ATOM 6228 O SER G 91 8.182 -56.470 -20.093 1.00300.32 O ANISOU 6228 O SER G 91 36207 41769 36128 498 -704 -3308 O ATOM 6229 CB SER G 91 10.863 -57.901 -20.935 1.00286.76 C ANISOU 6229 CB SER G 91 34807 40448 33700 347 -875 -2598 C ATOM 6230 OG SER G 91 11.435 -58.019 -19.648 1.00282.33 O ANISOU 6230 OG SER G 91 34520 39784 32967 183 -673 -2596 O ATOM 6231 N LEU G 92 9.859 -55.299 -19.109 1.00311.54 N ANISOU 6231 N LEU G 92 38056 43044 37269 366 -836 -2941 N ATOM 6232 CA LEU G 92 9.068 -54.649 -18.059 1.00316.92 C ANISOU 6232 CA LEU G 92 38753 43499 38163 340 -660 -3241 C ATOM 6233 C LEU G 92 8.080 -53.583 -18.601 1.00321.23 C ANISOU 6233 C LEU G 92 39053 43922 39075 523 -856 -3406 C ATOM 6234 O LEU G 92 6.900 -53.593 -18.226 1.00325.89 O ANISOU 6234 O LEU G 92 39479 44412 39930 554 -675 -3773 O ATOM 6235 CB LEU G 92 10.007 -54.021 -17.023 1.00313.73 C ANISOU 6235 CB LEU G 92 38659 42963 37578 212 -638 -3090 C ATOM 6236 CG LEU G 92 9.792 -54.278 -15.532 1.00310.32 C ANISOU 6236 CG LEU G 92 38414 42389 37102 40 -284 -3322 C ATOM 6237 CD1 LEU G 92 10.557 -53.220 -14.752 1.00307.32 C ANISOU 6237 CD1 LEU G 92 38281 41846 36638 -24 -365 -3173 C ATOM 6238 CD2 LEU G 92 8.323 -54.276 -15.136 1.00311.40 C ANISOU 6238 CD2 LEU G 92 38351 42414 37550 69 -58 -3764 C ATOM 6239 N LEU G 93 8.562 -52.679 -19.468 1.00317.77 N ANISOU 6239 N LEU G 93 38594 43488 38653 635 -1223 -3144 N ATOM 6240 CA LEU G 93 7.735 -51.621 -20.106 1.00310.34 C ANISOU 6240 CA LEU G 93 37439 42427 38048 818 -1475 -3253 C ATOM 6241 C LEU G 93 6.568 -52.204 -20.913 1.00314.41 C ANISOU 6241 C LEU G 93 37637 43022 38802 944 -1463 -3493 C ATOM 6242 O LEU G 93 5.421 -51.737 -20.818 1.00314.61 O ANISOU 6242 O LEU G 93 37463 42906 39167 1047 -1446 -3808 O ATOM 6243 CB LEU G 93 8.613 -50.722 -21.006 1.00297.64 C ANISOU 6243 CB LEU G 93 35899 40843 36346 890 -1884 -2876 C ATOM 6244 CG LEU G 93 8.067 -50.141 -22.324 1.00288.84 C ANISOU 6244 CG LEU G 93 34556 39737 35451 1079 -2235 -2838 C ATOM 6245 CD1 LEU G 93 7.319 -48.833 -22.105 1.00288.54 C ANISOU 6245 CD1 LEU G 93 34437 39448 35745 1196 -2388 -3016 C ATOM 6246 CD2 LEU G 93 9.184 -49.964 -23.348 1.00281.72 C ANISOU 6246 CD2 LEU G 93 33752 38985 34303 1079 -2547 -2412 C ATOM 6247 N LYS G 94 6.903 -53.227 -21.697 1.00318.88 N ANISOU 6247 N LYS G 94 38158 43813 39186 933 -1474 -3343 N ATOM 6248 CA LYS G 94 5.988 -53.977 -22.559 1.00324.92 C ANISOU 6248 CA LYS G 94 38646 44699 40108 1035 -1464 -3514 C ATOM 6249 C LYS G 94 4.902 -54.635 -21.712 1.00332.19 C ANISOU 6249 C LYS G 94 39456 45559 41201 986 -1089 -3937 C ATOM 6250 O LYS G 94 3.713 -54.459 -21.969 1.00339.85 O ANISOU 6250 O LYS G 94 40170 46459 42498 1105 -1091 -4233 O ATOM 6251 CB LYS G 94 6.769 -55.032 -23.375 1.00319.30 C ANISOU 6251 CB LYS G 94 37966 44248 39105 992 -1505 -3248 C ATOM 6252 CG LYS G 94 6.853 -54.777 -24.898 1.00311.97 C ANISOU 6252 CG LYS G 94 36888 43438 38206 1132 -1874 -3036 C ATOM 6253 CD LYS G 94 8.131 -55.337 -25.535 1.00302.75 C ANISOU 6253 CD LYS G 94 35858 42489 36680 1057 -1981 -2660 C ATOM 6254 CE LYS G 94 8.215 -55.100 -27.047 1.00295.50 C ANISOU 6254 CE LYS G 94 34805 41695 35774 1174 -2334 -2455 C ATOM 6255 NZ LYS G 94 7.784 -56.267 -27.875 1.00289.87 N ANISOU 6255 NZ LYS G 94 33902 41182 35050 1211 -2273 -2523 N ATOM 6256 N TYR G 95 5.340 -55.350 -20.677 1.00333.28 N ANISOU 6256 N TYR G 95 39799 45713 41117 803 -775 -3965 N ATOM 6257 CA TYR G 95 4.489 -56.032 -19.693 1.00334.17 C ANISOU 6257 CA TYR G 95 39880 45768 41321 701 -377 -4343 C ATOM 6258 C TYR G 95 3.400 -55.134 -19.111 1.00344.72 C ANISOU 6258 C TYR G 95 41079 46883 43015 761 -308 -4700 C ATOM 6259 O TYR G 95 2.202 -55.464 -19.138 1.00344.13 O ANISOU 6259 O TYR G 95 40763 46789 43201 811 -154 -5056 O ATOM 6260 CB TYR G 95 5.372 -56.530 -18.530 1.00323.34 C ANISOU 6260 CB TYR G 95 38836 44387 39631 481 -125 -4249 C ATOM 6261 CG TYR G 95 4.853 -57.770 -17.828 1.00315.46 C ANISOU 6261 CG TYR G 95 37853 43434 38572 337 269 -4511 C ATOM 6262 CD1 TYR G 95 3.557 -57.797 -17.277 1.00315.60 C ANISOU 6262 CD1 TYR G 95 37706 43341 38866 328 521 -4947 C ATOM 6263 CD2 TYR G 95 5.655 -58.935 -17.720 1.00309.01 C ANISOU 6263 CD2 TYR G 95 37216 42770 37422 203 390 -4332 C ATOM 6264 CE1 TYR G 95 3.071 -58.945 -16.644 1.00312.79 C ANISOU 6264 CE1 TYR G 95 37373 43028 38443 179 888 -5190 C ATOM 6265 CE2 TYR G 95 5.172 -60.084 -17.090 1.00306.70 C ANISOU 6265 CE2 TYR G 95 36952 42511 37067 63 741 -4568 C ATOM 6266 CZ TYR G 95 3.881 -60.088 -16.549 1.00309.00 C ANISOU 6266 CZ TYR G 95 37089 42693 37621 44 994 -4993 C ATOM 6267 OH TYR G 95 3.383 -61.220 -15.916 1.00306.57 O ANISOU 6267 OH TYR G 95 36820 42417 37246 -111 1350 -5234 O ATOM 6268 N ILE G 96 3.855 -53.997 -18.585 1.00355.91 N ANISOU 6268 N ILE G 96 42652 48135 44442 754 -425 -4604 N ATOM 6269 CA ILE G 96 3.039 -53.031 -17.839 1.00368.75 C ANISOU 6269 CA ILE G 96 44208 49528 46370 786 -355 -4915 C ATOM 6270 C ILE G 96 1.896 -52.383 -18.673 1.00386.14 C ANISOU 6270 C ILE G 96 46067 51657 48989 1009 -571 -5135 C ATOM 6271 O ILE G 96 0.745 -52.358 -18.215 1.00396.15 O ANISOU 6271 O ILE G 96 47148 52821 50549 1029 -372 -5549 O ATOM 6272 CB ILE G 96 3.960 -52.005 -17.081 1.00360.94 C ANISOU 6272 CB ILE G 96 43502 48390 45249 714 -442 -4715 C ATOM 6273 CG1 ILE G 96 4.644 -52.651 -15.856 1.00351.73 C ANISOU 6273 CG1 ILE G 96 42643 47227 43771 474 -115 -4684 C ATOM 6274 CG2 ILE G 96 3.243 -50.711 -16.691 1.00365.32 C ANISOU 6274 CG2 ILE G 96 43957 48704 46143 810 -521 -4951 C ATOM 6275 CD1 ILE G 96 3.725 -53.272 -14.816 1.00349.66 C ANISOU 6275 CD1 ILE G 96 42351 46899 43603 342 312 -5104 C ATOM 6276 N THR G 97 2.196 -51.898 -19.885 1.00395.06 N ANISOU 6276 N THR G 97 47116 52841 50146 1166 -971 -4871 N ATOM 6277 CA THR G 97 1.201 -51.176 -20.722 1.00401.01 C ANISOU 6277 CA THR G 97 47572 53504 51289 1384 -1238 -5040 C ATOM 6278 C THR G 97 -0.059 -51.989 -21.068 1.00403.07 C ANISOU 6278 C THR G 97 47521 53830 51796 1453 -1078 -5399 C ATOM 6279 O THR G 97 -1.163 -51.449 -21.065 1.00406.45 O ANISOU 6279 O THR G 97 47710 54114 52607 1576 -1108 -5731 O ATOM 6280 CB THR G 97 1.813 -50.617 -22.023 1.00399.25 C ANISOU 6280 CB THR G 97 47347 53345 51005 1517 -1701 -4662 C ATOM 6281 OG1 THR G 97 2.412 -51.684 -22.761 1.00394.68 O ANISOU 6281 OG1 THR G 97 46801 53015 50143 1469 -1705 -4418 O ATOM 6282 CG2 THR G 97 2.871 -49.560 -21.716 1.00399.91 C ANISOU 6282 CG2 THR G 97 47696 53321 50929 1477 -1900 -4358 C ATOM 6283 N ASP G 98 0.129 -53.281 -21.339 1.00402.53 N ANISOU 6283 N ASP G 98 47458 53974 51510 1370 -907 -5336 N ATOM 6284 CA ASP G 98 -0.953 -54.240 -21.651 1.00400.46 C ANISOU 6284 CA ASP G 98 46927 53804 51424 1407 -722 -5648 C ATOM 6285 C ASP G 98 -1.945 -54.398 -20.516 1.00386.76 C ANISOU 6285 C ASP G 98 45105 51944 49899 1323 -337 -6117 C ATOM 6286 O ASP G 98 -3.164 -54.247 -20.702 1.00387.56 O ANISOU 6286 O ASP G 98 44911 51972 50371 1439 -319 -6477 O ATOM 6287 CB ASP G 98 -0.374 -55.633 -21.947 1.00417.58 C ANISOU 6287 CB ASP G 98 49186 56217 53258 1293 -573 -5466 C ATOM 6288 CG ASP G 98 0.623 -55.629 -23.103 1.00431.74 C ANISOU 6288 CG ASP G 98 51054 58165 54821 1356 -920 -5016 C ATOM 6289 OD1 ASP G 98 0.691 -54.627 -23.845 1.00436.68 O ANISOU 6289 OD1 ASP G 98 51621 58721 55574 1502 -1288 -4869 O ATOM 6290 OD2 ASP G 98 1.337 -56.637 -23.286 1.00443.39 O ANISOU 6290 OD2 ASP G 98 52650 59831 55987 1255 -827 -4814 O ATOM 6291 N LYS G 99 -1.399 -54.734 -19.348 1.00366.70 N ANISOU 6291 N LYS G 99 42829 49385 47115 1112 -29 -6112 N ATOM 6292 CA LYS G 99 -2.172 -54.937 -18.130 1.00357.17 C ANISOU 6292 CA LYS G 99 41607 48067 46033 979 376 -6529 C ATOM 6293 C LYS G 99 -2.900 -53.656 -17.696 1.00374.33 C ANISOU 6293 C LYS G 99 43651 50000 48574 1076 310 -6807 C ATOM 6294 O LYS G 99 -3.924 -53.739 -17.039 1.00387.02 O ANISOU 6294 O LYS G 99 45106 51519 50425 1036 587 -7241 O ATOM 6295 CB LYS G 99 -1.286 -55.501 -17.007 1.00334.16 C ANISOU 6295 CB LYS G 99 39050 45174 42741 725 673 -6407 C ATOM 6296 CG LYS G 99 -1.334 -57.021 -16.890 1.00313.85 C ANISOU 6296 CG LYS G 99 36515 42777 39955 578 973 -6461 C ATOM 6297 CD LYS G 99 -0.377 -57.744 -17.834 1.00299.34 C ANISOU 6297 CD LYS G 99 34763 41152 37819 601 777 -6051 C ATOM 6298 CE LYS G 99 -0.478 -59.257 -17.694 1.00291.04 C ANISOU 6298 CE LYS G 99 33743 40261 36576 459 1074 -6127 C ATOM 6299 NZ LYS G 99 -1.681 -59.864 -18.344 1.00286.51 N ANISOU 6299 NZ LYS G 99 32832 39766 36261 555 1146 -6426 N ATOM 6300 N SER G 100 -2.377 -52.487 -18.090 1.00383.12 N ANISOU 6300 N SER G 100 44822 51012 49734 1202 -58 -6562 N ATOM 6301 CA SER G 100 -2.989 -51.173 -17.793 1.00389.53 C ANISOU 6301 CA SER G 100 45514 51585 50902 1319 -188 -6788 C ATOM 6302 C SER G 100 -4.286 -50.928 -18.560 1.00398.25 C ANISOU 6302 C SER G 100 46221 52639 52456 1531 -336 -7106 C ATOM 6303 O SER G 100 -5.217 -50.338 -18.016 1.00396.59 O ANISOU 6303 O SER G 100 45841 52254 52590 1577 -239 -7499 O ATOM 6304 CB SER G 100 -2.018 -50.011 -18.054 1.00385.34 C ANISOU 6304 CB SER G 100 45171 50962 50277 1390 -564 -6411 C ATOM 6305 OG SER G 100 -2.141 -49.508 -19.376 1.00384.75 O ANISOU 6305 OG SER G 100 44923 50902 50362 1609 -1001 -6249 O ATOM 6306 N GLU G 101 -4.330 -51.353 -19.824 1.00406.94 N ANISOU 6306 N GLU G 101 47176 53886 53556 1662 -584 -6938 N ATOM 6307 CA GLU G 101 -5.554 -51.271 -20.644 1.00413.94 C ANISOU 6307 CA GLU G 101 47682 54744 54850 1863 -734 -7226 C ATOM 6308 C GLU G 101 -6.629 -52.298 -20.195 1.00419.75 C ANISOU 6308 C GLU G 101 48208 55542 55734 1784 -319 -7675 C ATOM 6309 O GLU G 101 -7.847 -52.008 -20.204 1.00419.23 O ANISOU 6309 O GLU G 101 47835 55365 56087 1899 -294 -8094 O ATOM 6310 CB GLU G 101 -5.209 -51.424 -22.139 1.00411.36 C ANISOU 6310 CB GLU G 101 47291 54559 54446 2009 -1130 -6887 C ATOM 6311 CG GLU G 101 -4.550 -50.208 -22.789 1.00408.08 C ANISOU 6311 CG GLU G 101 46979 54041 54030 2140 -1606 -6547 C ATOM 6312 CD GLU G 101 -3.755 -50.553 -24.056 1.00403.93 C ANISOU 6312 CD GLU G 101 46527 53704 53243 2186 -1914 -6104 C ATOM 6313 OE1 GLU G 101 -4.108 -51.541 -24.741 1.00405.16 O ANISOU 6313 OE1 GLU G 101 46530 54034 53377 2207 -1865 -6140 O ATOM 6314 OE2 GLU G 101 -2.774 -49.837 -24.377 1.00399.29 O ANISOU 6314 OE2 GLU G 101 46148 53094 52469 2193 -2204 -5724 O ATOM 6315 N GLU G 102 -6.161 -53.483 -19.790 1.00424.02 N ANISOU 6315 N GLU G 102 48921 56254 55933 1585 0 -7590 N ATOM 6316 CA GLU G 102 -7.003 -54.556 -19.240 1.00427.26 C ANISOU 6316 CA GLU G 102 49204 56735 56399 1458 433 -7973 C ATOM 6317 C GLU G 102 -7.682 -54.158 -17.899 1.00430.48 C ANISOU 6317 C GLU G 102 49597 56962 57003 1341 777 -8408 C ATOM 6318 O GLU G 102 -8.888 -54.362 -17.720 1.00434.83 O ANISOU 6318 O GLU G 102 49869 57472 57874 1363 976 -8864 O ATOM 6319 CB GLU G 102 -6.152 -55.823 -19.088 1.00424.42 C ANISOU 6319 CB GLU G 102 49094 56582 55585 1263 651 -7718 C ATOM 6320 CG GLU G 102 -6.869 -57.039 -18.529 1.00428.30 C ANISOU 6320 CG GLU G 102 49510 57161 56062 1102 1098 -8055 C ATOM 6321 CD GLU G 102 -5.955 -57.884 -17.656 1.00425.87 C ANISOU 6321 CD GLU G 102 49561 56936 55311 840 1397 -7877 C ATOM 6322 OE1 GLU G 102 -6.308 -58.150 -16.485 1.00433.43 O ANISOU 6322 OE1 GLU G 102 50609 57822 56253 646 1785 -8165 O ATOM 6323 OE2 GLU G 102 -4.871 -58.290 -18.132 1.00414.87 O ANISOU 6323 OE2 GLU G 102 48368 55678 53583 819 1242 -7453 O ATOM 6324 N ILE G 103 -6.909 -53.591 -16.964 1.00425.78 N ANISOU 6324 N ILE G 103 49298 56261 56218 1212 851 -8274 N ATOM 6325 CA ILE G 103 -7.468 -53.088 -15.688 1.00412.19 C ANISOU 6325 CA ILE G 103 47587 54356 54670 1097 1154 -8663 C ATOM 6326 C ILE G 103 -8.067 -51.659 -15.814 1.00407.57 C ANISOU 6326 C ILE G 103 46795 53549 54513 1302 886 -8855 C ATOM 6327 O ILE G 103 -8.861 -51.264 -14.963 1.00405.88 O ANISOU 6327 O ILE G 103 46469 53188 54559 1256 1120 -9280 O ATOM 6328 CB ILE G 103 -6.497 -53.205 -14.462 1.00405.49 C ANISOU 6328 CB ILE G 103 47150 53481 53437 836 1417 -8504 C ATOM 6329 CG1 ILE G 103 -5.724 -54.539 -14.459 1.00399.78 C ANISOU 6329 CG1 ILE G 103 46660 52966 52270 659 1592 -8237 C ATOM 6330 CG2 ILE G 103 -7.281 -53.114 -13.161 1.00398.41 C ANISOU 6330 CG2 ILE G 103 46233 52448 52696 671 1837 -8982 C ATOM 6331 CD1 ILE G 103 -4.319 -54.480 -13.893 1.00393.78 C ANISOU 6331 CD1 ILE G 103 46321 52212 51085 505 1580 -7833 C ATOM 6332 N ALA G 104 -7.711 -50.893 -16.861 1.00398.32 N ANISOU 6332 N ALA G 104 45572 52349 53420 1521 400 -8560 N ATOM 6333 CA ALA G 104 -8.391 -49.599 -17.161 1.00392.66 C ANISOU 6333 CA ALA G 104 44623 51421 53147 1745 95 -8753 C ATOM 6334 C ALA G 104 -9.840 -49.831 -17.588 1.00395.09 C ANISOU 6334 C ALA G 104 44505 51712 53897 1884 137 -9217 C ATOM 6335 O ALA G 104 -10.687 -48.944 -17.470 1.00401.32 O ANISOU 6335 O ALA G 104 45061 52311 55109 2021 41 -9551 O ATOM 6336 CB ALA G 104 -7.649 -48.783 -18.218 1.00383.76 C ANISOU 6336 CB ALA G 104 43566 50271 51973 1929 -442 -8310 C ATOM 6337 N GLN G 105 -10.113 -51.035 -18.085 1.00392.80 N ANISOU 6337 N GLN G 105 44110 51622 53513 1848 276 -9240 N ATOM 6338 CA GLN G 105 -11.481 -51.485 -18.327 1.00394.07 C ANISOU 6338 CA GLN G 105 43885 51794 54049 1928 412 -9710 C ATOM 6339 C GLN G 105 -12.294 -51.667 -17.022 1.00396.69 C ANISOU 6339 C GLN G 105 44142 52042 54539 1753 910 -10233 C ATOM 6340 O GLN G 105 -13.527 -51.609 -17.050 1.00406.74 O ANISOU 6340 O GLN G 105 45065 53248 56228 1842 995 -10703 O ATOM 6341 CB GLN G 105 -11.489 -52.761 -19.176 1.00387.38 C ANISOU 6341 CB GLN G 105 42972 51189 53026 1919 440 -9576 C ATOM 6342 CG GLN G 105 -11.339 -52.510 -20.669 1.00381.79 C ANISOU 6342 CG GLN G 105 42144 50532 52384 2158 -65 -9277 C ATOM 6343 CD GLN G 105 -11.349 -53.791 -21.477 1.00377.45 C ANISOU 6343 CD GLN G 105 41530 50224 51657 2141 -19 -9158 C ATOM 6344 OE1 GLN G 105 -10.524 -54.687 -21.261 1.00375.52 O ANISOU 6344 OE1 GLN G 105 41538 50148 50993 1961 176 -8901 O ATOM 6345 NE2 GLN G 105 -12.283 -53.886 -22.423 1.00375.01 N ANISOU 6345 NE2 GLN G 105 40882 49930 51672 2331 -211 -9346 N ATOM 6346 N ALA G 106 -11.600 -51.892 -15.897 1.00387.92 N ANISOU 6346 N ALA G 106 43360 50935 53095 1500 1234 -10154 N ATOM 6347 CA ALA G 106 -12.218 -51.917 -14.558 1.00381.50 C ANISOU 6347 CA ALA G 106 42541 50023 52387 1305 1698 -10611 C ATOM 6348 C ALA G 106 -12.389 -50.507 -13.992 1.00377.97 C ANISOU 6348 C ALA G 106 42067 49327 52216 1384 1583 -10782 C ATOM 6349 O ALA G 106 -13.046 -49.659 -14.596 1.00375.53 O ANISOU 6349 O ALA G 106 41469 48890 52321 1629 1274 -10944 O ATOM 6350 CB ALA G 106 -11.409 -52.780 -13.595 1.00377.42 C ANISOU 6350 CB ALA G 106 42406 49608 51385 991 2083 -10452 C TER 6351 ALA G 106 ATOM 6352 N SER H 8 -3.467 -64.960 -10.303 1.00286.51 N ANISOU 6352 N SER H 8 33913 40638 34309 -4173 4704 -8619 N ATOM 6353 CA SER H 8 -2.443 -65.836 -9.683 1.00279.70 C ANISOU 6353 CA SER H 8 34315 38817 33138 -4759 5278 -7571 C ATOM 6354 C SER H 8 -1.417 -65.007 -8.877 1.00274.93 C ANISOU 6354 C SER H 8 34583 37595 32284 -4386 4820 -6269 C ATOM 6355 O SER H 8 -0.594 -64.327 -9.482 1.00265.07 O ANISOU 6355 O SER H 8 33384 36392 30939 -3586 3941 -5382 O ATOM 6356 CB SER H 8 -1.753 -66.636 -10.795 1.00272.90 C ANISOU 6356 CB SER H 8 33578 37944 32165 -4537 5064 -7069 C ATOM 6357 OG SER H 8 -1.048 -67.726 -10.250 1.00269.15 O ANISOU 6357 OG SER H 8 34218 36650 31395 -5167 5754 -6477 O ATOM 6358 N GLY H 9 -1.481 -65.036 -7.533 1.00281.12 N ANISOU 6358 N GLY H 9 36053 37807 32950 -4977 5441 -6228 N ATOM 6359 CA GLY H 9 -0.479 -64.334 -6.662 1.00284.02 C ANISOU 6359 CA GLY H 9 37287 37562 33065 -4662 5057 -5058 C ATOM 6360 C GLY H 9 -0.866 -63.209 -5.672 1.00294.67 C ANISOU 6360 C GLY H 9 38567 38903 34491 -4592 4940 -5167 C ATOM 6361 O GLY H 9 -1.656 -63.447 -4.755 1.00301.45 O ANISOU 6361 O GLY H 9 39541 39604 35391 -5309 5737 -5909 O ATOM 6362 N PHE H 10 -0.276 -62.005 -5.865 1.00296.89 N ANISOU 6362 N PHE H 10 38736 39307 34761 -3779 4008 -4434 N ATOM 6363 CA PHE H 10 -0.379 -60.749 -5.008 1.00298.58 C ANISOU 6363 CA PHE H 10 38977 39467 35000 -3525 3690 -4267 C ATOM 6364 C PHE H 10 -1.781 -60.161 -4.683 1.00299.54 C ANISOU 6364 C PHE H 10 38274 40133 35403 -3654 3864 -5476 C ATOM 6365 O PHE H 10 -2.534 -59.811 -5.596 1.00305.74 O ANISOU 6365 O PHE H 10 38109 41665 36391 -3206 3456 -6251 O ATOM 6366 CB PHE H 10 0.461 -59.600 -5.646 1.00297.48 C ANISOU 6366 CB PHE H 10 38797 39446 34786 -2605 2665 -3390 C ATOM 6367 CG PHE H 10 1.866 -59.432 -5.085 1.00296.34 C ANISOU 6367 CG PHE H 10 39549 38657 34388 -2501 2463 -2200 C ATOM 6368 CD1 PHE H 10 2.889 -60.341 -5.415 1.00296.22 C ANISOU 6368 CD1 PHE H 10 40044 38314 34189 -2562 2519 -1596 C ATOM 6369 CD2 PHE H 10 2.184 -58.325 -4.280 1.00292.38 C ANISOU 6369 CD2 PHE H 10 39313 37941 33836 -2274 2156 -1764 C ATOM 6370 CE1 PHE H 10 4.184 -60.173 -4.923 1.00289.87 C ANISOU 6370 CE1 PHE H 10 39932 37035 33169 -2384 2264 -692 C ATOM 6371 CE2 PHE H 10 3.478 -58.155 -3.778 1.00287.84 C ANISOU 6371 CE2 PHE H 10 39445 36866 33056 -2157 1948 -828 C ATOM 6372 CZ PHE H 10 4.472 -59.087 -4.094 1.00285.97 C ANISOU 6372 CZ PHE H 10 39641 36364 32650 -2198 1991 -346 C ATOM 6373 N ARG H 11 -2.098 -59.988 -3.396 1.00292.11 N ANISOU 6373 N ARG H 11 37703 38839 34445 -4166 4389 -5664 N ATOM 6374 CA ARG H 11 -3.375 -59.386 -3.014 1.00292.26 C ANISOU 6374 CA ARG H 11 36916 39388 34740 -4297 4554 -6852 C ATOM 6375 C ARG H 11 -3.243 -57.892 -2.966 1.00292.60 C ANISOU 6375 C ARG H 11 36754 39631 34786 -3441 3633 -6446 C ATOM 6376 O ARG H 11 -2.168 -57.341 -2.678 1.00283.35 O ANISOU 6376 O ARG H 11 36304 37962 33392 -3086 3190 -5236 O ATOM 6377 CB ARG H 11 -3.877 -59.894 -1.671 1.00291.15 C ANISOU 6377 CB ARG H 11 37275 38777 34570 -5323 5648 -7370 C ATOM 6378 CG ARG H 11 -4.293 -61.353 -1.681 1.00290.12 C ANISOU 6378 CG ARG H 11 37367 38452 34414 -6311 6762 -8094 C ATOM 6379 CD ARG H 11 -4.102 -61.989 -0.310 1.00288.66 C ANISOU 6379 CD ARG H 11 38493 37290 33893 -7215 7790 -7864 C ATOM 6380 NE ARG H 11 -2.860 -61.552 0.344 1.00278.95 N ANISOU 6380 NE ARG H 11 38351 35334 32300 -6728 7266 -6395 N ATOM 6381 CZ ARG H 11 -1.630 -61.970 0.039 1.00271.66 C ANISOU 6381 CZ ARG H 11 38202 33949 31066 -6322 6862 -5259 C ATOM 6382 NH1 ARG H 11 -1.430 -62.861 -0.921 1.00268.59 N ANISOU 6382 NH1 ARG H 11 37720 33676 30654 -6341 6920 -5283 N ATOM 6383 NH2 ARG H 11 -0.590 -61.484 0.703 1.00266.33 N ANISOU 6383 NH2 ARG H 11 38343 32737 30111 -5877 6382 -4170 N ATOM 6384 N LYS H 12 -4.372 -57.257 -3.243 1.00303.69 N ANISOU 6384 N LYS H 12 37162 41791 36434 -3112 3369 -7584 N ATOM 6385 CA LYS H 12 -4.473 -55.815 -3.383 1.00311.72 C ANISOU 6385 CA LYS H 12 37923 43100 37416 -2167 2438 -7445 C ATOM 6386 C LYS H 12 -4.007 -55.045 -2.127 1.00323.39 C ANISOU 6386 C LYS H 12 40105 43992 38775 -2291 2470 -6691 C ATOM 6387 O LYS H 12 -3.249 -54.067 -2.237 1.00332.56 O ANISOU 6387 O LYS H 12 41695 44923 39737 -1619 1751 -5731 O ATOM 6388 CB LYS H 12 -5.911 -55.425 -3.789 1.00306.63 C ANISOU 6388 CB LYS H 12 36058 43413 37033 -1798 2213 -9079 C ATOM 6389 CG LYS H 12 -6.351 -55.958 -5.153 1.00297.27 C ANISOU 6389 CG LYS H 12 34115 42903 35929 -1394 1927 -9850 C ATOM 6390 CD LYS H 12 -7.807 -55.654 -5.502 1.00299.25 C ANISOU 6390 CD LYS H 12 33061 44192 36446 -991 1693 -11703 C ATOM 6391 CE LYS H 12 -8.085 -54.164 -5.694 1.00299.31 C ANISOU 6391 CE LYS H 12 32921 44525 36274 269 584 -11782 C ATOM 6392 NZ LYS H 12 -7.236 -53.483 -6.718 1.00287.75 N ANISOU 6392 NZ LYS H 12 32128 42823 34381 1388 -430 -10621 N ATOM 6393 N GLU H 13 -4.451 -55.494 -0.946 1.00333.02 N ANISOU 6393 N GLU H 13 41503 44938 40089 -3187 3358 -7157 N ATOM 6394 CA GLU H 13 -4.167 -54.808 0.341 1.00328.31 C ANISOU 6394 CA GLU H 13 41529 43820 39390 -3353 3460 -6622 C ATOM 6395 C GLU H 13 -2.672 -54.812 0.714 1.00313.72 C ANISOU 6395 C GLU H 13 40815 41158 37226 -3271 3276 -5064 C ATOM 6396 O GLU H 13 -2.146 -53.785 1.204 1.00306.82 O ANISOU 6396 O GLU H 13 40287 40043 36246 -2862 2790 -4361 O ATOM 6397 CB GLU H 13 -5.048 -55.377 1.475 1.00341.45 C ANISOU 6397 CB GLU H 13 43198 45352 41184 -4392 4557 -7594 C ATOM 6398 CG GLU H 13 -4.865 -54.749 2.859 1.00348.09 C ANISOU 6398 CG GLU H 13 44699 45649 41908 -4623 4751 -7161 C ATOM 6399 CD GLU H 13 -4.360 -55.731 3.914 1.00354.28 C ANISOU 6399 CD GLU H 13 46702 45501 42406 -5519 5706 -6695 C ATOM 6400 OE1 GLU H 13 -5.046 -55.894 4.956 1.00364.69 O ANISOU 6400 OE1 GLU H 13 48233 46595 43737 -6282 6549 -7379 O ATOM 6401 OE2 GLU H 13 -3.293 -56.346 3.702 1.00349.14 O ANISOU 6401 OE2 GLU H 13 46855 44327 41473 -5434 5619 -5706 O ATOM 6402 N LEU H 14 -2.012 -55.957 0.460 1.00302.09 N ANISOU 6402 N LEU H 14 39867 39311 35603 -3628 3647 -4634 N ATOM 6403 CA LEU H 14 -0.558 -56.158 0.677 1.00283.27 C ANISOU 6403 CA LEU H 14 38455 36258 32916 -3491 3442 -3342 C ATOM 6404 C LEU H 14 0.214 -54.946 0.185 1.00273.03 C ANISOU 6404 C LEU H 14 37083 35077 31579 -2655 2482 -2552 C ATOM 6405 O LEU H 14 0.851 -54.215 0.958 1.00270.19 O ANISOU 6405 O LEU H 14 37208 34349 31102 -2506 2253 -1910 O ATOM 6406 CB LEU H 14 -0.038 -57.421 -0.056 1.00275.93 C ANISOU 6406 CB LEU H 14 37787 35186 31865 -3676 3677 -3136 C ATOM 6407 CG LEU H 14 1.442 -57.785 0.142 1.00266.45 C ANISOU 6407 CG LEU H 14 37523 33370 30345 -3505 3471 -2007 C ATOM 6408 CD1 LEU H 14 1.705 -58.085 1.606 1.00271.79 C ANISOU 6408 CD1 LEU H 14 39214 33311 30742 -3921 3982 -1777 C ATOM 6409 CD2 LEU H 14 1.831 -58.977 -0.712 1.00260.74 C ANISOU 6409 CD2 LEU H 14 36927 32616 29525 -3605 3635 -1928 C ATOM 6410 N VAL H 15 0.091 -54.738 -1.118 1.00265.55 N ANISOU 6410 N VAL H 15 35558 34633 30705 -2137 1977 -2693 N ATOM 6411 CA VAL H 15 0.737 -53.660 -1.818 1.00255.00 C ANISOU 6411 CA VAL H 15 34243 33381 29261 -1383 1169 -2057 C ATOM 6412 C VAL H 15 0.373 -52.257 -1.249 1.00250.33 C ANISOU 6412 C VAL H 15 33606 32839 28669 -1013 796 -2105 C ATOM 6413 O VAL H 15 1.266 -51.442 -1.008 1.00245.36 O ANISOU 6413 O VAL H 15 33466 31871 27885 -763 454 -1305 O ATOM 6414 CB VAL H 15 0.452 -53.783 -3.333 1.00255.76 C ANISOU 6414 CB VAL H 15 33818 33989 29370 -897 778 -2377 C ATOM 6415 CG1 VAL H 15 1.463 -52.975 -4.107 1.00253.38 C ANISOU 6415 CG1 VAL H 15 33893 33538 28841 -296 141 -1517 C ATOM 6416 CG2 VAL H 15 0.503 -55.244 -3.784 1.00251.55 C ANISOU 6416 CG2 VAL H 15 33201 33481 28893 -1361 1261 -2581 C ATOM 6417 N SER H 16 -0.917 -51.992 -1.006 1.00247.43 N ANISOU 6417 N SER H 16 32635 32902 28475 -1008 894 -3112 N ATOM 6418 CA SER H 16 -1.391 -50.669 -0.540 1.00237.10 C ANISOU 6418 CA SER H 16 31227 31707 27154 -568 490 -3290 C ATOM 6419 C SER H 16 -0.814 -50.273 0.812 1.00232.37 C ANISOU 6419 C SER H 16 31251 30534 26502 -932 722 -2661 C ATOM 6420 O SER H 16 -0.300 -49.162 0.972 1.00227.28 O ANISOU 6420 O SER H 16 30958 29685 25713 -507 253 -2069 O ATOM 6421 CB SER H 16 -2.921 -50.617 -0.481 1.00238.74 C ANISOU 6421 CB SER H 16 30552 32566 27592 -537 602 -4693 C ATOM 6422 OG SER H 16 -3.372 -49.347 -0.051 1.00232.59 O ANISOU 6422 OG SER H 16 29694 31907 26772 -31 155 -4891 O ATOM 6423 N ARG H 17 -0.918 -51.182 1.779 1.00234.62 N ANISOU 6423 N ARG H 17 31756 30526 26862 -1714 1473 -2833 N ATOM 6424 CA ARG H 17 -0.372 -50.966 3.113 1.00235.70 C ANISOU 6424 CA ARG H 17 32581 30076 26896 -2050 1726 -2283 C ATOM 6425 C ARG H 17 1.136 -50.811 3.036 1.00231.59 C ANISOU 6425 C ARG H 17 32721 29109 26163 -1814 1368 -1136 C ATOM 6426 O ARG H 17 1.741 -49.977 3.728 1.00231.42 O ANISOU 6426 O ARG H 17 33091 28786 26051 -1664 1128 -587 O ATOM 6427 CB ARG H 17 -0.699 -52.141 4.019 1.00241.91 C ANISOU 6427 CB ARG H 17 33721 30522 27670 -2901 2645 -2669 C ATOM 6428 CG ARG H 17 -2.040 -52.075 4.730 1.00257.80 C ANISOU 6428 CG ARG H 17 35306 32771 29875 -3369 3200 -3766 C ATOM 6429 CD ARG H 17 -2.073 -53.170 5.790 1.00270.86 C ANISOU 6429 CD ARG H 17 37747 33802 31364 -4271 4201 -3894 C ATOM 6430 NE ARG H 17 -3.331 -53.313 6.553 1.00289.68 N ANISOU 6430 NE ARG H 17 39851 36310 33905 -4974 5004 -5041 N ATOM 6431 CZ ARG H 17 -3.602 -52.716 7.719 1.00294.48 C ANISOU 6431 CZ ARG H 17 40746 36658 34484 -5193 5229 -5126 C ATOM 6432 NH1 ARG H 17 -2.714 -51.890 8.256 1.00295.89 N ANISOU 6432 NH1 ARG H 17 41466 36463 34493 -4711 4652 -4118 N ATOM 6433 NH2 ARG H 17 -4.768 -52.920 8.329 1.00298.93 N ANISOU 6433 NH2 ARG H 17 41000 37372 35206 -5917 6050 -6294 N ATOM 6434 N LEU H 18 1.732 -51.626 2.176 1.00231.80 N ANISOU 6434 N LEU H 18 32805 29140 26126 -1797 1349 -871 N ATOM 6435 CA LEU H 18 3.166 -51.624 2.005 1.00229.20 C ANISOU 6435 CA LEU H 18 32973 28485 25627 -1613 1055 28 C ATOM 6436 C LEU H 18 3.681 -50.277 1.528 1.00227.90 C ANISOU 6436 C LEU H 18 32769 28404 25416 -1077 433 471 C ATOM 6437 O LEU H 18 4.714 -49.808 1.986 1.00220.19 O ANISOU 6437 O LEU H 18 32206 27115 24341 -1028 266 1070 O ATOM 6438 CB LEU H 18 3.601 -52.739 1.058 1.00229.40 C ANISOU 6438 CB LEU H 18 32974 28576 25609 -1671 1142 113 C ATOM 6439 CG LEU H 18 3.703 -54.160 1.629 1.00232.39 C ANISOU 6439 CG LEU H 18 33831 28594 25869 -2186 1752 17 C ATOM 6440 CD1 LEU H 18 4.178 -55.101 0.535 1.00230.66 C ANISOU 6440 CD1 LEU H 18 33536 28494 25609 -2131 1719 137 C ATOM 6441 CD2 LEU H 18 4.607 -54.246 2.860 1.00232.43 C ANISOU 6441 CD2 LEU H 18 34667 28007 25639 -2267 1825 536 C ATOM 6442 N LEU H 19 2.942 -49.656 0.620 1.00237.46 N ANISOU 6442 N LEU H 19 33542 30021 26659 -659 108 99 N ATOM 6443 CA LEU H 19 3.292 -48.340 0.124 1.00249.95 C ANISOU 6443 CA LEU H 19 35294 31588 28088 -132 -417 456 C ATOM 6444 C LEU H 19 3.235 -47.272 1.197 1.00261.88 C ANISOU 6444 C LEU H 19 37046 32875 29580 -104 -495 585 C ATOM 6445 O LEU H 19 4.125 -46.424 1.273 1.00259.14 O ANISOU 6445 O LEU H 19 37121 32245 29093 19 -707 1161 O ATOM 6446 CB LEU H 19 2.335 -47.928 -0.974 1.00257.50 C ANISOU 6446 CB LEU H 19 35872 32984 28979 441 -785 -95 C ATOM 6447 CG LEU H 19 2.557 -48.566 -2.324 1.00260.72 C ANISOU 6447 CG LEU H 19 36162 33589 29310 631 -901 -83 C ATOM 6448 CD1 LEU H 19 1.354 -48.233 -3.186 1.00267.88 C ANISOU 6448 CD1 LEU H 19 36635 34994 30150 1270 -1283 -870 C ATOM 6449 CD2 LEU H 19 3.851 -48.033 -2.917 1.00262.21 C ANISOU 6449 CD2 LEU H 19 36938 33431 29257 770 -1106 735 C ATOM 6450 N HIS H 20 2.172 -47.290 2.001 1.00280.11 N ANISOU 6450 N HIS H 20 39069 35326 32034 -258 -283 -22 N ATOM 6451 CA HIS H 20 1.930 -46.225 2.989 1.00290.84 C ANISOU 6451 CA HIS H 20 40589 36531 33383 -183 -382 -4 C ATOM 6452 C HIS H 20 2.921 -46.251 4.154 1.00292.18 C ANISOU 6452 C HIS H 20 41282 36203 33530 -576 -161 608 C ATOM 6453 O HIS H 20 2.983 -45.316 4.960 1.00294.08 O ANISOU 6453 O HIS H 20 41740 36254 33742 -517 -270 773 O ATOM 6454 CB HIS H 20 0.481 -46.261 3.505 1.00292.79 C ANISOU 6454 CB HIS H 20 40309 37127 33810 -265 -182 -957 C ATOM 6455 CG HIS H 20 -0.500 -45.489 2.657 1.00289.06 C ANISOU 6455 CG HIS H 20 39388 37152 33290 443 -691 -1607 C ATOM 6456 ND1 HIS H 20 -0.851 -44.183 2.931 1.00285.71 N ANISOU 6456 ND1 HIS H 20 39082 36731 32741 949 -1113 -1675 N ATOM 6457 CD2 HIS H 20 -1.221 -45.850 1.566 1.00289.01 C ANISOU 6457 CD2 HIS H 20 38854 37656 33299 812 -890 -2285 C ATOM 6458 CE1 HIS H 20 -1.738 -43.772 2.041 1.00288.94 C ANISOU 6458 CE1 HIS H 20 39117 37615 33049 1670 -1591 -2371 C ATOM 6459 NE2 HIS H 20 -1.980 -44.764 1.202 1.00291.46 N ANISOU 6459 NE2 HIS H 20 39007 38272 33461 1612 -1480 -2774 N ATOM 6460 N LEU H 21 3.710 -47.321 4.216 1.00288.22 N ANISOU 6460 N LEU H 21 41002 35500 33009 -902 99 903 N ATOM 6461 CA LEU H 21 4.737 -47.472 5.247 1.00276.21 C ANISOU 6461 CA LEU H 21 40005 33539 31404 -1128 211 1398 C ATOM 6462 C LEU H 21 5.873 -46.435 5.143 1.00263.95 C ANISOU 6462 C LEU H 21 38674 31846 29769 -885 -176 1966 C ATOM 6463 O LEU H 21 6.292 -45.843 6.145 1.00255.78 O ANISOU 6463 O LEU H 21 37917 30560 28706 -932 -213 2177 O ATOM 6464 CB LEU H 21 5.325 -48.896 5.212 1.00275.78 C ANISOU 6464 CB LEU H 21 40196 33317 31268 -1378 490 1500 C ATOM 6465 CG LEU H 21 4.860 -50.021 6.154 1.00273.87 C ANISOU 6465 CG LEU H 21 40336 32782 30940 -1809 1060 1197 C ATOM 6466 CD1 LEU H 21 5.516 -51.335 5.734 1.00271.84 C ANISOU 6466 CD1 LEU H 21 40374 32382 30530 -1890 1211 1338 C ATOM 6467 CD2 LEU H 21 5.147 -49.732 7.623 1.00271.17 C ANISOU 6467 CD2 LEU H 21 40583 31992 30455 -1906 1162 1379 C ATOM 6468 N HIS H 22 6.352 -46.214 3.921 1.00255.68 N ANISOU 6468 N HIS H 22 37526 30950 28670 -668 -410 2152 N ATOM 6469 CA HIS H 22 7.528 -45.390 3.686 1.00249.46 C ANISOU 6469 CA HIS H 22 36977 30012 27791 -593 -615 2591 C ATOM 6470 C HIS H 22 7.179 -43.958 3.247 1.00247.43 C ANISOU 6470 C HIS H 22 36868 29734 27409 -300 -846 2631 C ATOM 6471 O HIS H 22 8.073 -43.129 3.078 1.00249.90 O ANISOU 6471 O HIS H 22 37480 29858 27611 -325 -906 2935 O ATOM 6472 CB HIS H 22 8.451 -46.058 2.652 1.00251.94 C ANISOU 6472 CB HIS H 22 37237 30416 28070 -626 -625 2763 C ATOM 6473 CG HIS H 22 8.804 -47.488 2.956 1.00252.51 C ANISOU 6473 CG HIS H 22 37271 30484 28187 -805 -452 2712 C ATOM 6474 ND1 HIS H 22 9.707 -47.845 3.938 1.00252.95 N ANISOU 6474 ND1 HIS H 22 37561 30337 28212 -896 -440 2834 N ATOM 6475 CD2 HIS H 22 8.413 -48.648 2.371 1.00251.62 C ANISOU 6475 CD2 HIS H 22 36997 30516 28089 -851 -305 2527 C ATOM 6476 CE1 HIS H 22 9.828 -49.160 3.966 1.00251.95 C ANISOU 6476 CE1 HIS H 22 37524 30178 28026 -945 -306 2750 C ATOM 6477 NE2 HIS H 22 9.054 -49.670 3.025 1.00250.90 N ANISOU 6477 NE2 HIS H 22 37147 30245 27937 -975 -181 2580 N ATOM 6478 N PHE H 23 5.892 -43.664 3.049 1.00244.27 N ANISOU 6478 N PHE H 23 36301 29520 26990 -10 -959 2246 N ATOM 6479 CA PHE H 23 5.484 -42.310 2.680 1.00245.54 C ANISOU 6479 CA PHE H 23 36748 29612 26931 416 -1248 2236 C ATOM 6480 C PHE H 23 5.859 -41.371 3.787 1.00247.87 C ANISOU 6480 C PHE H 23 37343 29611 27225 276 -1227 2472 C ATOM 6481 O PHE H 23 5.544 -41.620 4.947 1.00241.03 O ANISOU 6481 O PHE H 23 36303 28736 26539 60 -1089 2335 O ATOM 6482 CB PHE H 23 3.979 -42.181 2.454 1.00244.96 C ANISOU 6482 CB PHE H 23 36356 29871 26847 859 -1458 1608 C ATOM 6483 CG PHE H 23 3.506 -42.746 1.157 1.00249.54 C ANISOU 6483 CG PHE H 23 36698 30770 27344 1193 -1611 1289 C ATOM 6484 CD1 PHE H 23 4.302 -42.697 0.013 1.00249.88 C ANISOU 6484 CD1 PHE H 23 37117 30673 27153 1320 -1696 1673 C ATOM 6485 CD2 PHE H 23 2.238 -43.308 1.071 1.00256.55 C ANISOU 6485 CD2 PHE H 23 36968 32121 28386 1364 -1643 513 C ATOM 6486 CE1 PHE H 23 3.851 -43.230 -1.186 1.00256.06 C ANISOU 6486 CE1 PHE H 23 37709 31745 27836 1670 -1861 1373 C ATOM 6487 CE2 PHE H 23 1.779 -43.847 -0.119 1.00265.62 C ANISOU 6487 CE2 PHE H 23 37833 33619 29472 1705 -1812 129 C ATOM 6488 CZ PHE H 23 2.589 -43.807 -1.251 1.00265.03 C ANISOU 6488 CZ PHE H 23 38188 33371 29137 1896 -1953 603 C ATOM 6489 N LYS H 24 6.544 -40.299 3.423 1.00257.60 N ANISOU 6489 N LYS H 24 39094 30559 28222 359 -1307 2801 N ATOM 6490 CA LYS H 24 6.774 -39.218 4.368 1.00261.22 C ANISOU 6490 CA LYS H 24 39876 30736 28639 282 -1306 2963 C ATOM 6491 C LYS H 24 5.558 -38.283 4.399 1.00263.91 C ANISOU 6491 C LYS H 24 40391 31089 28794 812 -1594 2686 C ATOM 6492 O LYS H 24 5.210 -37.783 5.459 1.00268.13 O ANISOU 6492 O LYS H 24 40901 31556 29417 779 -1609 2614 O ATOM 6493 CB LYS H 24 8.131 -38.518 4.145 1.00260.77 C ANISOU 6493 CB LYS H 24 40290 30350 28440 -14 -1138 3338 C ATOM 6494 CG LYS H 24 9.346 -39.439 4.389 1.00254.16 C ANISOU 6494 CG LYS H 24 39125 29601 27840 -485 -922 3436 C ATOM 6495 CD LYS H 24 9.404 -40.042 5.802 1.00245.87 C ANISOU 6495 CD LYS H 24 37744 28620 27054 -658 -903 3361 C ATOM 6496 CE LYS H 24 9.864 -41.508 5.838 1.00236.06 C ANISOU 6496 CE LYS H 24 36161 27566 25963 -796 -835 3294 C ATOM 6497 NZ LYS H 24 11.247 -41.749 5.333 1.00229.03 N ANISOU 6497 NZ LYS H 24 35210 26723 25087 -1006 -766 3354 N ATOM 6498 N ASP H 25 4.884 -38.087 3.263 1.00262.30 N ANISOU 6498 N ASP H 25 40352 30995 28315 1366 -1864 2466 N ATOM 6499 CA ASP H 25 3.524 -37.511 3.287 1.00261.59 C ANISOU 6499 CA ASP H 25 40208 31099 28086 2019 -2243 1954 C ATOM 6500 C ASP H 25 2.444 -38.582 3.029 1.00263.45 C ANISOU 6500 C ASP H 25 39627 31911 28561 2189 -2325 1276 C ATOM 6501 O ASP H 25 2.438 -39.221 1.973 1.00262.62 O ANISOU 6501 O ASP H 25 39407 31989 28387 2347 -2386 1176 O ATOM 6502 CB ASP H 25 3.366 -36.320 2.311 1.00261.16 C ANISOU 6502 CB ASP H 25 41052 30740 27435 2735 -2600 2018 C ATOM 6503 CG ASP H 25 2.029 -35.567 2.500 1.00263.01 C ANISOU 6503 CG ASP H 25 41291 31163 27477 3538 -3093 1430 C ATOM 6504 OD1 ASP H 25 1.307 -35.883 3.471 1.00262.00 O ANISOU 6504 OD1 ASP H 25 40416 31395 27735 3395 -3068 989 O ATOM 6505 OD2 ASP H 25 1.702 -34.660 1.691 1.00265.11 O ANISOU 6505 OD2 ASP H 25 42366 31197 27166 4334 -3497 1358 O ATOM 6506 N ASP H 26 1.539 -38.769 3.996 1.00267.32 N ANISOU 6506 N ASP H 26 39556 32680 29331 2101 -2270 755 N ATOM 6507 CA ASP H 26 0.409 -39.727 3.880 1.00271.98 C ANISOU 6507 CA ASP H 26 39314 33845 30181 2139 -2225 -88 C ATOM 6508 C ASP H 26 -0.866 -39.116 3.300 1.00280.21 C ANISOU 6508 C ASP H 26 40125 35307 31032 3023 -2763 -922 C ATOM 6509 O ASP H 26 -1.922 -39.769 3.285 1.00279.85 O ANISOU 6509 O ASP H 26 39266 35830 31233 3066 -2728 -1848 O ATOM 6510 CB ASP H 26 0.038 -40.364 5.222 1.00275.05 C ANISOU 6510 CB ASP H 26 39227 34321 30958 1477 -1749 -389 C ATOM 6511 CG ASP H 26 1.131 -41.231 5.796 1.00272.23 C ANISOU 6511 CG ASP H 26 39064 33622 30747 737 -1271 226 C ATOM 6512 OD1 ASP H 26 1.894 -41.869 5.033 1.00262.96 O ANISOU 6512 OD1 ASP H 26 37998 32387 29525 633 -1219 587 O ATOM 6513 OD2 ASP H 26 1.220 -41.265 7.042 1.00279.84 O ANISOU 6513 OD2 ASP H 26 40107 34374 31843 313 -976 309 O ATOM 6514 N LYS H 27 -0.780 -37.864 2.850 1.00287.58 N ANISOU 6514 N LYS H 27 41807 35959 31500 3737 -3243 -688 N ATOM 6515 CA LYS H 27 -1.852 -37.269 2.048 1.00301.04 C ANISOU 6515 CA LYS H 27 43518 38006 32857 4829 -3909 -1449 C ATOM 6516 C LYS H 27 -1.854 -37.927 0.665 1.00315.91 C ANISOU 6516 C LYS H 27 45360 40103 34566 5195 -4098 -1606 C ATOM 6517 O LYS H 27 -2.883 -37.928 -0.032 1.00318.66 O ANISOU 6517 O LYS H 27 45348 40964 34763 6039 -4612 -2509 O ATOM 6518 CB LYS H 27 -1.675 -35.752 1.934 1.00295.88 C ANISOU 6518 CB LYS H 27 43967 36836 31618 5531 -4343 -1076 C ATOM 6519 CG LYS H 27 -1.769 -35.020 3.262 1.00289.88 C ANISOU 6519 CG LYS H 27 43235 35899 31006 5270 -4226 -993 C ATOM 6520 CD LYS H 27 -1.254 -33.607 3.112 1.00291.26 C ANISOU 6520 CD LYS H 27 44700 35387 30577 5733 -4476 -393 C ATOM 6521 CE LYS H 27 -0.524 -33.177 4.365 1.00288.54 C ANISOU 6521 CE LYS H 27 44539 34631 30462 4951 -4033 217 C ATOM 6522 NZ LYS H 27 0.267 -31.961 4.052 1.00295.81 N ANISOU 6522 NZ LYS H 27 46802 34793 30799 5150 -4072 899 N ATOM 6523 N THR H 28 -0.681 -38.482 0.308 1.00331.14 N ANISOU 6523 N THR H 28 47622 41670 36525 4579 -3699 -787 N ATOM 6524 CA THR H 28 -0.464 -39.350 -0.860 1.00346.13 C ANISOU 6524 CA THR H 28 49406 43734 38372 4635 -3696 -794 C ATOM 6525 C THR H 28 -1.505 -40.469 -0.916 1.00349.69 C ANISOU 6525 C THR H 28 48684 44941 39239 4584 -3649 -1787 C ATOM 6526 O THR H 28 -1.587 -41.312 -0.015 1.00357.26 O ANISOU 6526 O THR H 28 48976 46072 40694 3766 -3117 -1951 O ATOM 6527 CB THR H 28 0.968 -39.970 -0.878 1.00341.88 C ANISOU 6527 CB THR H 28 49133 42787 37977 3753 -3146 124 C ATOM 6528 OG1 THR H 28 1.943 -38.973 -0.554 1.00343.66 O ANISOU 6528 OG1 THR H 28 50251 42376 37945 3569 -3033 884 O ATOM 6529 CG2 THR H 28 1.309 -40.518 -2.241 1.00339.35 C ANISOU 6529 CG2 THR H 28 48992 42500 37445 3960 -3225 237 C ATOM 6530 N LYS H 29 -2.307 -40.449 -1.979 1.00342.09 N ANISOU 6530 N LYS H 29 47558 44398 38020 5481 -4190 -2509 N ATOM 6531 CA LYS H 29 -3.334 -41.459 -2.209 1.00330.26 C ANISOU 6531 CA LYS H 29 44906 43688 36887 5494 -4168 -3627 C ATOM 6532 C LYS H 29 -2.931 -42.367 -3.380 1.00332.03 C ANISOU 6532 C LYS H 29 45103 43994 37057 5468 -4119 -3467 C ATOM 6533 O LYS H 29 -2.039 -42.040 -4.174 1.00329.54 O ANISOU 6533 O LYS H 29 45704 43179 36324 5692 -4257 -2639 O ATOM 6534 CB LYS H 29 -4.711 -40.799 -2.439 1.00321.05 C ANISOU 6534 CB LYS H 29 43321 43125 35539 6610 -4886 -4883 C ATOM 6535 CG LYS H 29 -5.372 -40.200 -1.200 1.00307.33 C ANISOU 6535 CG LYS H 29 41210 41540 34018 6515 -4846 -5388 C ATOM 6536 CD LYS H 29 -6.253 -41.227 -0.506 1.00299.99 C ANISOU 6536 CD LYS H 29 38933 41299 33748 5767 -4298 -6492 C ATOM 6537 CE LYS H 29 -6.700 -40.760 0.870 1.00292.75 C ANISOU 6537 CE LYS H 29 37734 40402 33095 5371 -4033 -6809 C ATOM 6538 NZ LYS H 29 -7.389 -41.852 1.616 1.00290.22 N ANISOU 6538 NZ LYS H 29 36317 40570 33383 4370 -3247 -7760 N ATOM 6539 N VAL H 30 -3.576 -43.524 -3.460 1.00334.91 N ANISOU 6539 N VAL H 30 44435 44966 37848 5108 -3840 -4292 N ATOM 6540 CA VAL H 30 -3.306 -44.476 -4.531 1.00333.49 C ANISOU 6540 CA VAL H 30 44104 44938 37666 5059 -3775 -4258 C ATOM 6541 C VAL H 30 -4.628 -44.837 -5.238 1.00355.00 C ANISOU 6541 C VAL H 30 45886 48537 40458 5755 -4187 -5719 C ATOM 6542 O VAL H 30 -5.581 -45.295 -4.587 1.00364.69 O ANISOU 6542 O VAL H 30 46092 50343 42128 5399 -3902 -6805 O ATOM 6543 CB VAL H 30 -2.575 -45.754 -4.016 1.00315.09 C ANISOU 6543 CB VAL H 30 41519 42422 35777 3807 -2922 -3751 C ATOM 6544 CG1 VAL H 30 -1.997 -46.535 -5.186 1.00303.24 C ANISOU 6544 CG1 VAL H 30 40142 40905 34171 3814 -2912 -3413 C ATOM 6545 CG2 VAL H 30 -1.470 -45.426 -3.012 1.00303.72 C ANISOU 6545 CG2 VAL H 30 40755 40285 34360 3140 -2536 -2649 C ATOM 6546 N SER H 31 -4.685 -44.608 -6.554 1.00369.67 N ANISOU 6546 N SER H 31 48111 50488 41856 6741 -4831 -5824 N ATOM 6547 CA SER H 31 -5.837 -45.032 -7.362 1.00389.49 C ANISOU 6547 CA SER H 31 49715 53870 44404 7485 -5289 -7248 C ATOM 6548 C SER H 31 -5.903 -46.574 -7.499 1.00403.45 C ANISOU 6548 C SER H 31 50534 56039 46716 6533 -4604 -7642 C ATOM 6549 O SER H 31 -4.868 -47.261 -7.443 1.00403.66 O ANISOU 6549 O SER H 31 50941 55563 46867 5647 -4010 -6593 O ATOM 6550 CB SER H 31 -5.847 -44.326 -8.729 1.00386.92 C ANISOU 6550 CB SER H 31 50240 53446 43325 8915 -6217 -7217 C ATOM 6551 OG SER H 31 -4.776 -44.753 -9.552 1.00376.57 O ANISOU 6551 OG SER H 31 49669 51612 41796 8632 -6002 -6149 O ATOM 6552 N GLY H 32 -7.118 -47.112 -7.651 1.00423.38 N ANISOU 6552 N GLY H 32 51828 59480 49558 6711 -4669 -9233 N ATOM 6553 CA GLY H 32 -7.355 -48.571 -7.663 1.00430.22 C ANISOU 6553 CA GLY H 32 51746 60759 50960 5713 -3904 -9839 C ATOM 6554 C GLY H 32 -6.742 -49.337 -8.830 1.00429.97 C ANISOU 6554 C GLY H 32 51964 60621 50782 5757 -3929 -9327 C ATOM 6555 O GLY H 32 -6.304 -50.487 -8.667 1.00412.31 O ANISOU 6555 O GLY H 32 49537 58239 48880 4679 -3135 -9009 O ATOM 6556 N ASP H 33 -6.731 -48.699 -10.001 1.00444.21 N ANISOU 6556 N ASP H 33 54280 62465 52033 7042 -4842 -9281 N ATOM 6557 CA ASP H 33 -6.054 -49.222 -11.190 1.00440.92 C ANISOU 6557 CA ASP H 33 54324 61843 51360 7225 -4959 -8653 C ATOM 6558 C ASP H 33 -4.534 -49.227 -11.024 1.00426.57 C ANISOU 6558 C ASP H 33 53627 59048 49401 6503 -4505 -6862 C ATOM 6559 O ASP H 33 -3.922 -50.238 -11.329 1.00423.91 O ANISOU 6559 O ASP H 33 53220 58586 49259 5797 -4012 -6403 O ATOM 6560 CB ASP H 33 -6.479 -48.488 -12.480 1.00450.89 C ANISOU 6560 CB ASP H 33 56013 63340 51965 8871 -6063 -9130 C ATOM 6561 CG ASP H 33 -7.833 -48.962 -13.037 1.00458.38 C ANISOU 6561 CG ASP H 33 55642 65415 53106 9556 -6495 -11030 C ATOM 6562 OD1 ASP H 33 -8.460 -49.876 -12.447 1.00456.48 O ANISOU 6562 OD1 ASP H 33 54108 65786 53545 8633 -5837 -12031 O ATOM 6563 OD2 ASP H 33 -8.282 -48.391 -14.059 1.00463.46 O ANISOU 6563 OD2 ASP H 33 56595 66320 53176 11051 -7489 -11605 O ATOM 6564 N ALA H 34 -3.936 -48.127 -10.539 1.00414.02 N ANISOU 6564 N ALA H 34 53013 56808 47485 6668 -4659 -5956 N ATOM 6565 CA ALA H 34 -2.496 -48.104 -10.203 1.00391.15 C ANISOU 6565 CA ALA H 34 51013 53069 44538 5876 -4161 -4446 C ATOM 6566 C ALA H 34 -2.115 -49.169 -9.155 1.00377.51 C ANISOU 6566 C ALA H 34 48751 51274 43410 4525 -3261 -4205 C ATOM 6567 O ALA H 34 -0.984 -49.661 -9.181 1.00360.16 O ANISOU 6567 O ALA H 34 46992 48610 41242 3894 -2858 -3241 O ATOM 6568 CB ALA H 34 -2.041 -46.714 -9.761 1.00384.84 C ANISOU 6568 CB ALA H 34 51241 51653 43327 6226 -4420 -3731 C ATOM 6569 N LEU H 35 -3.058 -49.521 -8.260 1.00380.84 N ANISOU 6569 N LEU H 35 48298 52146 44256 4122 -2946 -5147 N ATOM 6570 CA LEU H 35 -2.905 -50.634 -7.272 1.00382.03 C ANISOU 6570 CA LEU H 35 48050 52214 44889 2878 -2032 -5128 C ATOM 6571 C LEU H 35 -2.924 -52.035 -7.918 1.00381.22 C ANISOU 6571 C LEU H 35 47474 52375 44998 2412 -1624 -5444 C ATOM 6572 O LEU H 35 -2.064 -52.888 -7.630 1.00379.98 O ANISOU 6572 O LEU H 35 47638 51790 44944 1622 -1055 -4716 O ATOM 6573 CB LEU H 35 -3.960 -50.548 -6.149 1.00394.03 C ANISOU 6573 CB LEU H 35 48895 54080 46738 2532 -1717 -6131 C ATOM 6574 CG LEU H 35 -3.812 -51.496 -4.952 1.00399.37 C ANISOU 6574 CG LEU H 35 49494 54478 47768 1272 -726 -6061 C ATOM 6575 CD1 LEU H 35 -2.502 -51.260 -4.213 1.00396.62 C ANISOU 6575 CD1 LEU H 35 50122 53298 47274 871 -535 -4639 C ATOM 6576 CD2 LEU H 35 -4.985 -51.359 -3.997 1.00406.05 C ANISOU 6576 CD2 LEU H 35 49655 55721 48904 962 -392 -7243 C ATOM 6577 N GLN H 36 -3.914 -52.259 -8.782 1.00382.63 N ANISOU 6577 N GLN H 36 46898 53269 45213 2966 -1953 -6595 N ATOM 6578 CA GLN H 36 -3.968 -53.418 -9.678 0.50385.73 C ANISOU 6578 CA GLN H 36 46864 53968 45727 2766 -1745 -6942 C ATOM 6579 C GLN H 36 -2.695 -53.603 -10.525 1.00391.92 C ANISOU 6579 C GLN H 36 48460 54237 46215 2868 -1891 -5675 C ATOM 6580 O GLN H 36 -2.280 -54.735 -10.814 1.00396.63 O ANISOU 6580 O GLN H 36 48968 54771 46960 2275 -1428 -5476 O ATOM 6581 CB GLN H 36 -5.168 -53.256 -10.597 0.50381.75 C ANISOU 6581 CB GLN H 36 45524 54333 45191 3696 -2359 -8361 C ATOM 6582 CG GLN H 36 -6.458 -53.742 -9.983 0.50379.05 C ANISOU 6582 CG GLN H 36 43992 54711 45316 3230 -1905 -9988 C ATOM 6583 CD GLN H 36 -6.519 -55.247 -10.005 0.50378.13 C ANISOU 6583 CD GLN H 36 43388 54716 45566 2151 -999 -10381 C ATOM 6584 OE1 GLN H 36 -6.885 -55.879 -9.020 0.50379.17 O ANISOU 6584 OE1 GLN H 36 43198 54822 46043 1081 -92 -10889 O ATOM 6585 NE2 GLN H 36 -6.124 -55.833 -11.127 0.50374.53 N ANISOU 6585 NE2 GLN H 36 43010 54312 44983 2399 -1192 -10105 N ATOM 6586 N LEU H 37 -2.084 -52.474 -10.901 1.00398.23 N ANISOU 6586 N LEU H 37 50092 54642 46573 3587 -2485 -4875 N ATOM 6587 CA LEU H 37 -0.847 -52.423 -11.708 1.00393.61 C ANISOU 6587 CA LEU H 37 50356 53539 45657 3694 -2609 -3731 C ATOM 6588 C LEU H 37 0.463 -52.720 -10.932 1.00375.18 C ANISOU 6588 C LEU H 37 48563 50551 43436 2789 -2042 -2588 C ATOM 6589 O LEU H 37 1.383 -53.352 -11.470 1.00375.85 O ANISOU 6589 O LEU H 37 48916 50407 43481 2498 -1856 -1968 O ATOM 6590 CB LEU H 37 -0.763 -51.080 -12.470 1.00405.84 C ANISOU 6590 CB LEU H 37 52717 54872 46609 4788 -3372 -3463 C ATOM 6591 CG LEU H 37 -1.777 -50.873 -13.612 1.00417.02 C ANISOU 6591 CG LEU H 37 53873 56850 47723 5942 -4098 -4449 C ATOM 6592 CD1 LEU H 37 -1.515 -49.589 -14.389 1.00421.43 C ANISOU 6592 CD1 LEU H 37 55628 56968 47527 7024 -4788 -4005 C ATOM 6593 CD2 LEU H 37 -1.853 -52.078 -14.538 1.00416.08 C ANISOU 6593 CD2 LEU H 37 53205 57119 47765 5806 -3969 -4804 C ATOM 6594 N MET H 38 0.537 -52.269 -9.679 1.00351.71 N ANISOU 6594 N MET H 38 45721 47320 40592 2406 -1810 -2391 N ATOM 6595 CA MET H 38 1.658 -52.584 -8.785 1.00322.24 C ANISOU 6595 CA MET H 38 42413 43047 36973 1629 -1323 -1518 C ATOM 6596 C MET H 38 1.689 -54.055 -8.386 1.00304.87 C ANISOU 6596 C MET H 38 39862 40894 35079 844 -690 -1702 C ATOM 6597 O MET H 38 2.765 -54.604 -8.119 1.00292.70 O ANISOU 6597 O MET H 38 38719 38956 33534 394 -407 -993 O ATOM 6598 CB MET H 38 1.589 -51.713 -7.534 1.00320.53 C ANISOU 6598 CB MET H 38 42414 42579 36791 1503 -1278 -1385 C ATOM 6599 CG MET H 38 2.151 -50.328 -7.737 1.00316.64 C ANISOU 6599 CG MET H 38 42635 41735 35939 2023 -1720 -782 C ATOM 6600 SD MET H 38 3.852 -50.552 -8.252 1.00305.83 S ANISOU 6600 SD MET H 38 41905 39880 34416 1691 -1559 272 S ATOM 6601 CE MET H 38 4.560 -51.215 -6.745 1.00305.54 C ANISOU 6601 CE MET H 38 41832 39559 34697 827 -1016 628 C ATOM 6602 N VAL H 39 0.496 -54.663 -8.327 1.00295.65 N ANISOU 6602 N VAL H 39 37985 40206 34143 699 -458 -2740 N ATOM 6603 CA VAL H 39 0.325 -56.118 -8.213 1.00284.91 C ANISOU 6603 CA VAL H 39 36332 38916 33003 -12 193 -3111 C ATOM 6604 C VAL H 39 1.022 -56.809 -9.389 1.00278.45 C ANISOU 6604 C VAL H 39 35619 38103 32076 113 74 -2703 C ATOM 6605 O VAL H 39 1.787 -57.738 -9.163 1.00270.78 O ANISOU 6605 O VAL H 39 34980 36787 31115 -414 488 -2223 O ATOM 6606 CB VAL H 39 -1.168 -56.530 -8.099 1.00292.33 C ANISOU 6606 CB VAL H 39 36401 40457 34214 -200 496 -4514 C ATOM 6607 CG1 VAL H 39 -1.398 -57.990 -8.501 1.00293.80 C ANISOU 6607 CG1 VAL H 39 36266 40806 34558 -783 1083 -5011 C ATOM 6608 CG2 VAL H 39 -1.677 -56.261 -6.689 1.00293.02 C ANISOU 6608 CG2 VAL H 39 36490 40394 34447 -699 939 -4861 C ATOM 6609 N GLU H 40 0.774 -56.331 -10.618 1.00279.81 N ANISOU 6609 N GLU H 40 35595 38627 32089 871 -517 -2899 N ATOM 6610 CA GLU H 40 1.489 -56.779 -11.839 1.00276.35 C ANISOU 6610 CA GLU H 40 35344 38167 31488 1092 -708 -2447 C ATOM 6611 C GLU H 40 3.010 -56.559 -11.732 1.00269.68 C ANISOU 6611 C GLU H 40 35273 36727 30466 922 -701 -1256 C ATOM 6612 O GLU H 40 3.787 -57.473 -12.027 1.00270.60 O ANISOU 6612 O GLU H 40 35514 36693 30606 578 -455 -865 O ATOM 6613 CB GLU H 40 0.956 -56.091 -13.120 1.00277.77 C ANISOU 6613 CB GLU H 40 35399 38732 31407 2067 -1408 -2842 C ATOM 6614 CG GLU H 40 -0.562 -56.082 -13.320 1.00278.28 C ANISOU 6614 CG GLU H 40 34613 39511 31608 2488 -1620 -4201 C ATOM 6615 CD GLU H 40 -1.117 -57.397 -13.860 1.00276.63 C ANISOU 6615 CD GLU H 40 33655 39785 31663 2155 -1279 -5001 C ATOM 6616 OE1 GLU H 40 -2.349 -57.592 -13.813 1.00275.04 O ANISOU 6616 OE1 GLU H 40 32595 40218 31687 2234 -1246 -6292 O ATOM 6617 OE2 GLU H 40 -0.316 -58.236 -14.326 1.00274.59 O ANISOU 6617 OE2 GLU H 40 33642 39294 31396 1795 -1023 -4410 O ATOM 6618 N LEU H 41 3.423 -55.360 -11.309 1.00261.65 N ANISOU 6618 N LEU H 41 34738 35402 29274 1159 -957 -776 N ATOM 6619 CA LEU H 41 4.850 -55.012 -11.176 1.00248.04 C ANISOU 6619 CA LEU H 41 33656 33181 27404 973 -929 173 C ATOM 6620 C LEU H 41 5.625 -55.899 -10.187 1.00239.13 C ANISOU 6620 C LEU H 41 32617 31775 26464 287 -465 515 C ATOM 6621 O LEU H 41 6.675 -56.463 -10.525 1.00236.01 O ANISOU 6621 O LEU H 41 32417 31223 26032 100 -376 967 O ATOM 6622 CB LEU H 41 5.024 -53.526 -10.799 1.00247.20 C ANISOU 6622 CB LEU H 41 34040 32799 27084 1286 -1208 482 C ATOM 6623 CG LEU H 41 6.348 -53.055 -10.148 1.00242.64 C ANISOU 6623 CG LEU H 41 33986 31744 26462 922 -1054 1239 C ATOM 6624 CD1 LEU H 41 7.604 -53.416 -10.941 1.00241.09 C ANISOU 6624 CD1 LEU H 41 34046 31392 26165 749 -966 1734 C ATOM 6625 CD2 LEU H 41 6.328 -51.562 -9.880 1.00246.92 C ANISOU 6625 CD2 LEU H 41 35016 32033 26768 1238 -1294 1420 C ATOM 6626 N LEU H 42 5.122 -55.998 -8.964 1.00233.34 N ANISOU 6626 N LEU H 42 31807 30963 25885 -33 -192 260 N ATOM 6627 CA LEU H 42 5.842 -56.746 -7.948 1.00228.18 C ANISOU 6627 CA LEU H 42 31461 29950 25283 -545 187 580 C ATOM 6628 C LEU H 42 5.724 -58.244 -8.221 1.00234.61 C ANISOU 6628 C LEU H 42 32158 30825 26156 -878 567 324 C ATOM 6629 O LEU H 42 6.612 -59.007 -7.890 1.00235.04 O ANISOU 6629 O LEU H 42 32589 30581 26133 -1105 742 691 O ATOM 6630 CB LEU H 42 5.379 -56.370 -6.541 1.00222.52 C ANISOU 6630 CB LEU H 42 30879 29035 24633 -782 398 422 C ATOM 6631 CG LEU H 42 5.657 -54.958 -6.001 1.00215.86 C ANISOU 6631 CG LEU H 42 30267 28027 23722 -541 90 753 C ATOM 6632 CD1 LEU H 42 5.093 -54.845 -4.592 1.00218.93 C ANISOU 6632 CD1 LEU H 42 30752 28236 24193 -840 379 512 C ATOM 6633 CD2 LEU H 42 7.137 -54.585 -6.025 1.00207.10 C ANISOU 6633 CD2 LEU H 42 29569 26630 22489 -505 -88 1470 C ATOM 6634 N LYS H 43 4.630 -58.645 -8.854 1.00241.24 N ANISOU 6634 N LYS H 43 32485 32066 27107 -855 666 -370 N ATOM 6635 CA LYS H 43 4.476 -59.984 -9.382 1.00242.29 C ANISOU 6635 CA LYS H 43 32462 32309 27286 -1141 1010 -665 C ATOM 6636 C LYS H 43 5.633 -60.289 -10.354 1.00245.20 C ANISOU 6636 C LYS H 43 33015 32622 27528 -925 742 -51 C ATOM 6637 O LYS H 43 6.359 -61.265 -10.149 1.00246.72 O ANISOU 6637 O LYS H 43 33545 32545 27651 -1199 991 226 O ATOM 6638 CB LYS H 43 3.090 -60.068 -10.014 1.00239.18 C ANISOU 6638 CB LYS H 43 31338 32482 27058 -1039 1041 -1637 C ATOM 6639 CG LYS H 43 2.701 -61.282 -10.816 1.00234.42 C ANISOU 6639 CG LYS H 43 30382 32150 26538 -1259 1339 -2142 C ATOM 6640 CD LYS H 43 1.225 -61.113 -11.159 1.00237.61 C ANISOU 6640 CD LYS H 43 29951 33186 27140 -1132 1339 -3317 C ATOM 6641 CE LYS H 43 0.819 -61.861 -12.424 1.00241.64 C ANISOU 6641 CE LYS H 43 29919 34176 27717 -983 1288 -3868 C ATOM 6642 NZ LYS H 43 0.254 -63.211 -12.141 1.00246.52 N ANISOU 6642 NZ LYS H 43 30339 34824 28503 -1794 2124 -4585 N ATOM 6643 N VAL H 44 5.849 -59.443 -11.370 1.00250.00 N ANISOU 6643 N VAL H 44 33505 33432 28052 -420 252 146 N ATOM 6644 CA VAL H 44 7.007 -59.629 -12.297 1.00250.77 C ANISOU 6644 CA VAL H 44 33805 33457 28020 -283 63 698 C ATOM 6645 C VAL H 44 8.352 -59.403 -11.599 1.00252.41 C ANISOU 6645 C VAL H 44 34469 33276 28156 -441 60 1333 C ATOM 6646 O VAL H 44 9.391 -59.909 -12.049 1.00252.11 O ANISOU 6646 O VAL H 44 34550 33175 28062 -488 43 1655 O ATOM 6647 CB VAL H 44 6.986 -58.742 -13.573 1.00250.33 C ANISOU 6647 CB VAL H 44 33734 33589 27788 259 -375 769 C ATOM 6648 CG1 VAL H 44 7.969 -59.280 -14.613 1.00247.97 C ANISOU 6648 CG1 VAL H 44 33551 33273 27393 260 -405 1137 C ATOM 6649 CG2 VAL H 44 5.607 -58.679 -14.180 1.00252.67 C ANISOU 6649 CG2 VAL H 44 33574 34322 28107 634 -548 25 C ATOM 6650 N PHE H 45 8.327 -58.639 -10.508 1.00254.53 N ANISOU 6650 N PHE H 45 34938 33335 28434 -498 58 1426 N ATOM 6651 CA PHE H 45 9.524 -58.358 -9.723 1.00252.17 C ANISOU 6651 CA PHE H 45 35002 32726 28083 -608 25 1882 C ATOM 6652 C PHE H 45 10.087 -59.623 -9.064 1.00253.73 C ANISOU 6652 C PHE H 45 35436 32719 28251 -838 253 1924 C ATOM 6653 O PHE H 45 11.280 -59.930 -9.198 1.00248.17 O ANISOU 6653 O PHE H 45 34860 31952 27479 -792 135 2184 O ATOM 6654 CB PHE H 45 9.231 -57.281 -8.677 1.00250.47 C ANISOU 6654 CB PHE H 45 34941 32344 27881 -597 -26 1908 C ATOM 6655 CG PHE H 45 10.357 -57.056 -7.715 1.00247.78 C ANISOU 6655 CG PHE H 45 34920 31720 27503 -703 -55 2243 C ATOM 6656 CD1 PHE H 45 11.346 -56.125 -7.996 1.00247.97 C ANISOU 6656 CD1 PHE H 45 35024 31711 27481 -634 -245 2530 C ATOM 6657 CD2 PHE H 45 10.445 -57.783 -6.529 1.00249.61 C ANISOU 6657 CD2 PHE H 45 35435 31701 27705 -869 132 2197 C ATOM 6658 CE1 PHE H 45 12.400 -55.920 -7.116 1.00251.91 C ANISOU 6658 CE1 PHE H 45 35692 32042 27977 -715 -292 2679 C ATOM 6659 CE2 PHE H 45 11.495 -57.584 -5.643 1.00252.99 C ANISOU 6659 CE2 PHE H 45 36154 31909 28061 -834 9 2415 C ATOM 6660 CZ PHE H 45 12.473 -56.646 -5.936 1.00254.17 C ANISOU 6660 CZ PHE H 45 36193 32140 28237 -751 -227 2614 C ATOM 6661 N VAL H 46 9.212 -60.334 -8.350 1.00258.56 N ANISOU 6661 N VAL H 46 36160 33208 28871 -1072 599 1593 N ATOM 6662 CA VAL H 46 9.538 -61.615 -7.720 1.00261.40 C ANISOU 6662 CA VAL H 46 36995 33248 29074 -1266 894 1578 C ATOM 6663 C VAL H 46 9.876 -62.680 -8.770 1.00274.28 C ANISOU 6663 C VAL H 46 38526 35022 30667 -1244 925 1565 C ATOM 6664 O VAL H 46 10.847 -63.418 -8.582 1.00276.65 O ANISOU 6664 O VAL H 46 39214 35111 30786 -1149 866 1769 O ATOM 6665 CB VAL H 46 8.394 -62.136 -6.806 1.00254.82 C ANISOU 6665 CB VAL H 46 36429 32181 28208 -1651 1430 1138 C ATOM 6666 CG1 VAL H 46 8.763 -63.472 -6.170 1.00252.31 C ANISOU 6666 CG1 VAL H 46 36899 31378 27587 -1827 1791 1152 C ATOM 6667 CG2 VAL H 46 8.037 -61.124 -5.724 1.00248.12 C ANISOU 6667 CG2 VAL H 46 35688 31188 27397 -1686 1420 1128 C ATOM 6668 N VAL H 47 9.078 -62.750 -9.852 1.00286.08 N ANISOU 6668 N VAL H 47 39505 36886 32305 -1263 969 1272 N ATOM 6669 CA VAL H 47 9.265 -63.719 -10.978 1.00289.10 C ANISOU 6669 CA VAL H 47 39713 37456 32675 -1246 1002 1218 C ATOM 6670 C VAL H 47 10.622 -63.572 -11.685 1.00290.90 C ANISOU 6670 C VAL H 47 39923 37757 32847 -975 622 1666 C ATOM 6671 O VAL H 47 11.273 -64.580 -11.964 1.00300.67 O ANISOU 6671 O VAL H 47 41326 38932 33982 -969 659 1741 O ATOM 6672 CB VAL H 47 8.068 -63.742 -11.995 1.00285.58 C ANISOU 6672 CB VAL H 47 38666 37448 32391 -1249 1072 707 C ATOM 6673 CG1 VAL H 47 8.461 -64.243 -13.391 1.00277.90 C ANISOU 6673 CG1 VAL H 47 37434 36743 31412 -1069 899 788 C ATOM 6674 CG2 VAL H 47 6.945 -64.595 -11.442 1.00288.27 C ANISOU 6674 CG2 VAL H 47 39019 37729 32779 -1697 1652 80 C ATOM 6675 N GLU H 48 11.058 -62.335 -11.942 1.00281.82 N ANISOU 6675 N GLU H 48 38624 36715 31740 -786 310 1902 N ATOM 6676 CA GLU H 48 12.377 -62.112 -12.553 1.00268.47 C ANISOU 6676 CA GLU H 48 36908 35090 30008 -662 74 2202 C ATOM 6677 C GLU H 48 13.562 -62.216 -11.588 1.00258.99 C ANISOU 6677 C GLU H 48 35979 33685 28737 -638 -27 2346 C ATOM 6678 O GLU H 48 14.657 -62.639 -12.005 1.00257.21 O ANISOU 6678 O GLU H 48 35690 33559 28477 -558 -156 2388 O ATOM 6679 CB GLU H 48 12.410 -60.821 -13.376 1.00269.28 C ANISOU 6679 CB GLU H 48 36877 35328 30110 -539 -100 2326 C ATOM 6680 CG GLU H 48 11.711 -60.960 -14.728 1.00276.13 C ANISOU 6680 CG GLU H 48 37529 36441 30944 -381 -136 2183 C ATOM 6681 CD GLU H 48 12.479 -61.818 -15.739 1.00277.28 C ANISOU 6681 CD GLU H 48 37570 36722 31062 -403 -122 2258 C ATOM 6682 OE1 GLU H 48 13.708 -61.618 -15.924 1.00280.73 O ANISOU 6682 OE1 GLU H 48 38076 37121 31466 -480 -157 2455 O ATOM 6683 OE2 GLU H 48 11.844 -62.693 -16.370 1.00274.74 O ANISOU 6683 OE2 GLU H 48 37049 36576 30764 -364 -55 2042 O ATOM 6684 N ALA H 49 13.332 -61.836 -10.323 1.00249.37 N ANISOU 6684 N ALA H 49 35035 32221 27490 -666 3 2342 N ATOM 6685 CA ALA H 49 14.253 -62.117 -9.216 1.00244.67 C ANISOU 6685 CA ALA H 49 34804 31397 26762 -537 -123 2371 C ATOM 6686 C ALA H 49 14.531 -63.635 -9.103 1.00250.13 C ANISOU 6686 C ALA H 49 35877 31924 27236 -415 -60 2273 C ATOM 6687 O ALA H 49 15.693 -64.069 -9.077 1.00244.30 O ANISOU 6687 O ALA H 49 35208 31231 26384 -143 -327 2239 O ATOM 6688 CB ALA H 49 13.704 -61.553 -7.911 1.00238.17 C ANISOU 6688 CB ALA H 49 34300 30291 25904 -590 -44 2368 C ATOM 6689 N ALA H 50 13.456 -64.432 -9.085 1.00263.02 N ANISOU 6689 N ALA H 50 37754 33384 28798 -616 308 2145 N ATOM 6690 CA ALA H 50 13.519 -65.915 -9.132 1.00276.83 C ANISOU 6690 CA ALA H 50 39988 34903 30292 -583 495 2040 C ATOM 6691 C ALA H 50 14.144 -66.504 -10.433 1.00290.17 C ANISOU 6691 C ALA H 50 41295 36919 32035 -460 333 2060 C ATOM 6692 O ALA H 50 15.102 -67.294 -10.359 1.00293.89 O ANISOU 6692 O ALA H 50 42082 37299 32284 -152 127 2055 O ATOM 6693 CB ALA H 50 12.130 -66.504 -8.885 1.00272.39 C ANISOU 6693 CB ALA H 50 39709 34103 29682 -993 1074 1783 C ATOM 6694 N VAL H 51 13.600 -66.106 -11.599 1.00300.08 N ANISOU 6694 N VAL H 51 41919 38549 33547 -633 390 2041 N ATOM 6695 CA VAL H 51 13.986 -66.607 -12.946 1.00296.22 C ANISOU 6695 CA VAL H 51 41055 38373 33121 -575 303 2050 C ATOM 6696 C VAL H 51 15.481 -66.546 -13.185 1.00293.87 C ANISOU 6696 C VAL H 51 40638 38226 32791 -312 -58 2146 C ATOM 6697 O VAL H 51 16.087 -67.539 -13.559 1.00296.89 O ANISOU 6697 O VAL H 51 41113 38638 33050 -153 -133 2083 O ATOM 6698 CB VAL H 51 13.261 -65.859 -14.098 1.00291.43 C ANISOU 6698 CB VAL H 51 39873 38122 32732 -676 314 2022 C ATOM 6699 CG1 VAL H 51 14.058 -65.934 -15.375 1.00285.50 C ANISOU 6699 CG1 VAL H 51 38802 37657 32015 -567 135 2125 C ATOM 6700 CG2 VAL H 51 11.884 -66.463 -14.356 1.00289.77 C ANISOU 6700 CG2 VAL H 51 39572 37957 32570 -878 652 1695 C ATOM 6701 N ARG H 52 16.063 -65.380 -12.957 1.00283.46 N ANISOU 6701 N ARG H 52 39101 37017 31583 -288 -253 2216 N ATOM 6702 CA ARG H 52 17.483 -65.205 -13.171 1.00268.89 C ANISOU 6702 CA ARG H 52 37011 35394 29760 -134 -525 2125 C ATOM 6703 C ARG H 52 18.333 -65.826 -12.051 1.00256.28 C ANISOU 6703 C ARG H 52 35788 33637 27948 245 -797 1936 C ATOM 6704 O ARG H 52 19.437 -66.282 -12.313 1.00251.17 O ANISOU 6704 O ARG H 52 34961 33213 27256 499 -1055 1697 O ATOM 6705 CB ARG H 52 17.818 -63.736 -13.424 1.00273.38 C ANISOU 6705 CB ARG H 52 37247 36123 30502 -334 -529 2170 C ATOM 6706 CG ARG H 52 17.149 -63.182 -14.673 1.00278.76 C ANISOU 6706 CG ARG H 52 37742 36915 31256 -543 -341 2323 C ATOM 6707 CD ARG H 52 17.686 -61.802 -15.035 1.00281.73 C ANISOU 6707 CD ARG H 52 38017 37344 31682 -749 -278 2351 C ATOM 6708 NE ARG H 52 16.882 -61.142 -16.073 1.00283.65 N ANISOU 6708 NE ARG H 52 38362 37554 31857 -812 -143 2520 N ATOM 6709 CZ ARG H 52 16.995 -59.862 -16.439 1.00282.48 C ANISOU 6709 CZ ARG H 52 38415 37290 31624 -959 -22 2604 C ATOM 6710 NH1 ARG H 52 17.879 -59.057 -15.854 1.00279.14 N ANISOU 6710 NH1 ARG H 52 38010 36807 31242 -1183 57 2512 N ATOM 6711 NH2 ARG H 52 16.209 -59.377 -17.395 1.00282.65 N ANISOU 6711 NH2 ARG H 52 38689 37232 31471 -849 20 2730 N ATOM 6712 N GLY H 53 17.807 -65.874 -10.824 1.00244.83 N ANISOU 6712 N GLY H 53 34897 31800 26327 334 -756 1982 N ATOM 6713 CA GLY H 53 18.430 -66.644 -9.738 1.00239.01 C ANISOU 6713 CA GLY H 53 34802 30777 25234 818 -1020 1809 C ATOM 6714 C GLY H 53 18.493 -68.110 -10.126 1.00241.42 C ANISOU 6714 C GLY H 53 35541 30932 25255 1043 -996 1744 C ATOM 6715 O GLY H 53 19.558 -68.733 -10.069 1.00240.28 O ANISOU 6715 O GLY H 53 35513 30880 24902 1553 -1392 1493 O ATOM 6716 N VAL H 54 17.344 -68.635 -10.559 1.00246.10 N ANISOU 6716 N VAL H 54 36325 31333 25846 670 -534 1891 N ATOM 6717 CA VAL H 54 17.198 -70.002 -11.108 1.00254.14 C ANISOU 6717 CA VAL H 54 37726 32200 26635 725 -368 1841 C ATOM 6718 C VAL H 54 18.085 -70.233 -12.351 1.00258.74 C ANISOU 6718 C VAL H 54 37635 33287 27385 869 -641 1761 C ATOM 6719 O VAL H 54 18.847 -71.214 -12.405 1.00260.32 O ANISOU 6719 O VAL H 54 38172 33435 27302 1305 -890 1602 O ATOM 6720 CB VAL H 54 15.703 -70.329 -11.422 1.00252.25 C ANISOU 6720 CB VAL H 54 37590 31781 26470 163 255 1876 C ATOM 6721 CG1 VAL H 54 15.533 -71.614 -12.223 1.00249.92 C ANISOU 6721 CG1 VAL H 54 37499 31429 26028 106 482 1791 C ATOM 6722 CG2 VAL H 54 14.910 -70.446 -10.139 1.00253.37 C ANISOU 6722 CG2 VAL H 54 38582 31338 26345 -5 630 1832 C ATOM 6723 N ARG H 55 17.987 -69.333 -13.338 1.00262.07 N ANISOU 6723 N ARG H 55 37205 34156 28212 537 -591 1842 N ATOM 6724 CA ARG H 55 18.801 -69.405 -14.572 1.00265.66 C ANISOU 6724 CA ARG H 55 37029 35073 28836 565 -754 1753 C ATOM 6725 C ARG H 55 20.321 -69.383 -14.317 1.00263.46 C ANISOU 6725 C ARG H 55 36546 35050 28507 981 -1212 1424 C ATOM 6726 O ARG H 55 21.091 -69.945 -15.113 1.00269.24 O ANISOU 6726 O ARG H 55 36963 36084 29251 1131 -1367 1218 O ATOM 6727 CB ARG H 55 18.435 -68.285 -15.555 1.00272.25 C ANISOU 6727 CB ARG H 55 37228 36213 30001 159 -585 1895 C ATOM 6728 CG ARG H 55 17.268 -68.561 -16.496 1.00279.80 C ANISOU 6728 CG ARG H 55 38084 37193 31031 -96 -281 2022 C ATOM 6729 CD ARG H 55 17.403 -67.709 -17.757 1.00287.80 C ANISOU 6729 CD ARG H 55 38591 38532 32227 -270 -261 2094 C ATOM 6730 NE ARG H 55 16.487 -66.558 -17.867 1.00287.94 N ANISOU 6730 NE ARG H 55 38555 38517 32329 -425 -150 2217 N ATOM 6731 CZ ARG H 55 16.814 -65.265 -17.726 1.00286.73 C ANISOU 6731 CZ ARG H 55 38361 38359 32222 -510 -187 2293 C ATOM 6732 NH1 ARG H 55 18.054 -64.881 -17.422 1.00291.27 N ANISOU 6732 NH1 ARG H 55 38838 39003 32825 -547 -281 2197 N ATOM 6733 NH2 ARG H 55 15.877 -64.334 -17.883 1.00279.14 N ANISOU 6733 NH2 ARG H 55 37465 37333 31260 -544 -126 2385 N ATOM 6734 N GLN H 56 20.740 -68.728 -13.226 1.00255.43 N ANISOU 6734 N GLN H 56 35642 33960 27447 1173 -1434 1290 N ATOM 6735 CA GLN H 56 22.158 -68.665 -12.842 1.00250.73 C ANISOU 6735 CA GLN H 56 34777 33675 26810 1627 -1913 791 C ATOM 6736 C GLN H 56 22.638 -69.992 -12.243 1.00252.92 C ANISOU 6736 C GLN H 56 35752 33728 26617 2376 -2309 540 C ATOM 6737 O GLN H 56 23.702 -70.480 -12.629 1.00258.55 O ANISOU 6737 O GLN H 56 36129 34817 27289 2780 -2680 82 O ATOM 6738 CB GLN H 56 22.458 -67.462 -11.925 1.00248.49 C ANISOU 6738 CB GLN H 56 34319 33440 26652 1587 -2027 653 C ATOM 6739 CG GLN H 56 23.944 -67.197 -11.651 1.00249.27 C ANISOU 6739 CG GLN H 56 33877 34018 26815 1952 -2478 -49 C ATOM 6740 CD GLN H 56 24.762 -66.754 -12.860 1.00248.08 C ANISOU 6740 CD GLN H 56 32789 34450 27017 1541 -2330 -406 C ATOM 6741 OE1 GLN H 56 24.234 -66.211 -13.829 1.00245.42 O ANISOU 6741 OE1 GLN H 56 32230 34119 26897 912 -1864 -50 O ATOM 6742 NE2 GLN H 56 26.073 -66.971 -12.791 1.00250.68 N ANISOU 6742 NE2 GLN H 56 32603 35272 27370 1924 -2726 -1198 N ATOM 6743 N ALA H 57 21.846 -70.579 -11.337 1.00248.85 N ANISOU 6743 N ALA H 57 36266 32577 25707 2558 -2196 792 N ATOM 6744 CA ALA H 57 22.137 -71.896 -10.742 1.00248.21 C ANISOU 6744 CA ALA H 57 37221 32069 25016 3283 -2481 628 C ATOM 6745 C ALA H 57 22.337 -72.958 -11.806 1.00249.26 C ANISOU 6745 C ALA H 57 37294 32337 25077 3368 -2468 575 C ATOM 6746 O ALA H 57 23.291 -73.717 -11.765 1.00247.06 O ANISOU 6746 O ALA H 57 37226 32161 24484 4093 -2973 174 O ATOM 6747 CB ALA H 57 21.028 -72.312 -9.792 1.00245.60 C ANISOU 6747 CB ALA H 57 38113 30929 24275 3185 -2085 962 C ATOM 6748 N GLN H 58 21.439 -72.981 -12.774 1.00256.79 N ANISOU 6748 N GLN H 58 37923 33328 26318 2677 -1930 922 N ATOM 6749 CA GLN H 58 21.564 -73.876 -13.906 1.00275.42 C ANISOU 6749 CA GLN H 58 40095 35867 28684 2657 -1868 896 C ATOM 6750 C GLN H 58 22.683 -73.538 -14.927 1.00297.98 C ANISOU 6750 C GLN H 58 41844 39474 31898 2709 -2183 563 C ATOM 6751 O GLN H 58 23.273 -74.467 -15.485 1.00306.24 O ANISOU 6751 O GLN H 58 42902 40668 32787 3066 -2404 336 O ATOM 6752 CB GLN H 58 20.223 -73.993 -14.607 1.00267.66 C ANISOU 6752 CB GLN H 58 39080 34728 27891 1941 -1218 1270 C ATOM 6753 CG GLN H 58 19.076 -74.326 -13.670 1.00261.05 C ANISOU 6753 CG GLN H 58 39231 33204 26753 1728 -764 1449 C ATOM 6754 CD GLN H 58 17.738 -73.869 -14.223 1.00258.41 C ANISOU 6754 CD GLN H 58 38458 32939 26787 966 -185 1632 C ATOM 6755 OE1 GLN H 58 17.678 -73.167 -15.247 1.00262.58 O ANISOU 6755 OE1 GLN H 58 38027 33989 27751 691 -199 1691 O ATOM 6756 NE2 GLN H 58 16.655 -74.262 -13.554 1.00253.23 N ANISOU 6756 NE2 GLN H 58 38545 31751 25918 643 338 1644 N ATOM 6757 N ALA H 59 22.983 -72.247 -15.173 1.00314.37 N ANISOU 6757 N ALA H 59 43044 41985 34416 2326 -2152 490 N ATOM 6758 CA ALA H 59 24.046 -71.821 -16.156 1.00322.32 C ANISOU 6758 CA ALA H 59 43037 43666 35762 2197 -2278 90 C ATOM 6759 C ALA H 59 25.513 -72.142 -15.758 1.00330.82 C ANISOU 6759 C ALA H 59 43838 45143 36715 2892 -2893 -682 C ATOM 6760 O ALA H 59 26.383 -72.366 -16.622 1.00324.37 O ANISOU 6760 O ALA H 59 42346 44841 36056 2915 -3009 -1130 O ATOM 6761 CB ALA H 59 23.905 -70.341 -16.526 1.00311.97 C ANISOU 6761 CB ALA H 59 41086 42581 34867 1521 -1943 204 C ATOM 6762 N GLU H 60 25.768 -72.151 -14.449 1.00338.70 N ANISOU 6762 N GLU H 60 45351 45923 37416 3486 -3298 -908 N ATOM 6763 CA GLU H 60 27.073 -72.525 -13.861 1.00343.54 C ANISOU 6763 CA GLU H 60 45838 46887 37804 4380 -4024 -1753 C ATOM 6764 C GLU H 60 27.038 -73.942 -13.215 1.00348.93 C ANISOU 6764 C GLU H 60 47756 47045 37775 5351 -4466 -1767 C ATOM 6765 O GLU H 60 27.938 -74.362 -12.460 1.00356.69 O ANISOU 6765 O GLU H 60 49026 48130 38370 6353 -5184 -2427 O ATOM 6766 CB GLU H 60 27.539 -71.441 -12.868 1.00334.07 C ANISOU 6766 CB GLU H 60 44319 45875 36735 4470 -4250 -2151 C ATOM 6767 CG GLU H 60 26.680 -71.306 -11.615 1.00318.38 C ANISOU 6767 CG GLU H 60 43373 43183 34412 4647 -4225 -1660 C ATOM 6768 CD GLU H 60 27.127 -70.182 -10.690 1.00309.30 C ANISOU 6768 CD GLU H 60 41849 42245 33426 4694 -4431 -2039 C ATOM 6769 OE1 GLU H 60 27.623 -70.494 -9.583 1.00312.47 O ANISOU 6769 OE1 GLU H 60 42792 42526 33406 5600 -5041 -2472 O ATOM 6770 OE2 GLU H 60 26.978 -68.993 -11.060 1.00296.55 O ANISOU 6770 OE2 GLU H 60 39490 40876 32308 3869 -3991 -1919 O ATOM 6771 N ASP H 61 25.965 -74.663 -13.531 1.00340.41 N ANISOU 6771 N ASP H 61 47468 45382 36491 5053 -4007 -1086 N ATOM 6772 CA ASP H 61 25.767 -76.054 -13.138 1.00331.15 C ANISOU 6772 CA ASP H 61 47628 43579 34614 5742 -4182 -999 C ATOM 6773 C ASP H 61 25.829 -76.335 -11.622 1.00325.53 C ANISOU 6773 C ASP H 61 48222 42243 33220 6584 -4581 -1119 C ATOM 6774 O ASP H 61 26.721 -77.045 -11.162 1.00324.15 O ANISOU 6774 O ASP H 61 48597 42053 32509 7685 -5298 -1675 O ATOM 6775 CB ASP H 61 26.714 -76.962 -13.925 1.00337.71 C ANISOU 6775 CB ASP H 61 48155 44829 35327 6310 -4623 -1505 C ATOM 6776 CG ASP H 61 26.117 -78.326 -14.163 1.00337.33 C ANISOU 6776 CG ASP H 61 49284 44133 34752 6492 -4409 -1142 C ATOM 6777 OD1 ASP H 61 24.873 -78.445 -14.173 1.00331.11 O ANISOU 6777 OD1 ASP H 61 49102 42766 33937 5808 -3707 -494 O ATOM 6778 OD2 ASP H 61 26.880 -79.291 -14.334 1.00345.26 O ANISOU 6778 OD2 ASP H 61 50615 45210 35357 7316 -4924 -1574 O ATOM 6779 N ALA H 62 24.867 -75.768 -10.875 1.00314.19 N ANISOU 6779 N ALA H 62 47309 40293 31776 6103 -4129 -635 N ATOM 6780 CA ALA H 62 24.689 -75.988 -9.428 1.00317.35 C ANISOU 6780 CA ALA H 62 49131 39946 31499 6725 -4319 -618 C ATOM 6781 C ALA H 62 23.646 -77.077 -9.159 1.00322.31 C ANISOU 6781 C ALA H 62 51400 39560 31502 6589 -3742 -137 C ATOM 6782 O ALA H 62 22.802 -77.362 -10.020 1.00327.49 O ANISOU 6782 O ALA H 62 51855 40148 32426 5764 -3065 243 O ATOM 6783 CB ALA H 62 24.276 -74.699 -8.742 1.00308.49 C ANISOU 6783 CB ALA H 62 47609 38862 30740 6226 -4113 -438 C ATOM 6784 N LEU H 63 23.703 -77.673 -7.963 1.00325.02 N ANISOU 6784 N LEU H 63 53417 39095 30979 7387 -3975 -217 N ATOM 6785 CA LEU H 63 22.900 -78.871 -7.635 1.00321.35 C ANISOU 6785 CA LEU H 63 54834 37537 29727 7367 -3411 99 C ATOM 6786 C LEU H 63 21.559 -78.577 -6.907 1.00313.49 C ANISOU 6786 C LEU H 63 54673 35784 28654 6477 -2485 560 C ATOM 6787 O LEU H 63 20.763 -79.479 -6.622 1.00308.61 O ANISOU 6787 O LEU H 63 55590 34228 27437 6203 -1794 766 O ATOM 6788 CB LEU H 63 23.776 -79.940 -6.952 1.00328.09 C ANISOU 6788 CB LEU H 63 57317 37832 29510 8827 -4155 -302 C ATOM 6789 CG LEU H 63 25.060 -80.311 -7.737 1.00327.49 C ANISOU 6789 CG LEU H 63 56331 38573 29527 9709 -5059 -890 C ATOM 6790 CD1 LEU H 63 26.047 -81.120 -6.909 1.00338.25 C ANISOU 6790 CD1 LEU H 63 59145 39535 29838 11404 -6042 -1465 C ATOM 6791 CD2 LEU H 63 24.768 -81.068 -9.029 1.00319.92 C ANISOU 6791 CD2 LEU H 63 55003 37751 28799 9151 -4612 -686 C ATOM 6792 N ARG H 64 21.332 -77.290 -6.638 1.00303.71 N ANISOU 6792 N ARG H 64 52376 34981 28038 5986 -2437 649 N ATOM 6793 CA ARG H 64 19.982 -76.694 -6.480 1.00296.15 C ANISOU 6793 CA ARG H 64 51290 33778 27456 4827 -1519 1031 C ATOM 6794 C ARG H 64 20.065 -75.166 -6.655 1.00298.67 C ANISOU 6794 C ARG H 64 49911 34931 28637 4413 -1708 1058 C ATOM 6795 O ARG H 64 21.159 -74.649 -6.936 1.00301.81 O ANISOU 6795 O ARG H 64 49296 36049 29327 4915 -2434 767 O ATOM 6796 CB ARG H 64 19.321 -77.074 -5.149 1.00287.21 C ANISOU 6796 CB ARG H 64 52049 31528 25547 4859 -1050 1139 C ATOM 6797 CG ARG H 64 20.046 -76.602 -3.898 1.00284.01 C ANISOU 6797 CG ARG H 64 52278 30921 24709 5776 -1742 962 C ATOM 6798 CD ARG H 64 19.089 -75.948 -2.890 1.00276.39 C ANISOU 6798 CD ARG H 64 51860 29432 23721 5157 -1128 1180 C ATOM 6799 NE ARG H 64 17.676 -76.078 -3.286 1.00268.88 N ANISOU 6799 NE ARG H 64 50875 28217 23068 3869 19 1410 N ATOM 6800 CZ ARG H 64 16.635 -76.044 -2.464 1.00270.11 C ANISOU 6800 CZ ARG H 64 52013 27642 22971 3218 849 1497 C ATOM 6801 NH1 ARG H 64 16.807 -75.867 -1.157 1.00274.72 N ANISOU 6801 NH1 ARG H 64 53840 27585 22956 3718 692 1487 N ATOM 6802 NH2 ARG H 64 15.403 -76.177 -2.948 1.00267.61 N ANISOU 6802 NH2 ARG H 64 51407 27265 23008 2057 1852 1512 N ATOM 6803 N VAL H 65 18.933 -74.455 -6.520 1.00302.43 N ANISOU 6803 N VAL H 65 50083 35324 29502 3497 -1037 1325 N ATOM 6804 CA VAL H 65 18.955 -72.968 -6.522 1.00303.39 C ANISOU 6804 CA VAL H 65 48889 36075 30307 3165 -1196 1373 C ATOM 6805 C VAL H 65 19.474 -72.388 -5.163 1.00307.17 C ANISOU 6805 C VAL H 65 49905 36323 30483 3758 -1653 1245 C ATOM 6806 O VAL H 65 18.746 -72.333 -4.167 1.00302.53 O ANISOU 6806 O VAL H 65 50286 35084 29577 3573 -1259 1384 O ATOM 6807 CB VAL H 65 17.636 -72.320 -7.069 1.00298.66 C ANISOU 6807 CB VAL H 65 47536 35646 30292 2095 -464 1617 C ATOM 6808 CG1 VAL H 65 17.767 -70.801 -7.183 1.00292.54 C ANISOU 6808 CG1 VAL H 65 45522 35489 30138 1865 -692 1670 C ATOM 6809 CG2 VAL H 65 17.277 -72.873 -8.449 1.00295.05 C ANISOU 6809 CG2 VAL H 65 46475 35512 30119 1677 -167 1646 C ATOM 6810 N ASP H 66 20.749 -71.954 -5.184 1.00310.97 N ANISOU 6810 N ASP H 66 49671 37392 31089 4436 -2458 898 N ATOM 6811 CA ASP H 66 21.585 -71.512 -4.034 1.00311.19 C ANISOU 6811 CA ASP H 66 50023 37392 30821 5246 -3123 568 C ATOM 6812 C ASP H 66 21.892 -69.979 -4.091 1.00310.79 C ANISOU 6812 C ASP H 66 48522 38066 31495 4874 -3281 467 C ATOM 6813 O ASP H 66 21.882 -69.396 -5.178 1.00316.14 O ANISOU 6813 O ASP H 66 47939 39360 32818 4253 -3088 528 O ATOM 6814 CB ASP H 66 22.901 -72.317 -4.058 1.00308.94 C ANISOU 6814 CB ASP H 66 49990 37305 30084 6403 -3969 7 C ATOM 6815 CG ASP H 66 23.301 -72.827 -2.678 1.00310.18 C ANISOU 6815 CG ASP H 66 51737 36784 29332 7511 -4487 -248 C ATOM 6816 OD1 ASP H 66 23.804 -72.027 -1.859 1.00312.76 O ANISOU 6816 OD1 ASP H 66 51814 37323 29697 7923 -4961 -547 O ATOM 6817 OD2 ASP H 66 23.114 -74.027 -2.405 1.00310.16 O ANISOU 6817 OD2 ASP H 66 53328 35993 28524 7995 -4413 -171 O ATOM 6818 N VAL H 67 22.180 -69.337 -2.956 1.00308.36 N ANISOU 6818 N VAL H 67 48476 37648 31038 5256 -3607 299 N ATOM 6819 CA VAL H 67 22.236 -67.852 -2.862 1.00298.06 C ANISOU 6819 CA VAL H 67 46043 36846 30359 4767 -3584 280 C ATOM 6820 C VAL H 67 23.329 -67.159 -3.699 1.00294.77 C ANISOU 6820 C VAL H 67 44107 37379 30510 4721 -3938 -204 C ATOM 6821 O VAL H 67 23.126 -66.036 -4.194 1.00287.63 O ANISOU 6821 O VAL H 67 42230 36856 30197 3968 -3613 -68 O ATOM 6822 CB VAL H 67 22.309 -67.377 -1.389 1.00299.36 C ANISOU 6822 CB VAL H 67 46907 36643 30191 5220 -3856 174 C ATOM 6823 CG1 VAL H 67 21.855 -65.930 -1.254 1.00291.73 C ANISOU 6823 CG1 VAL H 67 45101 35928 29813 4472 -3544 385 C ATOM 6824 CG2 VAL H 67 21.450 -68.263 -0.506 1.00301.35 C ANISOU 6824 CG2 VAL H 67 48915 35872 29711 5396 -3524 507 C ATOM 6825 N ASP H 68 24.471 -67.828 -3.851 1.00299.53 N ANISOU 6825 N ASP H 68 44586 38329 30891 5521 -4566 -827 N ATOM 6826 CA ASP H 68 25.598 -67.335 -4.679 1.00304.39 C ANISOU 6826 CA ASP H 68 43768 39874 32012 5458 -4845 -1476 C ATOM 6827 C ASP H 68 25.145 -66.924 -6.105 1.00306.30 C ANISOU 6827 C ASP H 68 43116 40423 32841 4408 -4192 -1090 C ATOM 6828 O ASP H 68 25.623 -65.922 -6.671 1.00309.70 O ANISOU 6828 O ASP H 68 42447 41427 33798 3868 -4041 -1362 O ATOM 6829 CB ASP H 68 26.717 -68.411 -4.768 1.00305.82 C ANISOU 6829 CB ASP H 68 44056 40340 31800 6512 -5579 -2220 C ATOM 6830 CG ASP H 68 27.770 -68.338 -3.641 1.00308.74 C ANISOU 6830 CG ASP H 68 44540 40939 31828 7629 -6458 -3102 C ATOM 6831 OD1 ASP H 68 27.428 -68.106 -2.453 1.00303.96 O ANISOU 6831 OD1 ASP H 68 44804 39823 30864 7973 -6591 -2937 O ATOM 6832 OD2 ASP H 68 28.942 -68.602 -3.964 1.00314.26 O ANISOU 6832 OD2 ASP H 68 44491 42338 32575 8233 -7046 -4031 O ATOM 6833 N GLN H 69 24.207 -67.701 -6.657 1.00309.41 N ANISOU 6833 N GLN H 69 44085 40386 33088 4127 -3777 -500 N ATOM 6834 CA GLN H 69 23.663 -67.510 -8.010 1.00307.21 C ANISOU 6834 CA GLN H 69 43169 40317 33240 3298 -3224 -127 C ATOM 6835 C GLN H 69 22.659 -66.337 -8.131 1.00300.03 C ANISOU 6835 C GLN H 69 41995 39298 32703 2459 -2668 381 C ATOM 6836 O GLN H 69 22.787 -65.503 -9.036 1.00296.64 O ANISOU 6836 O GLN H 69 40744 39265 32698 1897 -2421 384 O ATOM 6837 CB GLN H 69 23.075 -68.832 -8.534 1.00305.84 C ANISOU 6837 CB GLN H 69 43673 39776 32755 3383 -3036 178 C ATOM 6838 CG GLN H 69 24.123 -69.827 -9.053 1.00306.11 C ANISOU 6838 CG GLN H 69 43581 40130 32595 4012 -3501 -319 C ATOM 6839 CD GLN H 69 24.471 -70.983 -8.103 1.00311.49 C ANISOU 6839 CD GLN H 69 45476 40339 32535 5045 -4009 -563 C ATOM 6840 OE1 GLN H 69 23.705 -71.338 -7.202 1.00315.56 O ANISOU 6840 OE1 GLN H 69 47194 40107 32596 5171 -3830 -216 O ATOM 6841 NE2 GLN H 69 25.631 -71.593 -8.326 1.00314.65 N ANISOU 6841 NE2 GLN H 69 45640 41148 32763 5808 -4629 -1215 N ATOM 6842 N LEU H 70 21.675 -66.278 -7.225 1.00296.55 N ANISOU 6842 N LEU H 70 42326 38294 32056 2401 -2463 759 N ATOM 6843 CA LEU H 70 20.803 -65.096 -7.074 1.00293.19 C ANISOU 6843 CA LEU H 70 41688 37780 31929 1786 -2074 1110 C ATOM 6844 C LEU H 70 21.621 -63.805 -6.961 1.00291.39 C ANISOU 6844 C LEU H 70 40705 37982 32026 1653 -2239 814 C ATOM 6845 O LEU H 70 21.356 -62.827 -7.658 1.00287.34 O ANISOU 6845 O LEU H 70 39656 37660 31856 1072 -1918 980 O ATOM 6846 CB LEU H 70 19.902 -65.208 -5.826 1.00300.53 C ANISOU 6846 CB LEU H 70 43557 38083 32547 1864 -1925 1355 C ATOM 6847 CG LEU H 70 19.377 -63.864 -5.267 1.00305.96 C ANISOU 6847 CG LEU H 70 44022 38736 33490 1477 -1750 1528 C ATOM 6848 CD1 LEU H 70 18.064 -63.482 -5.939 1.00307.12 C ANISOU 6848 CD1 LEU H 70 43975 38827 33888 834 -1221 1894 C ATOM 6849 CD2 LEU H 70 19.261 -63.809 -3.740 1.00310.02 C ANISOU 6849 CD2 LEU H 70 45336 38788 33667 1821 -1888 1502 C ATOM 6850 N GLU H 71 22.608 -63.799 -6.069 1.00291.52 N ANISOU 6850 N GLU H 71 40753 38123 31886 2219 -2730 317 N ATOM 6851 CA GLU H 71 23.374 -62.584 -5.821 1.00289.53 C ANISOU 6851 CA GLU H 71 39798 38272 31939 2049 -2834 -82 C ATOM 6852 C GLU H 71 24.387 -62.282 -6.923 1.00292.91 C ANISOU 6852 C GLU H 71 39247 39340 32704 1755 -2786 -584 C ATOM 6853 O GLU H 71 24.881 -61.155 -7.014 1.00294.18 O ANISOU 6853 O GLU H 71 38799 39803 33171 1318 -2617 -884 O ATOM 6854 CB GLU H 71 24.042 -62.621 -4.454 1.00290.32 C ANISOU 6854 CB GLU H 71 40206 38333 31766 2773 -3388 -554 C ATOM 6855 CG GLU H 71 23.087 -62.601 -3.272 1.00282.28 C ANISOU 6855 CG GLU H 71 40162 36654 30437 2921 -3328 -93 C ATOM 6856 CD GLU H 71 23.817 -62.877 -1.959 1.00289.51 C ANISOU 6856 CD GLU H 71 41588 37471 30939 3833 -3969 -592 C ATOM 6857 OE1 GLU H 71 24.898 -63.521 -1.979 1.00297.87 O ANISOU 6857 OE1 GLU H 71 42491 38877 31809 4555 -4538 -1257 O ATOM 6858 OE2 GLU H 71 23.325 -62.451 -0.895 1.00288.89 O ANISOU 6858 OE2 GLU H 71 42082 36985 30696 3898 -3949 -380 O ATOM 6859 N LYS H 72 24.694 -63.284 -7.751 1.00291.87 N ANISOU 6859 N LYS H 72 39017 39383 32497 1941 -2873 -709 N ATOM 6860 CA LYS H 72 25.402 -63.050 -9.014 1.00287.27 C ANISOU 6860 CA LYS H 72 37592 39322 32233 1489 -2648 -1058 C ATOM 6861 C LYS H 72 24.480 -62.379 -10.068 1.00282.77 C ANISOU 6861 C LYS H 72 36997 38569 31872 672 -1999 -410 C ATOM 6862 O LYS H 72 24.959 -61.707 -10.995 1.00285.92 O ANISOU 6862 O LYS H 72 36854 39263 32518 114 -1651 -626 O ATOM 6863 CB LYS H 72 26.067 -64.335 -9.531 1.00283.05 C ANISOU 6863 CB LYS H 72 36953 39056 31538 2009 -2994 -1451 C ATOM 6864 CG LYS H 72 27.453 -64.546 -8.951 1.00282.40 C ANISOU 6864 CG LYS H 72 36393 39500 31404 2678 -3610 -2494 C ATOM 6865 CD LYS H 72 27.991 -65.941 -9.204 1.00277.40 C ANISOU 6865 CD LYS H 72 35907 39021 30471 3450 -4102 -2863 C ATOM 6866 CE LYS H 72 29.223 -66.171 -8.346 1.00280.62 C ANISOU 6866 CE LYS H 72 36024 39891 30707 4387 -4887 -3952 C ATOM 6867 NZ LYS H 72 29.463 -67.600 -8.004 1.00280.60 N ANISOU 6867 NZ LYS H 72 36777 39712 30126 5525 -5562 -4150 N ATOM 6868 N VAL H 73 23.164 -62.552 -9.911 1.00276.01 N ANISOU 6868 N VAL H 73 36778 37216 30875 626 -1826 295 N ATOM 6869 CA VAL H 73 22.187 -61.817 -10.726 1.00266.38 C ANISOU 6869 CA VAL H 73 35596 35822 29793 36 -1340 824 C ATOM 6870 C VAL H 73 21.633 -60.558 -10.012 1.00261.50 C ANISOU 6870 C VAL H 73 35152 34962 29241 -217 -1182 1050 C ATOM 6871 O VAL H 73 20.814 -59.850 -10.595 1.00265.13 O ANISOU 6871 O VAL H 73 35722 35261 29755 -583 -858 1429 O ATOM 6872 CB VAL H 73 21.030 -62.719 -11.264 1.00261.50 C ANISOU 6872 CB VAL H 73 35374 34941 29042 75 -1200 1300 C ATOM 6873 CG1 VAL H 73 21.564 -64.023 -11.846 1.00263.07 C ANISOU 6873 CG1 VAL H 73 35499 35321 29132 370 -1373 1092 C ATOM 6874 CG2 VAL H 73 19.987 -62.993 -10.188 1.00258.12 C ANISOU 6874 CG2 VAL H 73 35575 34067 28430 259 -1211 1587 C ATOM 6875 N LEU H 74 22.080 -60.279 -8.776 1.00253.35 N ANISOU 6875 N LEU H 74 34178 33909 28173 44 -1451 783 N ATOM 6876 CA LEU H 74 21.619 -59.095 -7.999 1.00243.43 C ANISOU 6876 CA LEU H 74 33085 32428 26977 -170 -1328 966 C ATOM 6877 C LEU H 74 22.042 -57.704 -8.528 1.00254.68 C ANISOU 6877 C LEU H 74 34160 33996 28611 -751 -979 832 C ATOM 6878 O LEU H 74 21.181 -56.807 -8.590 1.00250.12 O ANISOU 6878 O LEU H 74 33873 33130 28029 -1031 -719 1245 O ATOM 6879 CB LEU H 74 21.913 -59.220 -6.494 1.00230.82 C ANISOU 6879 CB LEU H 74 31741 30721 25238 308 -1718 735 C ATOM 6880 CG LEU H 74 20.956 -60.026 -5.608 1.00220.02 C ANISOU 6880 CG LEU H 74 31149 28876 23571 685 -1827 1089 C ATOM 6881 CD1 LEU H 74 21.086 -59.600 -4.158 1.00215.96 C ANISOU 6881 CD1 LEU H 74 30957 28166 22930 982 -2074 959 C ATOM 6882 CD2 LEU H 74 19.507 -59.897 -6.059 1.00212.89 C ANISOU 6882 CD2 LEU H 74 30509 27677 22703 303 -1415 1645 C ATOM 6883 N PRO H 75 23.347 -57.512 -8.902 1.00270.50 N ANISOU 6883 N PRO H 75 35593 36420 30762 -942 -937 188 N ATOM 6884 CA PRO H 75 23.724 -56.247 -9.567 1.00282.93 C ANISOU 6884 CA PRO H 75 36998 38031 32469 -1644 -416 37 C ATOM 6885 C PRO H 75 22.895 -55.996 -10.840 1.00294.55 C ANISOU 6885 C PRO H 75 38859 39224 33832 -1980 -9 599 C ATOM 6886 O PRO H 75 22.312 -54.904 -10.979 1.00294.47 O ANISOU 6886 O PRO H 75 39271 38877 33738 -2288 301 928 O ATOM 6887 CB PRO H 75 25.218 -56.439 -9.897 1.00283.14 C ANISOU 6887 CB PRO H 75 36293 38614 32670 -1806 -389 -874 C ATOM 6888 CG PRO H 75 25.690 -57.443 -8.906 1.00279.38 C ANISOU 6888 CG PRO H 75 35594 38403 32152 -1033 -1066 -1283 C ATOM 6889 CD PRO H 75 24.527 -58.391 -8.753 1.00275.34 C ANISOU 6889 CD PRO H 75 35727 37488 31399 -548 -1316 -524 C ATOM 6890 N GLN H 76 22.824 -57.001 -11.730 1.00307.19 N ANISOU 6890 N GLN H 76 40379 40949 35389 -1839 -60 683 N ATOM 6891 CA GLN H 76 21.987 -56.972 -12.963 1.00308.98 C ANISOU 6891 CA GLN H 76 40975 40950 35473 -1994 211 1173 C ATOM 6892 C GLN H 76 20.448 -56.814 -12.715 1.00313.53 C ANISOU 6892 C GLN H 76 42065 41152 35909 -1733 106 1786 C ATOM 6893 O GLN H 76 19.746 -56.166 -13.501 1.00325.22 O ANISOU 6893 O GLN H 76 43941 42395 37232 -1856 327 2093 O ATOM 6894 CB GLN H 76 22.319 -58.179 -13.885 1.00297.89 C ANISOU 6894 CB GLN H 76 39293 39814 34076 -1865 137 1053 C ATOM 6895 CG GLN H 76 21.650 -58.185 -15.265 1.00287.08 C ANISOU 6895 CG GLN H 76 38242 38281 32553 -2007 402 1433 C ATOM 6896 CD GLN H 76 21.933 -56.940 -16.108 1.00290.26 C ANISOU 6896 CD GLN H 76 38988 38473 32822 -2558 938 1410 C ATOM 6897 OE1 GLN H 76 23.074 -56.478 -16.207 1.00290.93 O ANISOU 6897 OE1 GLN H 76 38825 38715 32998 -3032 1268 899 O ATOM 6898 NE2 GLN H 76 20.883 -56.396 -16.727 1.00289.06 N ANISOU 6898 NE2 GLN H 76 39471 37948 32410 -2483 1046 1888 N ATOM 6899 N LEU H 77 19.929 -57.376 -11.623 1.00306.74 N ANISOU 6899 N LEU H 77 41245 40233 35067 -1356 -217 1882 N ATOM 6900 CA LEU H 77 18.497 -57.244 -11.301 1.00287.06 C ANISOU 6900 CA LEU H 77 39123 37458 32488 -1182 -258 2282 C ATOM 6901 C LEU H 77 18.121 -55.889 -10.690 1.00280.95 C ANISOU 6901 C LEU H 77 38613 36442 31690 -1314 -169 2407 C ATOM 6902 O LEU H 77 17.017 -55.387 -10.892 1.00284.47 O ANISOU 6902 O LEU H 77 39353 36695 32036 -1239 -130 2663 O ATOM 6903 CB LEU H 77 18.055 -58.369 -10.369 1.00274.41 C ANISOU 6903 CB LEU H 77 37593 35802 30865 -841 -496 2288 C ATOM 6904 CG LEU H 77 16.594 -58.375 -9.918 1.00262.23 C ANISOU 6904 CG LEU H 77 36345 34019 29271 -751 -455 2521 C ATOM 6905 CD1 LEU H 77 15.670 -58.899 -11.010 1.00255.94 C ANISOU 6905 CD1 LEU H 77 35510 33290 28443 -733 -346 2609 C ATOM 6906 CD2 LEU H 77 16.481 -59.182 -8.640 1.00254.27 C ANISOU 6906 CD2 LEU H 77 35590 32833 28186 -541 -573 2448 C ATOM 6907 N LEU H 78 19.023 -55.297 -9.926 1.00265.30 N ANISOU 6907 N LEU H 78 36507 34500 29794 -1465 -167 2155 N ATOM 6908 CA LEU H 78 18.682 -54.041 -9.302 1.00250.83 C ANISOU 6908 CA LEU H 78 34950 32420 27932 -1596 -73 2273 C ATOM 6909 C LEU H 78 18.966 -52.874 -10.214 1.00252.77 C ANISOU 6909 C LEU H 78 35470 32513 28057 -2001 315 2288 C ATOM 6910 O LEU H 78 18.384 -51.818 -10.051 1.00240.85 O ANISOU 6910 O LEU H 78 34398 30701 26412 -2046 418 2495 O ATOM 6911 CB LEU H 78 19.297 -53.940 -7.923 1.00244.83 C ANISOU 6911 CB LEU H 78 34018 31720 27287 -1518 -267 2009 C ATOM 6912 CG LEU H 78 18.528 -55.015 -7.145 1.00237.53 C ANISOU 6912 CG LEU H 78 33223 30713 26314 -1086 -559 2165 C ATOM 6913 CD1 LEU H 78 19.249 -55.483 -5.887 1.00237.53 C ANISOU 6913 CD1 LEU H 78 33159 30776 26315 -792 -868 1859 C ATOM 6914 CD2 LEU H 78 17.102 -54.562 -6.859 1.00234.15 C ANISOU 6914 CD2 LEU H 78 33146 29999 25821 -1039 -499 2518 C ATOM 6915 N LEU H 79 19.827 -53.100 -11.209 1.00267.72 N ANISOU 6915 N LEU H 79 37199 34573 29949 -2283 557 2053 N ATOM 6916 CA LEU H 79 19.859 -52.304 -12.454 1.00294.42 C ANISOU 6916 CA LEU H 79 41083 37702 33081 -2624 997 2151 C ATOM 6917 C LEU H 79 18.508 -52.242 -13.221 1.00314.72 C ANISOU 6917 C LEU H 79 44207 40006 35365 -2241 882 2618 C ATOM 6918 O LEU H 79 18.074 -51.137 -13.589 1.00328.50 O ANISOU 6918 O LEU H 79 46667 41353 36796 -2273 1073 2807 O ATOM 6919 CB LEU H 79 20.914 -52.852 -13.415 1.00302.37 C ANISOU 6919 CB LEU H 79 41773 38970 34142 -2958 1264 1791 C ATOM 6920 CG LEU H 79 22.209 -52.227 -13.913 1.00312.36 C ANISOU 6920 CG LEU H 79 42980 40282 35419 -3670 1851 1263 C ATOM 6921 CD1 LEU H 79 22.845 -53.304 -14.767 1.00318.01 C ANISOU 6921 CD1 LEU H 79 43217 41372 36240 -3713 1867 982 C ATOM 6922 CD2 LEU H 79 22.001 -50.984 -14.765 1.00317.58 C ANISOU 6922 CD2 LEU H 79 44615 40376 35672 -4084 2438 1466 C ATOM 6923 N ASP H 80 17.903 -53.418 -13.510 1.00330.31 N ANISOU 6923 N ASP H 80 45889 42201 37411 -1864 582 2720 N ATOM 6924 CA ASP H 80 16.578 -53.581 -14.228 1.00335.33 C ANISOU 6924 CA ASP H 80 46830 42741 37838 -1426 396 2977 C ATOM 6925 C ASP H 80 15.354 -53.112 -13.369 1.00344.10 C ANISOU 6925 C ASP H 80 48091 43724 38927 -1074 137 3096 C ATOM 6926 O ASP H 80 14.267 -52.819 -13.915 1.00352.44 O ANISOU 6926 O ASP H 80 49461 44689 39759 -684 -18 3169 O ATOM 6927 CB ASP H 80 16.352 -55.042 -14.758 1.00312.05 C ANISOU 6927 CB ASP H 80 43440 40110 35015 -1223 226 2929 C ATOM 6928 CG ASP H 80 16.844 -55.277 -16.225 1.00295.12 C ANISOU 6928 CG ASP H 80 41431 37998 32701 -1346 431 2915 C ATOM 6929 OD1 ASP H 80 17.295 -54.339 -16.925 1.00294.56 O ANISOU 6929 OD1 ASP H 80 41897 37656 32365 -1594 750 2942 O ATOM 6930 OD2 ASP H 80 16.769 -56.434 -16.682 1.00275.75 O ANISOU 6930 OD2 ASP H 80 38618 35802 30351 -1216 316 2865 O ATOM 6931 N PHE H 81 15.547 -53.031 -12.042 1.00340.78 N ANISOU 6931 N PHE H 81 47440 43321 38720 -1171 70 3038 N ATOM 6932 CA PHE H 81 14.534 -52.514 -11.099 1.00328.09 C ANISOU 6932 CA PHE H 81 45955 41587 37118 -938 -106 3101 C ATOM 6933 C PHE H 81 14.996 -51.281 -10.319 1.00329.52 C ANISOU 6933 C PHE H 81 46419 41519 37264 -1156 12 3136 C ATOM 6934 O PHE H 81 14.385 -50.208 -10.380 1.00330.22 O ANISOU 6934 O PHE H 81 47001 41341 37124 -1012 6 3248 O ATOM 6935 CB PHE H 81 14.075 -53.618 -10.136 1.00310.60 C ANISOU 6935 CB PHE H 81 43327 39548 35137 -824 -266 2999 C ATOM 6936 CG PHE H 81 13.190 -54.656 -10.781 1.00293.00 C ANISOU 6936 CG PHE H 81 40898 37509 32918 -609 -337 2908 C ATOM 6937 CD1 PHE H 81 12.029 -54.271 -11.453 1.00288.03 C ANISOU 6937 CD1 PHE H 81 40383 36908 32146 -300 -445 2836 C ATOM 6938 CD2 PHE H 81 13.513 -56.015 -10.724 1.00280.62 C ANISOU 6938 CD2 PHE H 81 39052 36099 31471 -668 -314 2818 C ATOM 6939 CE1 PHE H 81 11.206 -55.221 -12.046 1.00277.50 C ANISOU 6939 CE1 PHE H 81 38767 35819 30852 -122 -497 2618 C ATOM 6940 CE2 PHE H 81 12.695 -56.969 -11.320 1.00268.93 C ANISOU 6940 CE2 PHE H 81 37397 34781 30002 -544 -306 2683 C ATOM 6941 CZ PHE H 81 11.546 -56.565 -11.987 1.00269.39 C ANISOU 6941 CZ PHE H 81 37450 34926 29978 -304 -383 2555 C TER 6942 PHE H 81 ATOM 6943 N SER A 14 40.924 -88.506 -26.131 1.00281.61 N ANISOU 6943 N SER A 14 40688 33180 33130 866 3190 3574 N ATOM 6944 CA SER A 14 42.025 -89.441 -25.765 1.00274.75 C ANISOU 6944 CA SER A 14 39151 32732 32506 455 3679 3567 C ATOM 6945 C SER A 14 41.573 -90.747 -25.099 1.00275.29 C ANISOU 6945 C SER A 14 38240 33288 33069 620 3440 3540 C ATOM 6946 O SER A 14 40.416 -90.895 -24.696 1.00269.39 O ANISOU 6946 O SER A 14 37183 32621 32552 985 2971 3501 O ATOM 6947 CB SER A 14 43.112 -88.755 -24.940 1.00268.67 C ANISOU 6947 CB SER A 14 38196 32093 31791 5 4228 3526 C ATOM 6948 OG SER A 14 44.266 -89.571 -25.003 1.00259.16 O ANISOU 6948 OG SER A 14 36608 31157 30701 -362 4679 3450 O ATOM 6949 N TYR A 15 42.488 -91.713 -25.028 1.00282.89 N ANISOU 6949 N TYR A 15 38750 34552 34181 344 3771 3522 N ATOM 6950 CA TYR A 15 42.138 -92.991 -24.461 1.00290.57 C ANISOU 6950 CA TYR A 15 38924 35929 35550 475 3575 3504 C ATOM 6951 C TYR A 15 41.890 -92.641 -23.033 1.00294.73 C ANISOU 6951 C TYR A 15 38896 36698 36389 473 3543 3477 C ATOM 6952 O TYR A 15 40.798 -92.824 -22.506 1.00290.13 O ANISOU 6952 O TYR A 15 37993 36206 36034 747 3179 3449 O ATOM 6953 CB TYR A 15 43.228 -94.057 -24.666 1.00291.10 C ANISOU 6953 CB TYR A 15 38673 36240 35690 206 3906 3467 C ATOM 6954 CG TYR A 15 42.609 -95.375 -25.114 1.00292.54 C ANISOU 6954 CG TYR A 15 38603 36549 36000 449 3592 3488 C ATOM 6955 CD1 TYR A 15 42.538 -95.740 -26.474 1.00298.89 C ANISOU 6955 CD1 TYR A 15 39919 37113 36530 531 3521 3516 C ATOM 6956 CD2 TYR A 15 42.019 -96.233 -24.176 1.00286.39 C ANISOU 6956 CD2 TYR A 15 37129 36095 35591 597 3366 3470 C ATOM 6957 CE1 TYR A 15 41.921 -96.939 -26.874 1.00299.14 C ANISOU 6957 CE1 TYR A 15 39704 37263 36692 766 3219 3523 C ATOM 6958 CE2 TYR A 15 41.408 -97.428 -24.565 1.00288.25 C ANISOU 6958 CE2 TYR A 15 37148 36430 35942 798 3104 3468 C ATOM 6959 CZ TYR A 15 41.355 -97.777 -25.900 1.00294.77 C ANISOU 6959 CZ TYR A 15 38418 37050 36529 892 3019 3493 C ATOM 6960 OH TYR A 15 40.742 -98.970 -26.227 1.00296.53 O ANISOU 6960 OH TYR A 15 38386 37391 36891 1086 2762 3476 O ATOM 6961 N GLN A 16 42.916 -92.029 -22.473 1.00310.18 N ANISOU 6961 N GLN A 16 40801 38719 38331 143 3952 3449 N ATOM 6962 CA GLN A 16 42.844 -91.350 -21.214 1.00327.49 C ANISOU 6962 CA GLN A 16 42660 41048 40720 95 3987 3428 C ATOM 6963 C GLN A 16 41.598 -90.434 -21.085 1.00333.32 C ANISOU 6963 C GLN A 16 43667 41559 41418 400 3612 3450 C ATOM 6964 O GLN A 16 40.922 -90.535 -20.070 1.00350.46 O ANISOU 6964 O GLN A 16 45338 43933 43888 526 3423 3414 O ATOM 6965 CB GLN A 16 44.180 -90.622 -20.977 1.00335.34 C ANISOU 6965 CB GLN A 16 43756 42041 41616 -309 4499 3356 C ATOM 6966 CG GLN A 16 45.385 -91.562 -21.174 1.00335.67 C ANISOU 6966 CG GLN A 16 43488 42311 41739 -570 4823 3238 C ATOM 6967 CD GLN A 16 46.422 -91.092 -22.200 1.00340.82 C ANISOU 6967 CD GLN A 16 44687 42726 42082 -912 5285 3129 C ATOM 6968 OE1 GLN A 16 46.895 -89.948 -22.159 1.00344.40 O ANISOU 6968 OE1 GLN A 16 45505 42986 42363 -1157 5601 3065 O ATOM 6969 NE2 GLN A 16 46.814 -92.002 -23.105 1.00339.81 N ANISOU 6969 NE2 GLN A 16 44615 42611 41885 -967 5367 3080 N ATOM 6970 N GLN A 17 41.272 -89.605 -22.099 1.00324.49 N ANISOU 6970 N GLN A 17 43345 40011 39934 531 3488 3476 N ATOM 6971 CA GLN A 17 40.176 -88.579 -22.003 1.00315.26 C ANISOU 6971 CA GLN A 17 42507 38578 38697 854 3097 3445 C ATOM 6972 C GLN A 17 38.721 -89.041 -21.810 1.00309.01 C ANISOU 6972 C GLN A 17 41349 37871 38187 1291 2537 3329 C ATOM 6973 O GLN A 17 38.016 -88.513 -20.948 1.00302.47 O ANISOU 6973 O GLN A 17 40236 37109 37576 1428 2350 3235 O ATOM 6974 CB GLN A 17 40.197 -87.585 -23.176 1.00319.16 C ANISOU 6974 CB GLN A 17 44074 38523 38668 927 3052 3483 C ATOM 6975 CG GLN A 17 40.908 -86.254 -22.946 1.00322.56 C ANISOU 6975 CG GLN A 17 45004 38718 38834 643 3418 3516 C ATOM 6976 CD GLN A 17 40.937 -85.392 -24.196 1.00328.36 C ANISOU 6976 CD GLN A 17 46941 38843 38977 694 3396 3555 C ATOM 6977 OE1 GLN A 17 41.577 -85.759 -25.186 1.00333.83 O ANISOU 6977 OE1 GLN A 17 48103 39359 39375 499 3656 3587 O ATOM 6978 NE2 GLN A 17 40.265 -84.245 -24.153 1.00324.92 N ANISOU 6978 NE2 GLN A 17 47053 38057 38342 949 3095 3538 N ATOM 6979 N ARG A 18 38.232 -89.965 -22.625 1.00309.59 N ANISOU 6979 N ARG A 18 41437 37928 38264 1508 2273 3290 N ATOM 6980 CA ARG A 18 36.885 -90.430 -22.338 1.00321.00 C ANISOU 6980 CA ARG A 18 42427 39495 40042 1871 1802 3099 C ATOM 6981 C ARG A 18 36.947 -91.459 -21.227 1.00326.95 C ANISOU 6981 C ARG A 18 42293 40713 41216 1674 1994 3074 C ATOM 6982 O ARG A 18 35.971 -91.682 -20.515 1.00327.78 O ANISOU 6982 O ARG A 18 41900 40981 41660 1823 1778 2890 O ATOM 6983 CB ARG A 18 36.148 -90.971 -23.554 1.00321.74 C ANISOU 6983 CB ARG A 18 42836 39387 40024 2232 1375 3001 C ATOM 6984 CG ARG A 18 34.635 -90.813 -23.442 1.00326.05 C ANISOU 6984 CG ARG A 18 43169 39885 40827 2695 795 2693 C ATOM 6985 CD ARG A 18 33.855 -92.061 -23.827 1.00324.88 C ANISOU 6985 CD ARG A 18 42598 39902 40940 2905 516 2507 C ATOM 6986 NE ARG A 18 34.299 -93.250 -23.090 1.00320.46 N ANISOU 6986 NE ARG A 18 41327 39766 40664 2562 897 2589 N ATOM 6987 CZ ARG A 18 33.828 -93.651 -21.909 1.00316.86 C ANISOU 6987 CZ ARG A 18 40145 39627 40621 2451 986 2443 C ATOM 6988 NH1 ARG A 18 34.315 -94.747 -21.335 1.00307.79 N ANISOU 6988 NH1 ARG A 18 38524 38788 39635 2154 1316 2541 N ATOM 6989 NH2 ARG A 18 32.877 -92.967 -21.293 1.00315.33 N ANISOU 6989 NH2 ARG A 18 39731 39418 40659 2634 749 2178 N ATOM 6990 N LEU A 19 38.098 -92.086 -21.059 1.00338.66 N ANISOU 6990 N LEU A 19 43607 42393 42674 1335 2405 3221 N ATOM 6991 CA LEU A 19 38.259 -92.895 -19.867 1.00351.77 C ANISOU 6991 CA LEU A 19 44553 44435 44668 1151 2582 3206 C ATOM 6992 C LEU A 19 38.392 -92.066 -18.546 1.00365.16 C ANISOU 6992 C LEU A 19 46000 46236 46505 1000 2747 3195 C ATOM 6993 O LEU A 19 37.894 -92.502 -17.478 1.00377.14 O ANISOU 6993 O LEU A 19 46996 47977 48320 977 2730 3109 O ATOM 6994 CB LEU A 19 39.293 -94.014 -20.075 1.00340.11 C ANISOU 6994 CB LEU A 19 42913 43145 43165 928 2852 3301 C ATOM 6995 CG LEU A 19 38.627 -95.204 -20.788 1.00328.56 C ANISOU 6995 CG LEU A 19 41343 41719 41775 1124 2603 3249 C ATOM 6996 CD1 LEU A 19 39.653 -96.273 -21.150 1.00319.12 C ANISOU 6996 CD1 LEU A 19 40059 40670 40520 937 2834 3335 C ATOM 6997 CD2 LEU A 19 37.495 -95.814 -19.960 1.00322.81 C ANISOU 6997 CD2 LEU A 19 40088 41171 41394 1245 2404 3093 C ATOM 6998 N LYS A 20 38.986 -90.858 -18.626 1.00367.53 N ANISOU 6998 N LYS A 20 46718 46346 46579 892 2910 3264 N ATOM 6999 CA LYS A 20 38.842 -89.835 -17.533 1.00355.27 C ANISOU 6999 CA LYS A 20 45032 44817 45135 834 2968 3231 C ATOM 7000 C LYS A 20 37.363 -89.417 -17.349 1.00345.59 C ANISOU 7000 C LYS A 20 43732 43498 44079 1166 2550 3055 C ATOM 7001 O LYS A 20 36.952 -89.063 -16.236 1.00340.92 O ANISOU 7001 O LYS A 20 42776 43036 43719 1134 2560 2969 O ATOM 7002 CB LYS A 20 39.731 -88.578 -17.722 1.00360.08 C ANISOU 7002 CB LYS A 20 46152 45208 45453 646 3234 3316 C ATOM 7003 CG LYS A 20 41.035 -88.515 -16.912 1.00358.17 C ANISOU 7003 CG LYS A 20 45647 45179 45260 269 3685 3356 C ATOM 7004 CD LYS A 20 41.242 -87.165 -16.225 1.00348.59 C ANISOU 7004 CD LYS A 20 44575 43871 44000 154 3832 3354 C ATOM 7005 CE LYS A 20 42.697 -86.699 -16.182 1.00346.67 C ANISOU 7005 CE LYS A 20 44463 43637 43618 -222 4311 3350 C ATOM 7006 NZ LYS A 20 43.270 -86.251 -17.484 1.00352.19 N ANISOU 7006 NZ LYS A 20 45870 44011 43934 -352 4516 3363 N ATOM 7007 N ALA A 21 36.599 -89.476 -18.451 1.00338.39 N ANISOU 7007 N ALA A 21 43161 42356 43054 1487 2180 2964 N ATOM 7008 CA ALA A 21 35.144 -89.293 -18.486 1.00331.93 C ANISOU 7008 CA ALA A 21 42222 41457 42439 1867 1706 2692 C ATOM 7009 C ALA A 21 34.338 -90.414 -17.821 1.00324.17 C ANISOU 7009 C ALA A 21 40506 40784 41880 1876 1645 2488 C ATOM 7010 O ALA A 21 33.333 -90.148 -17.172 1.00322.08 O ANISOU 7010 O ALA A 21 39894 40576 41906 2008 1460 2219 O ATOM 7011 CB ALA A 21 34.704 -89.139 -19.921 1.00339.12 C ANISOU 7011 CB ALA A 21 43748 42020 43080 2221 1312 2633 C ATOM 7012 N ALA A 22 34.757 -91.660 -18.019 1.00316.46 N ANISOU 7012 N ALA A 22 39324 39983 40931 1729 1809 2582 N ATOM 7013 CA ALA A 22 34.197 -92.777 -17.275 1.00310.42 C ANISOU 7013 CA ALA A 22 37937 39496 40511 1636 1869 2427 C ATOM 7014 C ALA A 22 34.648 -92.803 -15.805 1.00314.57 C ANISOU 7014 C ALA A 22 38095 40244 41183 1309 2229 2497 C ATOM 7015 O ALA A 22 33.884 -93.240 -14.968 1.00310.56 O ANISOU 7015 O ALA A 22 37156 39879 40961 1250 2255 2292 O ATOM 7016 CB ALA A 22 34.513 -94.098 -17.952 1.00299.73 C ANISOU 7016 CB ALA A 22 36544 38229 39109 1596 1913 2510 C ATOM 7017 N VAL A 23 35.875 -92.355 -15.493 1.00323.70 N ANISOU 7017 N VAL A 23 39435 41415 42141 1088 2514 2747 N ATOM 7018 CA VAL A 23 36.337 -92.149 -14.086 1.00324.49 C ANISOU 7018 CA VAL A 23 39263 41680 42346 827 2799 2799 C ATOM 7019 C VAL A 23 35.484 -91.049 -13.453 1.00336.29 C ANISOU 7019 C VAL A 23 40683 43104 43988 919 2681 2628 C ATOM 7020 O VAL A 23 34.911 -91.233 -12.359 1.00341.22 O ANISOU 7020 O VAL A 23 40930 43861 44857 816 2762 2480 O ATOM 7021 CB VAL A 23 37.844 -91.734 -13.973 1.00313.91 C ANISOU 7021 CB VAL A 23 38131 40356 40784 608 3089 3025 C ATOM 7022 CG1 VAL A 23 38.155 -91.137 -12.611 1.00304.41 C ANISOU 7022 CG1 VAL A 23 36728 39256 39677 426 3285 3033 C ATOM 7023 CG2 VAL A 23 38.778 -92.909 -14.226 1.00304.32 C ANISOU 7023 CG2 VAL A 23 36849 39278 39501 477 3243 3128 C ATOM 7024 N HIS A 24 35.424 -89.917 -14.170 1.00344.33 N ANISOU 7024 N HIS A 24 42116 43883 44827 1105 2501 2639 N ATOM 7025 CA HIS A 24 34.578 -88.751 -13.861 1.00344.80 C ANISOU 7025 CA HIS A 24 42215 43810 44982 1286 2288 2454 C ATOM 7026 C HIS A 24 33.160 -89.253 -13.564 1.00349.52 C ANISOU 7026 C HIS A 24 42358 44497 45946 1449 2054 2085 C ATOM 7027 O HIS A 24 32.514 -88.764 -12.638 1.00350.99 O ANISOU 7027 O HIS A 24 42249 44742 46367 1426 2058 1878 O ATOM 7028 CB HIS A 24 34.610 -87.738 -15.044 1.00334.86 C ANISOU 7028 CB HIS A 24 41619 42202 43407 1546 2027 2496 C ATOM 7029 CG HIS A 24 34.447 -86.274 -14.676 1.00324.58 C ANISOU 7029 CG HIS A 24 40568 40719 42037 1627 1947 2456 C ATOM 7030 ND1 HIS A 24 34.816 -85.724 -13.461 1.00321.08 N ANISOU 7030 ND1 HIS A 24 39883 40414 41697 1382 2225 2512 N ATOM 7031 CD2 HIS A 24 33.997 -85.233 -15.424 1.00320.90 C ANISOU 7031 CD2 HIS A 24 40654 39907 41365 1944 1599 2372 C ATOM 7032 CE1 HIS A 24 34.557 -84.427 -13.464 1.00319.06 C ANISOU 7032 CE1 HIS A 24 39961 39931 41334 1533 2067 2459 C ATOM 7033 NE2 HIS A 24 34.074 -84.101 -14.647 1.00318.44 N ANISOU 7033 NE2 HIS A 24 40393 39544 41053 1878 1682 2376 N ATOM 7034 N TYR A 25 32.707 -90.262 -14.307 1.00350.71 N ANISOU 7034 N TYR A 25 42420 44671 46162 1576 1893 1971 N ATOM 7035 CA TYR A 25 31.395 -90.852 -14.072 1.00351.27 C ANISOU 7035 CA TYR A 25 42017 44841 46607 1686 1723 1555 C ATOM 7036 C TYR A 25 31.246 -91.637 -12.762 1.00335.13 C ANISOU 7036 C TYR A 25 39471 43044 44817 1331 2093 1469 C ATOM 7037 O TYR A 25 30.318 -91.364 -12.003 1.00340.02 O ANISOU 7037 O TYR A 25 39738 43716 45736 1309 2091 1125 O ATOM 7038 CB TYR A 25 30.968 -91.707 -15.257 1.00369.62 C ANISOU 7038 CB TYR A 25 44400 47111 48927 1917 1452 1437 C ATOM 7039 CG TYR A 25 29.920 -92.763 -14.933 1.00390.92 C ANISOU 7039 CG TYR A 25 46538 49982 52009 1876 1454 1045 C ATOM 7040 CD1 TYR A 25 28.552 -92.484 -15.041 1.00404.98 C ANISOU 7040 CD1 TYR A 25 48019 51727 54128 2151 1112 503 C ATOM 7041 CD2 TYR A 25 30.294 -94.052 -14.535 1.00393.61 C ANISOU 7041 CD2 TYR A 25 46666 50508 52379 1561 1797 1169 C ATOM 7042 CE1 TYR A 25 27.595 -93.459 -14.758 1.00415.79 C ANISOU 7042 CE1 TYR A 25 48853 53254 55873 2061 1176 75 C ATOM 7043 CE2 TYR A 25 29.344 -95.033 -14.245 1.00404.01 C ANISOU 7043 CE2 TYR A 25 47535 51951 54019 1470 1861 796 C ATOM 7044 CZ TYR A 25 27.996 -94.735 -14.365 1.00413.44 C ANISOU 7044 CZ TYR A 25 48401 53121 55566 1695 1579 238 C ATOM 7045 OH TYR A 25 27.059 -95.705 -14.093 1.00418.76 O ANISOU 7045 OH TYR A 25 48607 53918 56581 1558 1699 -196 O ATOM 7046 N THR A 26 32.135 -92.604 -12.506 1.00313.32 N ANISOU 7046 N THR A 26 36713 40406 41925 1062 2400 1745 N ATOM 7047 CA THR A 26 31.983 -93.525 -11.367 1.00297.57 C ANISOU 7047 CA THR A 26 34383 38581 40099 744 2725 1666 C ATOM 7048 C THR A 26 32.062 -92.767 -10.064 1.00298.08 C ANISOU 7048 C THR A 26 34346 38681 40227 546 2943 1661 C ATOM 7049 O THR A 26 31.318 -93.012 -9.110 1.00296.88 O ANISOU 7049 O THR A 26 33898 38593 40306 362 3119 1397 O ATOM 7050 CB THR A 26 33.077 -94.599 -11.352 1.00288.22 C ANISOU 7050 CB THR A 26 33332 37479 38699 552 2945 1985 C ATOM 7051 OG1 THR A 26 33.058 -95.313 -12.588 1.00285.61 O ANISOU 7051 OG1 THR A 26 33105 37115 38296 725 2757 2006 O ATOM 7052 CG2 THR A 26 32.825 -95.578 -10.247 1.00286.33 C ANISOU 7052 CG2 THR A 26 32877 37339 38576 259 3235 1883 C ATOM 7053 N VAL A 27 32.995 -91.838 -10.041 1.00302.29 N ANISOU 7053 N VAL A 27 35152 39160 40543 561 2960 1940 N ATOM 7054 CA VAL A 27 33.165 -90.976 -8.906 1.00310.58 C ANISOU 7054 CA VAL A 27 36149 40230 41627 408 3132 1962 C ATOM 7055 C VAL A 27 31.933 -90.048 -8.742 1.00321.71 C ANISOU 7055 C VAL A 27 37366 41574 43294 570 2939 1596 C ATOM 7056 O VAL A 27 31.546 -89.734 -7.623 1.00329.65 O ANISOU 7056 O VAL A 27 38150 42633 44466 397 3116 1444 O ATOM 7057 CB VAL A 27 34.505 -90.217 -9.010 1.00307.40 C ANISOU 7057 CB VAL A 27 36073 39784 40939 377 3209 2309 C ATOM 7058 CG1 VAL A 27 34.702 -89.313 -7.806 1.00306.15 C ANISOU 7058 CG1 VAL A 27 35852 39651 40819 222 3381 2328 C ATOM 7059 CG2 VAL A 27 35.668 -91.203 -9.141 1.00304.56 C ANISOU 7059 CG2 VAL A 27 35815 39512 40391 235 3375 2559 C ATOM 7060 N GLY A 28 31.287 -89.656 -9.843 1.00326.45 N ANISOU 7060 N GLY A 28 38057 42047 43932 915 2558 1416 N ATOM 7061 CA GLY A 28 30.071 -88.810 -9.782 1.00323.29 C ANISOU 7061 CA GLY A 28 37458 41573 43802 1147 2281 984 C ATOM 7062 C GLY A 28 28.877 -89.484 -9.130 1.00316.60 C ANISOU 7062 C GLY A 28 36070 40857 43366 1023 2381 495 C ATOM 7063 O GLY A 28 28.037 -88.837 -8.485 1.00305.29 O ANISOU 7063 O GLY A 28 34350 39435 42209 1036 2351 122 O ATOM 7064 N CYS A 29 28.819 -90.798 -9.315 1.00316.14 N ANISOU 7064 N CYS A 29 35883 40890 43344 880 2524 473 N ATOM 7065 CA CYS A 29 27.873 -91.659 -8.631 1.00314.81 C ANISOU 7065 CA CYS A 29 35266 40837 43508 635 2764 47 C ATOM 7066 C CYS A 29 28.033 -91.510 -7.136 1.00303.68 C ANISOU 7066 C CYS A 29 33761 39491 42131 240 3199 79 C ATOM 7067 O CYS A 29 27.083 -91.158 -6.439 1.00297.77 O ANISOU 7067 O CYS A 29 32670 38770 41698 141 3295 -369 O ATOM 7068 CB CYS A 29 28.123 -93.126 -8.981 1.00320.81 C ANISOU 7068 CB CYS A 29 36054 41657 44182 481 2925 163 C ATOM 7069 SG CYS A 29 27.937 -93.541 -10.723 1.00328.29 S ANISOU 7069 SG CYS A 29 37118 42535 45081 900 2459 124 S ATOM 7070 N LEU A 30 29.239 -91.804 -6.651 1.00294.14 N ANISOU 7070 N LEU A 30 32860 38298 40602 23 3454 573 N ATOM 7071 CA LEU A 30 29.528 -91.786 -5.218 1.00286.76 C ANISOU 7071 CA LEU A 30 31936 37391 39626 -340 3851 651 C ATOM 7072 C LEU A 30 29.320 -90.425 -4.544 1.00286.36 C ANISOU 7072 C LEU A 30 31803 37318 39680 -314 3832 554 C ATOM 7073 O LEU A 30 28.881 -90.376 -3.393 1.00288.00 O ANISOU 7073 O LEU A 30 31856 37544 40026 -600 4135 346 O ATOM 7074 CB LEU A 30 30.923 -92.354 -4.921 1.00277.47 C ANISOU 7074 CB LEU A 30 31122 36222 38082 -489 4023 1159 C ATOM 7075 CG LEU A 30 31.174 -93.851 -5.154 1.00270.24 C ANISOU 7075 CG LEU A 30 30313 35319 37044 -613 4143 1248 C ATOM 7076 CD1 LEU A 30 32.487 -94.239 -4.502 1.00263.11 C ANISOU 7076 CD1 LEU A 30 29742 34409 35817 -759 4303 1650 C ATOM 7077 CD2 LEU A 30 30.059 -94.750 -4.639 1.00272.33 C ANISOU 7077 CD2 LEU A 30 30368 35575 37529 -881 4407 835 C ATOM 7078 N CYS A 31 29.596 -89.334 -5.264 1.00285.82 N ANISOU 7078 N CYS A 31 31880 37187 39531 12 3494 683 N ATOM 7079 CA CYS A 31 29.455 -87.968 -4.716 1.00288.27 C ANISOU 7079 CA CYS A 31 32164 37455 39909 73 3436 616 C ATOM 7080 C CYS A 31 28.014 -87.523 -4.517 1.00291.42 C ANISOU 7080 C CYS A 31 32147 37856 40720 166 3314 9 C ATOM 7081 O CYS A 31 27.699 -86.751 -3.610 1.00289.27 O ANISOU 7081 O CYS A 31 31728 37592 40588 57 3434 -155 O ATOM 7082 CB CYS A 31 30.186 -86.962 -5.590 1.00292.38 C ANISOU 7082 CB CYS A 31 33055 37859 40177 377 3131 922 C ATOM 7083 SG CYS A 31 31.972 -86.980 -5.339 1.00303.98 S ANISOU 7083 SG CYS A 31 34916 39347 41234 181 3380 1529 S ATOM 7084 N GLU A 32 27.150 -88.016 -5.384 1.00302.52 N ANISOU 7084 N GLU A 32 33344 39260 42339 377 3063 -361 N ATOM 7085 CA GLU A 32 25.730 -87.887 -5.185 1.00329.35 C ANISOU 7085 CA GLU A 32 36245 42694 46199 428 2983 -1063 C ATOM 7086 C GLU A 32 25.185 -88.708 -4.009 1.00343.29 C ANISOU 7086 C GLU A 32 37673 44566 48195 -77 3527 -1381 C ATOM 7087 O GLU A 32 24.317 -88.235 -3.287 1.00358.60 O ANISOU 7087 O GLU A 32 39250 46536 50464 -190 3645 -1873 O ATOM 7088 CB GLU A 32 25.009 -88.257 -6.475 1.00338.65 C ANISOU 7088 CB GLU A 32 37292 43837 47541 811 2542 -1407 C ATOM 7089 CG GLU A 32 24.482 -87.041 -7.207 1.00356.28 C ANISOU 7089 CG GLU A 32 39566 45933 49868 1345 1946 -1672 C ATOM 7090 CD GLU A 32 23.354 -86.376 -6.441 1.00373.14 C ANISOU 7090 CD GLU A 32 41196 48119 52459 1345 1929 -2337 C ATOM 7091 OE1 GLU A 32 22.282 -87.005 -6.324 1.00381.43 O ANISOU 7091 OE1 GLU A 32 41709 49274 53942 1261 1998 -2990 O ATOM 7092 OE2 GLU A 32 23.544 -85.241 -5.945 1.00381.47 O ANISOU 7092 OE2 GLU A 32 42375 49111 53454 1406 1874 -2238 O ATOM 7093 N GLU A 33 25.669 -89.940 -3.828 1.00348.41 N ANISOU 7093 N GLU A 33 38476 45244 48658 -385 3864 -1133 N ATOM 7094 CA GLU A 33 25.284 -90.764 -2.664 1.00356.12 C ANISOU 7094 CA GLU A 33 39320 46250 49738 -914 4436 -1366 C ATOM 7095 C GLU A 33 25.735 -90.150 -1.332 1.00362.53 C ANISOU 7095 C GLU A 33 40295 47031 50417 -1203 4763 -1166 C ATOM 7096 O GLU A 33 25.121 -90.388 -0.286 1.00370.14 O ANISOU 7096 O GLU A 33 41106 47985 51544 -1606 5200 -1516 O ATOM 7097 CB GLU A 33 25.837 -92.180 -2.785 1.00346.60 C ANISOU 7097 CB GLU A 33 38385 45029 48276 -1136 4672 -1076 C ATOM 7098 CG GLU A 33 24.932 -93.158 -3.513 1.00337.79 C ANISOU 7098 CG GLU A 33 36974 43949 47419 -1130 4649 -1532 C ATOM 7099 CD GLU A 33 25.511 -94.563 -3.561 1.00330.03 C ANISOU 7099 CD GLU A 33 36311 42931 46152 -1367 4901 -1225 C ATOM 7100 OE1 GLU A 33 26.301 -94.929 -2.657 1.00329.33 O ANISOU 7100 OE1 GLU A 33 36616 42772 45740 -1666 5229 -848 O ATOM 7101 OE2 GLU A 33 25.178 -95.320 -4.504 1.00322.24 O ANISOU 7101 OE2 GLU A 33 35206 41973 45255 -1234 4746 -1376 O ATOM 7102 N VAL A 34 26.821 -89.379 -1.385 1.00360.18 N ANISOU 7102 N VAL A 34 40331 46707 49814 -1017 4575 -625 N ATOM 7103 CA VAL A 34 27.254 -88.530 -0.273 1.00355.29 C ANISOU 7103 CA VAL A 34 39837 46063 49092 -1182 4767 -450 C ATOM 7104 C VAL A 34 26.259 -87.354 -0.094 1.00352.59 C ANISOU 7104 C VAL A 34 39113 45736 49117 -1045 4619 -935 C ATOM 7105 O VAL A 34 25.908 -87.018 1.051 1.00352.43 O ANISOU 7105 O VAL A 34 38975 45713 49216 -1340 4943 -1143 O ATOM 7106 CB VAL A 34 28.727 -88.050 -0.442 1.00353.06 C ANISOU 7106 CB VAL A 34 39981 45756 48406 -1026 4614 206 C ATOM 7107 CG1 VAL A 34 29.126 -87.100 0.677 1.00349.68 C ANISOU 7107 CG1 VAL A 34 39646 45309 47905 -1169 4780 341 C ATOM 7108 CG2 VAL A 34 29.694 -89.231 -0.457 1.00353.26 C ANISOU 7108 CG2 VAL A 34 40339 45774 48109 -1170 4766 596 C ATOM 7109 N ALA A 35 25.788 -86.768 -1.211 1.00345.44 N ANISOU 7109 N ALA A 35 38047 44825 48378 -591 4121 -1142 N ATOM 7110 CA ALA A 35 24.769 -85.683 -1.190 1.00337.98 C ANISOU 7110 CA ALA A 35 36736 43877 47804 -363 3865 -1681 C ATOM 7111 C ALA A 35 23.424 -86.098 -0.547 1.00340.60 C ANISOU 7111 C ALA A 35 36508 44284 48620 -644 4157 -2462 C ATOM 7112 O ALA A 35 22.663 -85.238 -0.098 1.00333.37 O ANISOU 7112 O ALA A 35 35259 43384 48022 -596 4104 -2932 O ATOM 7113 CB ALA A 35 24.571 -85.073 -2.588 1.00335.26 C ANISOU 7113 CB ALA A 35 36451 43454 47478 228 3210 -1751 C ATOM 7114 N LEU A 36 23.169 -87.415 -0.493 1.00348.13 N ANISOU 7114 N LEU A 36 37377 45274 49619 -958 4494 -2613 N ATOM 7115 CA LEU A 36 22.033 -88.038 0.235 1.00354.04 C ANISOU 7115 CA LEU A 36 37679 46072 50766 -1388 4957 -3331 C ATOM 7116 C LEU A 36 22.199 -88.087 1.776 1.00355.03 C ANISOU 7116 C LEU A 36 37956 46153 50783 -1963 5599 -3270 C ATOM 7117 O LEU A 36 21.280 -87.698 2.509 1.00367.14 O ANISOU 7117 O LEU A 36 39101 47713 52681 -2194 5856 -3880 O ATOM 7118 CB LEU A 36 21.771 -89.490 -0.259 1.00351.34 C ANISOU 7118 CB LEU A 36 37295 45747 50451 -1566 5140 -3483 C ATOM 7119 CG LEU A 36 20.714 -89.971 -1.268 1.00350.25 C ANISOU 7119 CG LEU A 36 36667 45679 50731 -1338 4871 -4148 C ATOM 7120 CD1 LEU A 36 21.074 -89.560 -2.690 1.00347.66 C ANISOU 7120 CD1 LEU A 36 36476 45335 50283 -674 4133 -3868 C ATOM 7121 CD2 LEU A 36 20.580 -91.487 -1.192 1.00348.00 C ANISOU 7121 CD2 LEU A 36 36433 45387 50403 -1768 5337 -4239 C ATOM 7122 N ASP A 37 23.353 -88.583 2.246 1.00341.44 N ANISOU 7122 N ASP A 37 36808 44353 48567 -2178 5839 -2580 N ATOM 7123 CA ASP A 37 23.595 -88.977 3.655 1.00323.48 C ANISOU 7123 CA ASP A 37 34843 41976 46086 -2739 6456 -2476 C ATOM 7124 C ASP A 37 23.550 -87.826 4.665 1.00316.92 C ANISOU 7124 C ASP A 37 33967 41131 45316 -2839 6578 -2532 C ATOM 7125 O ASP A 37 22.885 -87.916 5.711 1.00317.06 O ANISOU 7125 O ASP A 37 33884 41094 45488 -3300 7086 -2957 O ATOM 7126 CB ASP A 37 24.931 -89.746 3.758 1.00311.25 C ANISOU 7126 CB ASP A 37 33947 40334 43979 -2804 6520 -1727 C ATOM 7127 CG ASP A 37 25.381 -89.956 5.187 1.00304.56 C ANISOU 7127 CG ASP A 37 33555 39336 42828 -3254 7010 -1525 C ATOM 7128 OD1 ASP A 37 24.579 -90.458 5.995 1.00307.81 O ANISOU 7128 OD1 ASP A 37 33942 39651 43359 -3734 7533 -1978 O ATOM 7129 OD2 ASP A 37 26.539 -89.615 5.506 1.00295.49 O ANISOU 7129 OD2 ASP A 37 32811 38147 41314 -3135 6878 -946 O ATOM 7130 N LYS A 38 24.259 -86.752 4.335 1.00303.75 N ANISOU 7130 N LYS A 38 32399 39497 43515 -2432 6140 -2118 N ATOM 7131 CA LYS A 38 24.294 -85.569 5.161 1.00293.40 C ANISOU 7131 CA LYS A 38 31049 38179 42249 -2456 6177 -2123 C ATOM 7132 C LYS A 38 23.384 -84.470 4.622 1.00297.95 C ANISOU 7132 C LYS A 38 31106 38835 43264 -2085 5775 -2635 C ATOM 7133 O LYS A 38 23.188 -83.456 5.290 1.00297.77 O ANISOU 7133 O LYS A 38 30962 38813 43363 -2101 5801 -2772 O ATOM 7134 CB LYS A 38 25.745 -85.098 5.336 1.00279.78 C ANISOU 7134 CB LYS A 38 29831 36412 40060 -2314 6028 -1347 C ATOM 7135 CG LYS A 38 26.550 -85.997 6.275 1.00271.50 C ANISOU 7135 CG LYS A 38 29290 35254 38612 -2706 6446 -967 C ATOM 7136 CD LYS A 38 25.953 -85.980 7.672 1.00272.28 C ANISOU 7136 CD LYS A 38 29400 35261 38789 -3195 6981 -1304 C ATOM 7137 CE LYS A 38 26.076 -87.323 8.373 1.00274.14 C ANISOU 7137 CE LYS A 38 30081 35331 38746 -3651 7463 -1258 C ATOM 7138 NZ LYS A 38 24.915 -87.509 9.270 1.00282.23 N ANISOU 7138 NZ LYS A 38 30937 36273 40023 -4155 8020 -1891 N ATOM 7139 N ALA A 39 22.840 -84.684 3.416 1.00300.98 N ANISOU 7139 N ALA A 39 31217 39270 43871 -1729 5374 -2925 N ATOM 7140 CA ALA A 39 21.862 -83.795 2.751 1.00301.05 C ANISOU 7140 CA ALA A 39 30747 39325 44314 -1295 4890 -3517 C ATOM 7141 C ALA A 39 22.432 -82.440 2.327 1.00297.63 C ANISOU 7141 C ALA A 39 30545 38833 43706 -813 4369 -3148 C ATOM 7142 O ALA A 39 21.923 -81.372 2.711 1.00297.49 O ANISOU 7142 O ALA A 39 30296 38813 43923 -688 4233 -3481 O ATOM 7143 CB ALA A 39 20.602 -83.630 3.592 1.00303.40 C ANISOU 7143 CB ALA A 39 30473 39681 45123 -1596 5221 -4372 C ATOM 7144 N MET A 40 23.498 -82.510 1.530 1.00291.83 N ANISOU 7144 N MET A 40 30292 38037 42551 -567 4104 -2481 N ATOM 7145 CA MET A 40 24.229 -81.336 1.027 1.00286.97 C ANISOU 7145 CA MET A 40 30041 37323 41669 -167 3678 -2047 C ATOM 7146 C MET A 40 25.294 -81.807 0.042 1.00287.38 C ANISOU 7146 C MET A 40 30570 37318 41302 -1 3503 -1435 C ATOM 7147 O MET A 40 25.881 -82.873 0.217 1.00283.02 O ANISOU 7147 O MET A 40 30162 36814 40557 -292 3826 -1135 O ATOM 7148 CB MET A 40 24.906 -80.560 2.164 1.00276.75 C ANISOU 7148 CB MET A 40 28941 36017 40191 -412 3966 -1706 C ATOM 7149 CG MET A 40 25.014 -79.057 1.934 1.00265.31 C ANISOU 7149 CG MET A 40 27636 34470 38700 -38 3564 -1642 C ATOM 7150 SD MET A 40 23.919 -78.114 3.016 1.00258.79 S ANISOU 7150 SD MET A 40 26325 33684 38317 -129 3659 -2285 S ATOM 7151 CE MET A 40 22.360 -78.189 2.119 1.00265.61 C ANISOU 7151 CE MET A 40 26644 34560 39713 275 3184 -3192 C ATOM 7152 N GLN A 41 25.572 -80.980 -0.960 1.00295.20 N ANISOU 7152 N GLN A 41 31855 38180 42127 457 3006 -1261 N ATOM 7153 CA GLN A 41 26.270 -81.425 -2.174 1.00304.25 C ANISOU 7153 CA GLN A 41 33396 39246 42956 681 2766 -870 C ATOM 7154 C GLN A 41 27.670 -80.786 -2.380 1.00308.91 C ANISOU 7154 C GLN A 41 34565 39733 43073 705 2772 -197 C ATOM 7155 O GLN A 41 28.149 -80.006 -1.532 1.00310.05 O ANISOU 7155 O GLN A 41 34797 39877 43128 546 2963 -7 O ATOM 7156 CB GLN A 41 25.337 -81.238 -3.404 1.00310.03 C ANISOU 7156 CB GLN A 41 34053 39870 43873 1199 2174 -1312 C ATOM 7157 CG GLN A 41 25.102 -79.784 -3.876 1.00316.06 C ANISOU 7157 CG GLN A 41 35071 40427 44588 1669 1655 -1423 C ATOM 7158 CD GLN A 41 24.011 -79.001 -3.131 1.00322.52 C ANISOU 7158 CD GLN A 41 35425 41280 45837 1749 1549 -2048 C ATOM 7159 OE1 GLN A 41 22.806 -79.245 -3.299 1.00332.79 O ANISOU 7159 OE1 GLN A 41 36232 42633 47577 1929 1319 -2752 O ATOM 7160 NE2 GLN A 41 24.434 -78.013 -2.337 1.00319.60 N ANISOU 7160 NE2 GLN A 41 35199 40877 45357 1631 1697 -1833 N ATOM 7161 N PHE A 42 28.302 -81.133 -3.506 1.00317.38 N ANISOU 7161 N PHE A 42 36010 40718 43859 882 2587 114 N ATOM 7162 CA PHE A 42 29.581 -80.560 -3.911 1.00320.74 C ANISOU 7162 CA PHE A 42 36983 41025 43856 904 2598 655 C ATOM 7163 C PHE A 42 29.505 -79.655 -5.131 1.00312.41 C ANISOU 7163 C PHE A 42 36393 39705 42602 1346 2120 661 C ATOM 7164 O PHE A 42 28.602 -79.769 -5.969 1.00312.51 O ANISOU 7164 O PHE A 42 36369 39619 42750 1702 1703 315 O ATOM 7165 CB PHE A 42 30.577 -81.666 -4.226 1.00340.83 C ANISOU 7165 CB PHE A 42 39684 43650 46163 699 2837 1037 C ATOM 7166 CG PHE A 42 30.837 -82.615 -3.089 1.00370.11 C ANISOU 7166 CG PHE A 42 43111 47556 49956 289 3277 1097 C ATOM 7167 CD1 PHE A 42 31.163 -82.157 -1.809 1.00379.66 C ANISOU 7167 CD1 PHE A 42 44245 48829 51178 25 3571 1176 C ATOM 7168 CD2 PHE A 42 30.816 -83.988 -3.314 1.00389.95 C ANISOU 7168 CD2 PHE A 42 45513 50160 52489 173 3390 1094 C ATOM 7169 CE1 PHE A 42 31.427 -83.064 -0.775 1.00393.35 C ANISOU 7169 CE1 PHE A 42 45846 50685 52924 -329 3946 1236 C ATOM 7170 CE2 PHE A 42 31.087 -84.898 -2.292 1.00404.61 C ANISOU 7170 CE2 PHE A 42 47243 52136 54353 -188 3774 1159 C ATOM 7171 CZ PHE A 42 31.395 -84.430 -1.018 1.00402.31 C ANISOU 7171 CZ PHE A 42 46932 51877 54048 -432 4043 1230 C ATOM 7172 N SER A 43 30.500 -78.776 -5.214 1.00302.30 N ANISOU 7172 N SER A 43 35590 38288 40980 1307 2197 1043 N ATOM 7173 CA SER A 43 30.719 -77.914 -6.360 1.00305.97 C ANISOU 7173 CA SER A 43 36699 38437 41119 1637 1852 1156 C ATOM 7174 C SER A 43 31.219 -78.716 -7.584 1.00315.67 C ANISOU 7174 C SER A 43 38270 39580 42087 1706 1788 1364 C ATOM 7175 O SER A 43 31.787 -79.809 -7.432 1.00313.12 O ANISOU 7175 O SER A 43 37736 39463 41772 1428 2101 1545 O ATOM 7176 CB SER A 43 31.704 -76.813 -5.976 1.00294.13 C ANISOU 7176 CB SER A 43 35593 36827 39334 1468 2077 1484 C ATOM 7177 OG SER A 43 32.991 -77.351 -5.771 1.00279.70 O ANISOU 7177 OG SER A 43 33822 35135 37315 1092 2523 1870 O ATOM 7178 N LYS A 44 30.988 -78.170 -8.783 1.00329.10 N ANISOU 7178 N LYS A 44 40541 40956 43544 2091 1364 1320 N ATOM 7179 CA LYS A 44 31.352 -78.792 -10.083 1.00331.38 C ANISOU 7179 CA LYS A 44 41262 41095 43551 2211 1242 1479 C ATOM 7180 C LYS A 44 32.854 -79.104 -10.239 1.00340.83 C ANISOU 7180 C LYS A 44 42751 42332 44417 1820 1724 1951 C ATOM 7181 O LYS A 44 33.274 -80.200 -10.714 1.00342.21 O ANISOU 7181 O LYS A 44 42856 42620 44547 1702 1861 2078 O ATOM 7182 CB LYS A 44 30.873 -77.877 -11.219 1.00321.23 C ANISOU 7182 CB LYS A 44 40695 39370 41988 2701 692 1351 C ATOM 7183 CG LYS A 44 30.439 -78.601 -12.484 1.00310.27 C ANISOU 7183 CG LYS A 44 39540 37834 40511 3027 311 1229 C ATOM 7184 CD LYS A 44 29.464 -79.754 -12.232 1.00300.25 C ANISOU 7184 CD LYS A 44 37467 36873 39739 3097 189 848 C ATOM 7185 CE LYS A 44 28.234 -79.339 -11.440 1.00293.43 C ANISOU 7185 CE LYS A 44 36031 36113 39343 3298 -75 316 C ATOM 7186 NZ LYS A 44 27.588 -80.489 -10.755 1.00282.70 N ANISOU 7186 NZ LYS A 44 33798 35131 38482 3096 121 6 N ATOM 7187 N GLN A 45 33.648 -78.123 -9.815 1.00350.60 N ANISOU 7187 N GLN A 45 44284 43480 45448 1621 1980 2161 N ATOM 7188 CA GLN A 45 35.109 -78.217 -9.803 1.00351.56 C ANISOU 7188 CA GLN A 45 44614 43651 45310 1226 2468 2511 C ATOM 7189 C GLN A 45 35.586 -79.249 -8.776 1.00345.56 C ANISOU 7189 C GLN A 45 43182 43299 44815 885 2836 2579 C ATOM 7190 O GLN A 45 36.564 -79.933 -9.030 1.00344.82 O ANISOU 7190 O GLN A 45 43116 43303 44596 661 3110 2765 O ATOM 7191 CB GLN A 45 35.780 -76.861 -9.542 1.00357.20 C ANISOU 7191 CB GLN A 45 45775 44168 45773 1086 2660 2647 C ATOM 7192 CG GLN A 45 34.985 -75.644 -9.986 1.00366.18 C ANISOU 7192 CG GLN A 45 47453 44926 46753 1458 2238 2499 C ATOM 7193 CD GLN A 45 33.992 -75.218 -8.929 1.00370.87 C ANISOU 7193 CD GLN A 45 47529 45659 47724 1606 2034 2235 C ATOM 7194 OE1 GLN A 45 32.825 -75.625 -8.956 1.00376.99 O ANISOU 7194 OE1 GLN A 45 47947 46496 48794 1911 1650 1918 O ATOM 7195 NE2 GLN A 45 34.459 -74.429 -7.965 1.00370.69 N ANISOU 7195 NE2 GLN A 45 47422 45702 47720 1368 2316 2325 N ATOM 7196 N THR A 46 34.910 -79.360 -7.629 1.00338.47 N ANISOU 7196 N THR A 46 41729 42612 44263 851 2839 2403 N ATOM 7197 CA THR A 46 35.159 -80.462 -6.689 1.00326.54 C ANISOU 7197 CA THR A 46 39673 41424 42971 578 3122 2428 C ATOM 7198 C THR A 46 34.999 -81.876 -7.334 1.00320.04 C ANISOU 7198 C THR A 46 38706 40698 42196 617 3062 2407 C ATOM 7199 O THR A 46 35.848 -82.754 -7.132 1.00322.04 O ANISOU 7199 O THR A 46 38845 41112 42401 390 3320 2574 O ATOM 7200 CB THR A 46 34.287 -80.313 -5.422 1.00323.12 C ANISOU 7200 CB THR A 46 38762 41134 42872 531 3138 2194 C ATOM 7201 OG1 THR A 46 34.509 -79.025 -4.836 1.00316.97 O ANISOU 7201 OG1 THR A 46 38123 40271 42038 491 3200 2235 O ATOM 7202 CG2 THR A 46 34.618 -81.374 -4.407 1.00326.10 C ANISOU 7202 CG2 THR A 46 38745 41770 43388 230 3452 2243 C ATOM 7203 N ILE A 47 33.929 -82.083 -8.111 1.00311.65 N ANISOU 7203 N ILE A 47 37653 39530 41231 926 2696 2173 N ATOM 7204 CA ILE A 47 33.675 -83.358 -8.815 1.00302.41 C ANISOU 7204 CA ILE A 47 36364 38428 40110 993 2605 2123 C ATOM 7205 C ILE A 47 34.814 -83.661 -9.754 1.00305.61 C ANISOU 7205 C ILE A 47 37184 38755 40178 922 2722 2424 C ATOM 7206 O ILE A 47 35.411 -84.749 -9.720 1.00297.29 O ANISOU 7206 O ILE A 47 35965 37870 39119 737 2928 2547 O ATOM 7207 CB ILE A 47 32.416 -83.286 -9.696 1.00301.31 C ANISOU 7207 CB ILE A 47 36267 38128 40086 1403 2123 1792 C ATOM 7208 CG1 ILE A 47 31.171 -82.918 -8.877 1.00300.61 C ANISOU 7208 CG1 ILE A 47 35726 38107 40384 1506 1971 1371 C ATOM 7209 CG2 ILE A 47 32.256 -84.566 -10.509 1.00299.19 C ANISOU 7209 CG2 ILE A 47 35921 37918 39838 1468 2038 1761 C ATOM 7210 CD1 ILE A 47 30.905 -83.799 -7.676 1.00296.47 C ANISOU 7210 CD1 ILE A 47 34610 37866 40166 1178 2311 1244 C ATOM 7211 N ALA A 48 35.085 -82.670 -10.598 1.00319.38 N ANISOU 7211 N ALA A 48 39506 40214 41629 1068 2592 2510 N ATOM 7212 CA ALA A 48 36.238 -82.673 -11.462 1.00333.57 C ANISOU 7212 CA ALA A 48 41784 41885 43072 939 2782 2761 C ATOM 7213 C ALA A 48 37.553 -82.954 -10.697 1.00339.63 C ANISOU 7213 C ALA A 48 42340 42879 43825 537 3255 2948 C ATOM 7214 O ALA A 48 38.343 -83.807 -11.134 1.00347.08 O ANISOU 7214 O ALA A 48 43281 43911 44679 396 3429 3055 O ATOM 7215 CB ALA A 48 36.311 -81.373 -12.261 1.00334.56 C ANISOU 7215 CB ALA A 48 42644 41619 42854 1095 2640 2801 C ATOM 7216 N ALA A 49 37.755 -82.278 -9.551 1.00339.68 N ANISOU 7216 N ALA A 49 42144 42980 43938 381 3428 2949 N ATOM 7217 CA ALA A 49 39.031 -82.326 -8.793 1.00334.56 C ANISOU 7217 CA ALA A 49 41336 42511 43270 45 3823 3071 C ATOM 7218 C ALA A 49 39.330 -83.699 -8.216 1.00336.05 C ANISOU 7218 C ALA A 49 41068 42982 43631 -75 3929 3077 C ATOM 7219 O ALA A 49 40.498 -84.088 -8.151 1.00324.61 O ANISOU 7219 O ALA A 49 39580 41645 42111 -270 4166 3148 O ATOM 7220 CB ALA A 49 39.066 -81.278 -7.685 1.00327.08 C ANISOU 7220 CB ALA A 49 40288 41584 42401 -54 3934 3050 C ATOM 7221 N ILE A 50 38.279 -84.413 -7.793 1.00352.86 N ANISOU 7221 N ILE A 50 42874 45210 45986 35 3757 2959 N ATOM 7222 CA ILE A 50 38.432 -85.796 -7.315 1.00371.31 C ANISOU 7222 CA ILE A 50 44887 47753 48439 -66 3838 2959 C ATOM 7223 C ILE A 50 38.740 -86.758 -8.468 1.00378.55 C ANISOU 7223 C ILE A 50 45928 48659 49241 -2 3779 3016 C ATOM 7224 O ILE A 50 39.525 -87.693 -8.278 1.00390.90 O ANISOU 7224 O ILE A 50 47370 50366 50787 -125 3910 3077 O ATOM 7225 CB ILE A 50 37.233 -86.342 -6.488 1.00377.09 C ANISOU 7225 CB ILE A 50 45276 48569 49430 -44 3761 2781 C ATOM 7226 CG1 ILE A 50 36.881 -85.408 -5.337 1.00387.09 C ANISOU 7226 CG1 ILE A 50 46414 49843 50818 -122 3836 2701 C ATOM 7227 CG2 ILE A 50 37.582 -87.688 -5.858 1.00376.02 C ANISOU 7227 CG2 ILE A 50 44943 48593 49331 -199 3902 2811 C ATOM 7228 CD1 ILE A 50 35.633 -85.813 -4.581 1.00390.51 C ANISOU 7228 CD1 ILE A 50 46532 50329 51514 -141 3813 2456 C ATOM 7229 N SER A 51 38.132 -86.533 -9.645 1.00377.72 N ANISOU 7229 N SER A 51 46090 48373 49051 211 3554 2980 N ATOM 7230 CA SER A 51 38.354 -87.390 -10.846 1.00364.47 C ANISOU 7230 CA SER A 51 44581 46655 47244 288 3480 3032 C ATOM 7231 C SER A 51 39.797 -87.330 -11.357 1.00356.45 C ANISOU 7231 C SER A 51 43810 45626 45997 105 3735 3173 C ATOM 7232 O SER A 51 40.448 -88.365 -11.590 1.00344.39 O ANISOU 7232 O SER A 51 42168 44228 44456 21 3829 3209 O ATOM 7233 CB SER A 51 37.377 -87.040 -11.966 1.00364.22 C ANISOU 7233 CB SER A 51 44850 46390 47146 590 3143 2937 C ATOM 7234 OG SER A 51 36.040 -87.134 -11.503 1.00363.98 O ANISOU 7234 OG SER A 51 44507 46397 47390 759 2908 2706 O ATOM 7235 N GLU A 52 40.277 -86.096 -11.497 1.00360.75 N ANISOU 7235 N GLU A 52 44685 46009 46373 30 3859 3211 N ATOM 7236 CA GLU A 52 41.681 -85.775 -11.715 1.00368.18 C ANISOU 7236 CA GLU A 52 45803 46945 47142 -225 4196 3258 C ATOM 7237 C GLU A 52 42.578 -86.371 -10.629 1.00357.79 C ANISOU 7237 C GLU A 52 44026 45920 45997 -419 4398 3221 C ATOM 7238 O GLU A 52 43.575 -86.999 -10.942 1.00363.36 O ANISOU 7238 O GLU A 52 44667 46725 46666 -547 4562 3187 O ATOM 7239 CB GLU A 52 41.871 -84.254 -11.721 1.00395.10 C ANISOU 7239 CB GLU A 52 49602 50134 50383 -301 4318 3267 C ATOM 7240 CG GLU A 52 41.349 -83.515 -12.961 1.00433.15 C ANISOU 7240 CG GLU A 52 55096 54572 54908 -132 4155 3298 C ATOM 7241 CD GLU A 52 41.065 -82.018 -12.728 1.00458.07 C ANISOU 7241 CD GLU A 52 58625 57484 57934 -101 4134 3294 C ATOM 7242 OE1 GLU A 52 41.702 -81.402 -11.833 1.00457.37 O ANISOU 7242 OE1 GLU A 52 58370 57499 57911 -328 4401 3285 O ATOM 7243 OE2 GLU A 52 40.194 -81.453 -13.443 1.00460.44 O ANISOU 7243 OE2 GLU A 52 59406 57475 58063 175 3819 3281 O ATOM 7244 N LEU A 53 42.222 -86.165 -9.360 1.00345.38 N ANISOU 7244 N LEU A 53 42159 44465 44605 -424 4366 3197 N ATOM 7245 CA LEU A 53 43.050 -86.591 -8.222 1.00336.99 C ANISOU 7245 CA LEU A 53 40748 43625 43666 -568 4506 3148 C ATOM 7246 C LEU A 53 43.304 -88.097 -8.174 1.00334.31 C ANISOU 7246 C LEU A 53 40184 43446 43391 -534 4436 3130 C ATOM 7247 O LEU A 53 44.406 -88.549 -7.841 1.00327.27 O ANISOU 7247 O LEU A 53 39140 42690 42516 -627 4541 3051 O ATOM 7248 CB LEU A 53 42.390 -86.173 -6.912 1.00336.62 C ANISOU 7248 CB LEU A 53 40504 43625 43769 -556 4453 3136 C ATOM 7249 CG LEU A 53 43.302 -85.951 -5.708 1.00335.09 C ANISOU 7249 CG LEU A 53 40109 43569 43639 -704 4607 3081 C ATOM 7250 CD1 LEU A 53 43.606 -84.466 -5.557 1.00332.60 C ANISOU 7250 CD1 LEU A 53 39939 43160 43273 -809 4762 3069 C ATOM 7251 CD2 LEU A 53 42.666 -86.509 -4.452 1.00340.06 C ANISOU 7251 CD2 LEU A 53 40521 44283 44401 -675 4513 3070 C ATOM 7252 N THR A 54 42.265 -88.870 -8.477 1.00336.17 N ANISOU 7252 N THR A 54 40397 43658 43672 -386 4240 3163 N ATOM 7253 CA THR A 54 42.374 -90.323 -8.442 1.00332.23 C ANISOU 7253 CA THR A 54 39741 43277 43212 -351 4167 3153 C ATOM 7254 C THR A 54 43.203 -90.791 -9.617 1.00331.57 C ANISOU 7254 C THR A 54 39775 43194 43009 -360 4216 3154 C ATOM 7255 O THR A 54 43.976 -91.714 -9.469 1.00325.84 O ANISOU 7255 O THR A 54 38911 42594 42296 -384 4230 3103 O ATOM 7256 CB THR A 54 41.018 -91.060 -8.474 1.00331.78 C ANISOU 7256 CB THR A 54 39617 43193 43252 -231 3990 3143 C ATOM 7257 OG1 THR A 54 40.129 -90.508 -7.494 1.00336.96 O ANISOU 7257 OG1 THR A 54 40166 43827 44036 -249 3981 3085 O ATOM 7258 CG2 THR A 54 41.222 -92.560 -8.186 1.00325.82 C ANISOU 7258 CG2 THR A 54 38742 42543 42510 -238 3958 3134 C ATOM 7259 N PHE A 55 43.024 -90.149 -10.772 1.00335.32 N ANISOU 7259 N PHE A 55 40546 43504 43354 -331 4228 3191 N ATOM 7260 CA PHE A 55 43.812 -90.402 -11.985 1.00338.26 C ANISOU 7260 CA PHE A 55 41119 43827 43575 -386 4337 3178 C ATOM 7261 C PHE A 55 45.307 -90.251 -11.712 1.00347.01 C ANISOU 7261 C PHE A 55 42107 45054 44685 -598 4606 3044 C ATOM 7262 O PHE A 55 46.106 -91.105 -12.090 1.00351.11 O ANISOU 7262 O PHE A 55 42511 45680 45212 -638 4661 2950 O ATOM 7263 CB PHE A 55 43.352 -89.425 -13.067 1.00329.24 C ANISOU 7263 CB PHE A 55 40448 42412 42236 -340 4327 3234 C ATOM 7264 CG PHE A 55 44.030 -89.589 -14.391 1.00318.27 C ANISOU 7264 CG PHE A 55 39387 40903 40637 -421 4469 3224 C ATOM 7265 CD1 PHE A 55 43.529 -90.495 -15.329 1.00310.39 C ANISOU 7265 CD1 PHE A 55 38490 39858 39586 -263 4282 3270 C ATOM 7266 CD2 PHE A 55 45.122 -88.786 -14.737 1.00315.80 C ANISOU 7266 CD2 PHE A 55 39317 40498 40171 -679 4819 3143 C ATOM 7267 CE1 PHE A 55 44.125 -90.618 -16.573 1.00305.26 C ANISOU 7267 CE1 PHE A 55 38194 39070 38719 -350 4428 3260 C ATOM 7268 CE2 PHE A 55 45.724 -88.909 -15.974 1.00308.09 C ANISOU 7268 CE2 PHE A 55 38695 39380 38984 -804 5010 3102 C ATOM 7269 CZ PHE A 55 45.218 -89.816 -16.893 1.00305.01 C ANISOU 7269 CZ PHE A 55 38428 38936 38524 -632 4806 3174 C ATOM 7270 N ARG A 56 45.662 -89.165 -11.030 1.00351.96 N ANISOU 7270 N ARG A 56 42729 45667 45330 -723 4761 2995 N ATOM 7271 CA ARG A 56 47.025 -88.917 -10.583 1.00347.87 C ANISOU 7271 CA ARG A 56 42022 45279 44871 -918 5004 2793 C ATOM 7272 C ARG A 56 47.414 -89.926 -9.516 1.00325.26 C ANISOU 7272 C ARG A 56 38759 42643 42183 -830 4850 2697 C ATOM 7273 O ARG A 56 48.569 -90.322 -9.420 1.00320.10 O ANISOU 7273 O ARG A 56 37892 42128 41602 -896 4934 2468 O ATOM 7274 CB ARG A 56 47.150 -87.507 -9.998 1.00368.56 C ANISOU 7274 CB ARG A 56 44729 47824 47481 -1053 5176 2767 C ATOM 7275 CG ARG A 56 46.556 -86.365 -10.834 1.00396.27 C ANISOU 7275 CG ARG A 56 48741 51044 50778 -1089 5259 2887 C ATOM 7276 CD ARG A 56 46.828 -85.008 -10.190 1.00416.81 C ANISOU 7276 CD ARG A 56 51422 53578 53367 -1244 5453 2839 C ATOM 7277 NE ARG A 56 46.009 -83.869 -10.640 1.00440.55 N ANISOU 7277 NE ARG A 56 54918 56289 56179 -1198 5420 2974 N ATOM 7278 CZ ARG A 56 45.066 -83.260 -9.909 1.00445.50 C ANISOU 7278 CZ ARG A 56 55527 56871 56871 -1050 5222 3069 C ATOM 7279 NH1 ARG A 56 44.767 -83.688 -8.689 1.00442.26 N ANISOU 7279 NH1 ARG A 56 54661 56680 56697 -970 5078 3065 N ATOM 7280 NH2 ARG A 56 44.405 -82.220 -10.407 1.00454.44 N ANISOU 7280 NH2 ARG A 56 57141 57711 57813 -977 5158 3146 N ATOM 7281 N GLN A 57 46.435 -90.330 -8.715 1.00304.14 N ANISOU 7281 N GLN A 57 36013 39979 39565 -679 4622 2834 N ATOM 7282 CA GLN A 57 46.642 -91.301 -7.665 1.00291.61 C ANISOU 7282 CA GLN A 57 34202 38527 38069 -585 4457 2774 C ATOM 7283 C GLN A 57 46.892 -92.685 -8.238 1.00297.36 C ANISOU 7283 C GLN A 57 34886 39317 38778 -485 4330 2741 C ATOM 7284 O GLN A 57 47.586 -93.502 -7.630 1.00289.00 O ANISOU 7284 O GLN A 57 33681 38363 37761 -409 4211 2605 O ATOM 7285 CB GLN A 57 45.424 -91.339 -6.746 1.00280.30 C ANISOU 7285 CB GLN A 57 32791 37039 36668 -514 4324 2914 C ATOM 7286 CG GLN A 57 45.695 -91.982 -5.401 1.00273.55 C ANISOU 7286 CG GLN A 57 31835 36253 35848 -466 4210 2850 C ATOM 7287 CD GLN A 57 46.779 -91.260 -4.630 1.00271.03 C ANISOU 7287 CD GLN A 57 31394 36009 35575 -524 4281 2687 C ATOM 7288 OE1 GLN A 57 47.011 -90.074 -4.846 1.00268.91 O ANISOU 7288 OE1 GLN A 57 31117 35726 35330 -643 4461 2660 O ATOM 7289 NE2 GLN A 57 47.452 -91.971 -3.728 1.00268.87 N ANISOU 7289 NE2 GLN A 57 31057 35795 35304 -426 4125 2553 N ATOM 7290 N CYS A 58 46.315 -92.942 -9.410 1.00316.02 N ANISOU 7290 N CYS A 58 37408 41597 41067 -458 4324 2851 N ATOM 7291 CA CYS A 58 46.468 -94.226 -10.114 1.00337.11 C ANISOU 7291 CA CYS A 58 40060 44313 43711 -368 4215 2837 C ATOM 7292 C CYS A 58 47.907 -94.442 -10.592 1.00339.93 C ANISOU 7292 C CYS A 58 40292 44778 44087 -443 4337 2602 C ATOM 7293 O CYS A 58 48.342 -95.584 -10.758 1.00349.17 O ANISOU 7293 O CYS A 58 41357 46034 45276 -347 4211 2511 O ATOM 7294 CB CYS A 58 45.455 -94.381 -11.272 1.00352.45 C ANISOU 7294 CB CYS A 58 42212 46129 45573 -307 4163 2993 C ATOM 7295 SG CYS A 58 43.803 -95.025 -10.825 1.00379.61 S ANISOU 7295 SG CYS A 58 45651 49513 49070 -168 3943 3126 S ATOM 7296 N GLU A 59 48.622 -93.334 -10.795 1.00334.07 N ANISOU 7296 N GLU A 59 39561 44022 43347 -625 4595 2467 N ATOM 7297 CA GLU A 59 50.062 -93.327 -11.044 1.00323.83 C ANISOU 7297 CA GLU A 59 38069 42843 42126 -755 4781 2130 C ATOM 7298 C GLU A 59 50.787 -93.931 -9.828 1.00309.23 C ANISOU 7298 C GLU A 59 35894 41166 40430 -617 4572 1903 C ATOM 7299 O GLU A 59 51.555 -94.893 -9.961 1.00313.19 O ANISOU 7299 O GLU A 59 36207 41785 41004 -521 4453 1672 O ATOM 7300 CB GLU A 59 50.533 -91.886 -11.366 1.00330.48 C ANISOU 7300 CB GLU A 59 39037 43599 42930 -1026 5151 2020 C ATOM 7301 CG GLU A 59 51.929 -91.751 -11.990 1.00340.82 C ANISOU 7301 CG GLU A 59 40203 44986 44305 -1262 5477 1618 C ATOM 7302 CD GLU A 59 52.026 -90.770 -13.171 1.00347.37 C ANISOU 7302 CD GLU A 59 41439 45601 44943 -1563 5895 1619 C ATOM 7303 OE1 GLU A 59 51.048 -90.040 -13.438 1.00347.69 O ANISOU 7303 OE1 GLU A 59 41893 45420 44792 -1552 5889 1931 O ATOM 7304 OE2 GLU A 59 53.080 -90.763 -13.846 1.00354.09 O ANISOU 7304 OE2 GLU A 59 42225 46486 45827 -1806 6224 1275 O ATOM 7305 N ASN A 60 50.490 -93.391 -8.650 1.00286.61 N ANISOU 7305 N ASN A 60 33007 38294 37599 -579 4493 1965 N ATOM 7306 CA ASN A 60 51.022 -93.893 -7.395 1.00271.89 C ANISOU 7306 CA ASN A 60 30954 36528 35823 -412 4244 1787 C ATOM 7307 C ASN A 60 50.694 -95.363 -7.142 1.00271.55 C ANISOU 7307 C ASN A 60 30983 36476 35717 -173 3913 1866 C ATOM 7308 O ASN A 60 51.602 -96.149 -6.863 1.00276.46 O ANISOU 7308 O ASN A 60 31455 37188 36397 -15 3708 1588 O ATOM 7309 CB ASN A 60 50.602 -92.956 -6.265 1.00259.47 C ANISOU 7309 CB ASN A 60 29425 34904 34255 -444 4256 1888 C ATOM 7310 CG ASN A 60 50.911 -91.500 -6.589 1.00255.50 C ANISOU 7310 CG ASN A 60 28902 34386 33790 -690 4597 1816 C ATOM 7311 OD1 ASN A 60 51.895 -91.195 -7.272 1.00250.68 O ANISOU 7311 OD1 ASN A 60 28159 33841 33247 -844 4825 1535 O ATOM 7312 ND2 ASN A 60 50.059 -90.596 -6.122 1.00254.55 N ANISOU 7312 ND2 ASN A 60 28936 34160 33619 -747 4658 2044 N ATOM 7313 N PHE A 61 49.426 -95.745 -7.312 1.00267.29 N ANISOU 7313 N PHE A 61 30676 35819 35063 -147 3861 2198 N ATOM 7314 CA PHE A 61 49.003 -97.160 -7.236 1.00265.06 C ANISOU 7314 CA PHE A 61 30520 35495 34694 23 3615 2287 C ATOM 7315 C PHE A 61 49.835 -98.083 -8.121 1.00268.53 C ANISOU 7315 C PHE A 61 30846 36025 35158 108 3537 2099 C ATOM 7316 O PHE A 61 50.440 -99.028 -7.630 1.00260.90 O ANISOU 7316 O PHE A 61 29859 35088 34182 299 3277 1924 O ATOM 7317 CB PHE A 61 47.539 -97.373 -7.651 1.00261.86 C ANISOU 7317 CB PHE A 61 30313 34970 34209 -15 3651 2592 C ATOM 7318 CG PHE A 61 46.518 -96.654 -6.802 1.00265.49 C ANISOU 7318 CG PHE A 61 30873 35334 34665 -90 3712 2747 C ATOM 7319 CD1 PHE A 61 46.726 -96.403 -5.447 1.00268.93 C ANISOU 7319 CD1 PHE A 61 31339 35750 35092 -76 3655 2688 C ATOM 7320 CD2 PHE A 61 45.304 -96.259 -7.367 1.00267.04 C ANISOU 7320 CD2 PHE A 61 31141 35450 34869 -157 3805 2917 C ATOM 7321 CE1 PHE A 61 45.754 -95.746 -4.693 1.00272.82 C ANISOU 7321 CE1 PHE A 61 31917 36154 35589 -171 3743 2811 C ATOM 7322 CE2 PHE A 61 44.334 -95.603 -6.619 1.00269.49 C ANISOU 7322 CE2 PHE A 61 31495 35683 35212 -224 3860 2995 C ATOM 7323 CZ PHE A 61 44.556 -95.351 -5.276 1.00271.84 C ANISOU 7323 CZ PHE A 61 31810 35970 35504 -251 3853 2949 C ATOM 7324 N ALA A 62 49.834 -97.811 -9.427 1.00281.18 N ANISOU 7324 N ALA A 62 32422 37642 36770 -22 3748 2126 N ATOM 7325 CA ALA A 62 50.429 -98.691 -10.456 1.00293.45 C ANISOU 7325 CA ALA A 62 33897 39265 38335 20 3724 1984 C ATOM 7326 C ALA A 62 51.930 -99.007 -10.295 1.00298.81 C ANISOU 7326 C ALA A 62 34279 40098 39154 90 3651 1532 C ATOM 7327 O ALA A 62 52.332-100.180 -10.333 1.00302.07 O ANISOU 7327 O ALA A 62 34642 40558 39573 284 3401 1393 O ATOM 7328 CB ALA A 62 50.149 -98.139 -11.853 1.00300.47 C ANISOU 7328 CB ALA A 62 34894 40097 39173 -164 4004 2090 C ATOM 7329 N LYS A 63 52.745 -97.961 -10.138 1.00297.81 N ANISOU 7329 N LYS A 63 33951 40048 39155 -64 3867 1265 N ATOM 7330 CA LYS A 63 54.193 -98.086 -9.923 1.00293.37 C ANISOU 7330 CA LYS A 63 33023 39651 38790 -15 3819 725 C ATOM 7331 C LYS A 63 54.502 -99.060 -8.812 1.00295.21 C ANISOU 7331 C LYS A 63 33219 39908 39037 337 3337 575 C ATOM 7332 O LYS A 63 55.242-100.022 -8.986 1.00297.85 O ANISOU 7332 O LYS A 63 33397 40324 39446 531 3102 264 O ATOM 7333 CB LYS A 63 54.777 -96.736 -9.512 1.00288.08 C ANISOU 7333 CB LYS A 63 32176 39031 38247 -222 4088 493 C ATOM 7334 CG LYS A 63 55.383 -95.968 -10.662 1.00288.25 C ANISOU 7334 CG LYS A 63 32103 39082 38335 -573 4576 265 C ATOM 7335 CD LYS A 63 56.178 -94.802 -10.132 1.00292.74 C ANISOU 7335 CD LYS A 63 32441 39721 39065 -766 4822 -87 C ATOM 7336 CE LYS A 63 56.414 -93.781 -11.217 1.00304.10 C ANISOU 7336 CE LYS A 63 33999 41082 40461 -1196 5400 -166 C ATOM 7337 NZ LYS A 63 55.161 -93.047 -11.527 1.00307.84 N ANISOU 7337 NZ LYS A 63 34968 41326 40669 -1299 5529 399 N ATOM 7338 N ASP A 64 53.905 -98.775 -7.663 1.00295.67 N ANISOU 7338 N ASP A 64 33472 39866 39002 422 3189 790 N ATOM 7339 CA ASP A 64 54.207 -99.435 -6.405 1.00295.84 C ANISOU 7339 CA ASP A 64 33579 39844 38982 739 2749 645 C ATOM 7340 C ASP A 64 53.759-100.881 -6.382 1.00291.66 C ANISOU 7340 C ASP A 64 33350 39196 38267 976 2424 809 C ATOM 7341 O ASP A 64 54.430-101.730 -5.803 1.00295.95 O ANISOU 7341 O ASP A 64 33935 39720 38791 1288 2017 531 O ATOM 7342 CB ASP A 64 53.523 -98.675 -5.269 1.00301.73 C ANISOU 7342 CB ASP A 64 34539 40473 39632 696 2762 890 C ATOM 7343 CG ASP A 64 53.994 -97.225 -5.151 1.00308.35 C ANISOU 7343 CG ASP A 64 35107 41412 40640 479 3058 718 C ATOM 7344 OD1 ASP A 64 54.764 -96.726 -6.008 1.00307.65 O ANISOU 7344 OD1 ASP A 64 34704 41462 40726 302 3326 432 O ATOM 7345 OD2 ASP A 64 53.572 -96.575 -4.178 1.00316.99 O ANISOU 7345 OD2 ASP A 64 36334 42426 41679 460 3052 863 O ATOM 7346 N LEU A 65 52.606-101.136 -6.994 1.00281.09 N ANISOU 7346 N LEU A 65 32248 37762 36790 839 2588 1233 N ATOM 7347 CA LEU A 65 52.047-102.473 -7.128 1.00277.41 C ANISOU 7347 CA LEU A 65 32078 37176 36147 992 2370 1414 C ATOM 7348 C LEU A 65 52.994-103.364 -7.949 1.00295.59 C ANISOU 7348 C LEU A 65 34174 39596 38539 1148 2210 1101 C ATOM 7349 O LEU A 65 53.277-104.504 -7.563 1.00304.40 O ANISOU 7349 O LEU A 65 35472 40635 39550 1430 1834 985 O ATOM 7350 CB LEU A 65 50.636-102.409 -7.757 1.00255.89 C ANISOU 7350 CB LEU A 65 29542 34359 33323 783 2625 1852 C ATOM 7351 CG LEU A 65 49.447-101.858 -6.945 1.00244.39 C ANISOU 7351 CG LEU A 65 28328 32758 31768 654 2743 2150 C ATOM 7352 CD1 LEU A 65 48.248-101.503 -7.823 1.00237.74 C ANISOU 7352 CD1 LEU A 65 27507 31887 30934 455 3005 2436 C ATOM 7353 CD2 LEU A 65 49.049-102.833 -5.849 1.00245.28 C ANISOU 7353 CD2 LEU A 65 28847 32676 31671 797 2497 2218 C ATOM 7354 N GLU A 66 53.509-102.836 -9.058 1.00310.96 N ANISOU 7354 N GLU A 66 35781 41704 40663 961 2499 937 N ATOM 7355 CA GLU A 66 54.426-103.590 -9.915 1.00322.98 C ANISOU 7355 CA GLU A 66 37059 43355 42304 1056 2416 593 C ATOM 7356 C GLU A 66 55.728-103.978 -9.187 1.00332.75 C ANISOU 7356 C GLU A 66 38056 44684 43689 1357 2040 28 C ATOM 7357 O GLU A 66 56.256-105.084 -9.364 1.00337.19 O ANISOU 7357 O GLU A 66 38589 45265 44260 1617 1718 -213 O ATOM 7358 CB GLU A 66 54.728-102.788 -11.172 1.00321.25 C ANISOU 7358 CB GLU A 66 36584 43252 42222 731 2878 497 C ATOM 7359 CG GLU A 66 55.561-103.516 -12.204 1.00321.12 C ANISOU 7359 CG GLU A 66 36326 43359 42325 753 2891 156 C ATOM 7360 CD GLU A 66 56.624-102.592 -12.759 1.00326.13 C ANISOU 7360 CD GLU A 66 36574 44146 43192 485 3271 -308 C ATOM 7361 OE1 GLU A 66 56.373-101.366 -12.810 1.00326.41 O ANISOU 7361 OE1 GLU A 66 36662 44143 43216 201 3635 -180 O ATOM 7362 OE2 GLU A 66 57.721-103.075 -13.106 1.00330.73 O ANISOU 7362 OE2 GLU A 66 36805 44879 43977 551 3215 -843 O ATOM 7363 N MET A 67 56.234-103.062 -8.372 1.00335.93 N ANISOU 7363 N MET A 67 38288 45137 44213 1344 2051 -205 N ATOM 7364 CA MET A 67 57.444-103.306 -7.598 1.00334.23 C ANISOU 7364 CA MET A 67 37827 45002 44161 1662 1651 -797 C ATOM 7365 C MET A 67 57.275-104.292 -6.430 1.00330.00 C ANISOU 7365 C MET A 67 37735 44259 43390 2093 1060 -740 C ATOM 7366 O MET A 67 58.253-104.916 -6.008 1.00325.23 O ANISOU 7366 O MET A 67 37016 43681 42873 2469 592 -1246 O ATOM 7367 CB MET A 67 58.014-101.972 -7.145 1.00339.52 C ANISOU 7367 CB MET A 67 38170 45788 45041 1492 1877 -1083 C ATOM 7368 CG MET A 67 58.410-101.116 -8.339 1.00345.98 C ANISOU 7368 CG MET A 67 38606 46775 46072 1071 2456 -1262 C ATOM 7369 SD MET A 67 59.094 -99.475 -7.981 1.00358.29 S ANISOU 7369 SD MET A 67 39796 48460 47877 773 2843 -1624 S ATOM 7370 CE MET A 67 57.677 -98.415 -7.843 1.00340.91 C ANISOU 7370 CE MET A 67 38034 46078 45418 476 3195 -874 C ATOM 7371 N PHE A 68 56.041-104.435 -5.925 1.00327.25 N ANISOU 7371 N PHE A 68 37920 43683 42736 2036 1084 -168 N ATOM 7372 CA PHE A 68 55.652-105.529 -4.992 1.00323.68 C ANISOU 7372 CA PHE A 68 38067 42954 41961 2359 623 -17 C ATOM 7373 C PHE A 68 55.538-106.926 -5.640 1.00315.67 C ANISOU 7373 C PHE A 68 37265 41863 40810 2527 413 33 C ATOM 7374 O PHE A 68 55.939-107.923 -5.031 1.00315.90 O ANISOU 7374 O PHE A 68 37633 41723 40669 2917 -100 -159 O ATOM 7375 CB PHE A 68 54.305-105.243 -4.307 1.00324.82 C ANISOU 7375 CB PHE A 68 38710 42872 41835 2159 820 535 C ATOM 7376 CG PHE A 68 54.296-104.042 -3.411 1.00321.90 C ANISOU 7376 CG PHE A 68 38282 42505 41518 2052 940 530 C ATOM 7377 CD1 PHE A 68 55.443-103.634 -2.743 1.00324.39 C ANISOU 7377 CD1 PHE A 68 38358 42903 41990 2285 660 46 C ATOM 7378 CD2 PHE A 68 53.111-103.341 -3.205 1.00315.42 C ANISOU 7378 CD2 PHE A 68 37643 41599 40602 1735 1312 976 C ATOM 7379 CE1 PHE A 68 55.410-102.532 -1.908 1.00322.23 C ANISOU 7379 CE1 PHE A 68 38043 42629 41760 2182 774 52 C ATOM 7380 CE2 PHE A 68 53.071-102.245 -2.368 1.00313.09 C ANISOU 7380 CE2 PHE A 68 37309 41300 40350 1636 1422 981 C ATOM 7381 CZ PHE A 68 54.225-101.836 -1.721 1.00317.31 C ANISOU 7381 CZ PHE A 68 37624 41916 41022 1852 1162 540 C ATOM 7382 N ALA A 69 54.949-106.992 -6.843 1.00305.10 N ANISOU 7382 N ALA A 69 35791 40616 39516 2248 788 303 N ATOM 7383 CA ALA A 69 54.791-108.245 -7.603 1.00299.42 C ANISOU 7383 CA ALA A 69 35222 39850 38693 2358 655 373 C ATOM 7384 C ALA A 69 56.144-108.783 -8.095 1.00305.98 C ANISOU 7384 C ALA A 69 35656 40856 39746 2627 363 -210 C ATOM 7385 O ALA A 69 56.363-109.987 -8.086 1.00303.07 O ANISOU 7385 O ALA A 69 35527 40380 39246 2932 -28 -319 O ATOM 7386 CB ALA A 69 53.817-108.059 -8.763 1.00290.88 C ANISOU 7386 CB ALA A 69 34077 38823 37619 1998 1123 780 C ATOM 7387 N ARG A 70 57.037-107.877 -8.507 1.00317.70 N ANISOU 7387 N ARG A 70 36546 42597 41567 2498 573 -617 N ATOM 7388 CA ARG A 70 58.466-108.167 -8.772 1.00333.80 C ANISOU 7388 CA ARG A 70 38094 44832 43900 2738 315 -1339 C ATOM 7389 C ARG A 70 59.331-108.603 -7.543 1.00339.99 C ANISOU 7389 C ARG A 70 38967 45529 44683 3257 -355 -1831 C ATOM 7390 O ARG A 70 60.271-109.402 -7.701 1.00341.50 O ANISOU 7390 O ARG A 70 38953 45787 45012 3607 -771 -2372 O ATOM 7391 CB ARG A 70 59.111-106.984 -9.519 1.00340.44 C ANISOU 7391 CB ARG A 70 38308 45945 45096 2370 827 -1666 C ATOM 7392 CG ARG A 70 60.634-106.935 -9.523 1.00350.61 C ANISOU 7392 CG ARG A 70 38991 47458 46765 2549 640 -2540 C ATOM 7393 CD ARG A 70 61.277-108.010 -10.402 1.00355.26 C ANISOU 7393 CD ARG A 70 39343 48151 47486 2717 464 -2928 C ATOM 7394 NE ARG A 70 60.402-108.513 -11.461 1.00350.64 N ANISOU 7394 NE ARG A 70 39019 47502 46705 2491 753 -2387 N ATOM 7395 CZ ARG A 70 59.980-109.772 -11.544 1.00348.58 C ANISOU 7395 CZ ARG A 70 39133 47096 46215 2762 395 -2150 C ATOM 7396 NH1 ARG A 70 60.364-110.662 -10.639 1.00350.54 N ANISOU 7396 NH1 ARG A 70 39602 47216 46367 3272 -269 -2395 N ATOM 7397 NH2 ARG A 70 59.182-110.142 -12.535 1.00344.18 N ANISOU 7397 NH2 ARG A 70 38767 46496 45508 2533 688 -1687 N ATOM 7398 N HIS A 71 59.031-108.071 -6.345 1.00343.55 N ANISOU 7398 N HIS A 71 39729 45822 44981 3325 -482 -1679 N ATOM 7399 CA HIS A 71 59.605-108.573 -5.049 1.00351.53 C ANISOU 7399 CA HIS A 71 41069 46639 45857 3858 -1183 -2021 C ATOM 7400 C HIS A 71 59.342-110.060 -4.760 1.00357.67 C ANISOU 7400 C HIS A 71 42524 47111 46263 4250 -1709 -1888 C ATOM 7401 O HIS A 71 60.154-110.712 -4.092 1.00360.99 O ANISOU 7401 O HIS A 71 43114 47408 46635 4779 -2378 -2364 O ATOM 7402 CB HIS A 71 59.115-107.754 -3.820 1.00348.15 C ANISOU 7402 CB HIS A 71 40992 46038 45249 3806 -1163 -1761 C ATOM 7403 CG HIS A 71 59.005-108.554 -2.537 1.00345.97 C ANISOU 7403 CG HIS A 71 41503 45378 44571 4258 -1788 -1725 C ATOM 7404 ND1 HIS A 71 60.104-108.989 -1.822 1.00347.85 N ANISOU 7404 ND1 HIS A 71 41773 45546 44847 4825 -2495 -2357 N ATOM 7405 CD2 HIS A 71 57.919-108.990 -1.849 1.00340.67 C ANISOU 7405 CD2 HIS A 71 41664 44340 43432 4217 -1799 -1165 C ATOM 7406 CE1 HIS A 71 59.701-109.657 -0.754 1.00345.13 C ANISOU 7406 CE1 HIS A 71 42325 44778 44029 5129 -2936 -2145 C ATOM 7407 NE2 HIS A 71 58.380-109.671 -0.747 1.00339.66 N ANISOU 7407 NE2 HIS A 71 42133 43898 43021 4735 -2485 -1424 N ATOM 7408 N ALA A 72 58.197-110.563 -5.231 1.00359.72 N ANISOU 7408 N ALA A 72 43196 47227 46252 3998 -1418 -1268 N ATOM 7409 CA ALA A 72 57.691-111.903 -4.893 1.00361.93 C ANISOU 7409 CA ALA A 72 44252 47156 46105 4259 -1791 -1022 C ATOM 7410 C ALA A 72 57.863-112.938 -6.030 1.00353.01 C ANISOU 7410 C ALA A 72 42979 46114 45032 4330 -1848 -1100 C ATOM 7411 O ALA A 72 57.163-113.958 -6.054 1.00364.20 O ANISOU 7411 O ALA A 72 45001 47272 46106 4378 -1945 -757 O ATOM 7412 CB ALA A 72 56.221-111.808 -4.457 1.00367.39 C ANISOU 7412 CB ALA A 72 45571 47584 46436 3920 -1428 -320 C ATOM 7413 N LYS A 73 58.796-112.672 -6.954 1.00331.06 N ANISOU 7413 N LYS A 73 39417 43688 42682 4313 -1761 -1575 N ATOM 7414 CA LYS A 73 59.071-113.545 -8.126 1.00314.41 C ANISOU 7414 CA LYS A 73 37066 41708 40687 4352 -1771 -1716 C ATOM 7415 C LYS A 73 57.830-113.853 -9.025 1.00306.98 C ANISOU 7415 C LYS A 73 36355 40719 39565 3955 -1285 -1048 C ATOM 7416 O LYS A 73 57.706-114.957 -9.559 1.00304.02 O ANISOU 7416 O LYS A 73 36186 40265 39062 4086 -1450 -986 O ATOM 7417 CB LYS A 73 59.814-114.841 -7.701 1.00310.15 C ANISOU 7417 CB LYS A 73 36846 40985 40010 4970 -2553 -2148 C ATOM 7418 CG LYS A 73 60.964-114.658 -6.696 1.00306.43 C ANISOU 7418 CG LYS A 73 36255 40499 39673 5466 -3168 -2840 C ATOM 7419 CD LYS A 73 61.375-115.961 -5.999 1.00304.79 C ANISOU 7419 CD LYS A 73 36698 39953 39155 6129 -4024 -3112 C ATOM 7420 CE LYS A 73 60.298-116.573 -5.096 1.00300.68 C ANISOU 7420 CE LYS A 73 37320 38926 37998 6180 -4166 -2476 C ATOM 7421 NZ LYS A 73 60.121-115.907 -3.775 1.00297.92 N ANISOU 7421 NZ LYS A 73 37417 38345 37433 6247 -4296 -2385 N ATOM 7422 N ARG A 74 56.934-112.874 -9.194 1.00301.06 N ANISOU 7422 N ARG A 74 35555 40015 38818 3497 -720 -594 N ATOM 7423 CA ARG A 74 55.699-113.039 -9.993 1.00296.97 C ANISOU 7423 CA ARG A 74 35226 39450 38158 3140 -285 -12 C ATOM 7424 C ARG A 74 55.382-111.874 -10.920 1.00300.36 C ANISOU 7424 C ARG A 74 35193 40110 38821 2688 321 148 C ATOM 7425 O ARG A 74 55.782-110.727 -10.674 1.00298.37 O ANISOU 7425 O ARG A 74 34617 39989 38760 2553 509 -22 O ATOM 7426 CB ARG A 74 54.480-113.148 -9.091 1.00290.19 C ANISOU 7426 CB ARG A 74 35033 38284 36942 3046 -237 489 C ATOM 7427 CG ARG A 74 54.220-114.472 -8.428 1.00292.23 C ANISOU 7427 CG ARG A 74 36012 38200 36819 3336 -654 574 C ATOM 7428 CD ARG A 74 53.018-114.279 -7.514 1.00293.59 C ANISOU 7428 CD ARG A 74 36773 38089 36686 3117 -450 1015 C ATOM 7429 NE ARG A 74 53.245-113.323 -6.411 1.00299.39 N ANISOU 7429 NE ARG A 74 37548 38780 37426 3140 -497 922 N ATOM 7430 CZ ARG A 74 52.873-112.036 -6.392 1.00296.56 C ANISOU 7430 CZ ARG A 74 36840 38582 37256 2822 -88 1063 C ATOM 7431 NH1 ARG A 74 52.261-111.481 -7.432 1.00288.29 N ANISOU 7431 NH1 ARG A 74 35389 37739 36406 2469 385 1292 N ATOM 7432 NH2 ARG A 74 53.120-111.295 -5.318 1.00298.67 N ANISOU 7432 NH2 ARG A 74 37200 38782 37499 2882 -183 963 N ATOM 7433 N THR A 75 54.615-112.180 -11.967 1.00309.77 N ANISOU 7433 N THR A 75 36419 41314 39964 2464 612 484 N ATOM 7434 CA THR A 75 53.930-111.155 -12.767 1.00318.78 C ANISOU 7434 CA THR A 75 37367 42555 41198 2053 1150 777 C ATOM 7435 C THR A 75 52.437-111.125 -12.466 1.00314.80 C ANISOU 7435 C THR A 75 37284 41857 40468 1885 1311 1315 C ATOM 7436 O THR A 75 51.800-110.105 -12.703 1.00322.50 O ANISOU 7436 O THR A 75 38173 42865 41496 1611 1662 1536 O ATOM 7437 CB THR A 75 54.083-111.309 -14.309 1.00326.22 C ANISOU 7437 CB THR A 75 38030 43650 42267 1888 1411 740 C ATOM 7438 OG1 THR A 75 53.636-112.607 -14.735 1.00333.11 O ANISOU 7438 OG1 THR A 75 39162 44424 42980 2022 1227 907 O ATOM 7439 CG2 THR A 75 55.523-111.054 -14.764 1.00331.24 C ANISOU 7439 CG2 THR A 75 38155 44510 43189 1917 1428 151 C ATOM 7440 N THR A 76 51.884-112.233 -11.962 1.00305.28 N ANISOU 7440 N THR A 76 36540 40438 39014 2041 1065 1482 N ATOM 7441 CA THR A 76 50.436-112.351 -11.756 1.00297.22 C ANISOU 7441 CA THR A 76 35888 39235 37808 1844 1262 1911 C ATOM 7442 C THR A 76 50.039-111.823 -10.380 1.00300.40 C ANISOU 7442 C THR A 76 36584 39470 38082 1809 1253 1999 C ATOM 7443 O THR A 76 50.486-112.346 -9.365 1.00298.25 O ANISOU 7443 O THR A 76 36656 39029 37634 2045 921 1859 O ATOM 7444 CB THR A 76 49.981-113.805 -11.893 1.00291.88 C ANISOU 7444 CB THR A 76 35608 38381 36911 1956 1086 2025 C ATOM 7445 OG1 THR A 76 50.610-114.580 -10.874 1.00285.60 O ANISOU 7445 OG1 THR A 76 35202 37399 35914 2266 663 1833 O ATOM 7446 CG2 THR A 76 50.380-114.359 -13.246 1.00290.59 C ANISOU 7446 CG2 THR A 76 35159 38381 36870 1998 1085 1935 C ATOM 7447 N ILE A 77 49.204-110.785 -10.358 1.00305.36 N ANISOU 7447 N ILE A 77 37109 40126 38785 1532 1596 2214 N ATOM 7448 CA ILE A 77 48.970-109.984 -9.141 1.00313.09 C ANISOU 7448 CA ILE A 77 38240 41005 39712 1465 1642 2254 C ATOM 7449 C ILE A 77 47.887-110.601 -8.221 1.00323.69 C ANISOU 7449 C ILE A 77 40149 42054 40783 1379 1671 2463 C ATOM 7450 O ILE A 77 46.793-110.949 -8.688 1.00327.80 O ANISOU 7450 O ILE A 77 40757 42516 41274 1186 1893 2663 O ATOM 7451 CB ILE A 77 48.734-108.475 -9.495 1.00305.33 C ANISOU 7451 CB ILE A 77 36870 40191 38951 1227 1978 2322 C ATOM 7452 CG1 ILE A 77 50.079-107.785 -9.808 1.00302.71 C ANISOU 7452 CG1 ILE A 77 36117 40073 38826 1309 1934 2006 C ATOM 7453 CG2 ILE A 77 47.958-107.733 -8.397 1.00306.11 C ANISOU 7453 CG2 ILE A 77 37162 40160 38983 1078 2118 2469 C ATOM 7454 CD1 ILE A 77 49.984-106.416 -10.447 1.00298.70 C ANISOU 7454 CD1 ILE A 77 35283 39708 38501 1064 2286 2051 C ATOM 7455 N ASN A 78 48.230-110.753 -6.928 1.00332.19 N ANISOU 7455 N ASN A 78 41627 42931 41658 1520 1449 2373 N ATOM 7456 CA ASN A 78 47.332-111.334 -5.902 1.00329.79 C ANISOU 7456 CA ASN A 78 41982 42285 41036 1411 1503 2523 C ATOM 7457 C ASN A 78 46.907-110.387 -4.787 1.00325.83 C ANISOU 7457 C ASN A 78 41624 41682 40494 1245 1675 2581 C ATOM 7458 O ASN A 78 47.239-109.189 -4.761 1.00336.80 O ANISOU 7458 O ASN A 78 42588 43271 42110 1211 1754 2531 O ATOM 7459 CB ASN A 78 47.857-112.688 -5.303 1.00333.24 C ANISOU 7459 CB ASN A 78 43066 42428 41120 1704 1096 2410 C ATOM 7460 CG ASN A 78 49.180-112.559 -4.528 1.00338.87 C ANISOU 7460 CG ASN A 78 43867 43108 41778 2091 624 2115 C ATOM 7461 OD1 ASN A 78 49.381-111.638 -3.739 1.00339.71 O ANISOU 7461 OD1 ASN A 78 43924 43222 41925 2080 633 2059 O ATOM 7462 ND2 ASN A 78 50.083-113.514 -4.747 1.00343.22 N ANISOU 7462 ND2 ASN A 78 44545 43618 42244 2459 181 1888 N ATOM 7463 N THR A 79 46.171-110.983 -3.865 1.00313.69 N ANISOU 7463 N THR A 79 40736 39806 38643 1121 1753 2674 N ATOM 7464 CA THR A 79 45.594-110.345 -2.698 1.00310.38 C ANISOU 7464 CA THR A 79 40616 39205 38107 917 1955 2731 C ATOM 7465 C THR A 79 46.580-109.496 -1.834 1.00317.52 C ANISOU 7465 C THR A 79 41476 40141 39025 1133 1700 2585 C ATOM 7466 O THR A 79 46.207-108.422 -1.298 1.00327.10 O ANISOU 7466 O THR A 79 42542 41398 40342 944 1929 2634 O ATOM 7467 CB THR A 79 44.938-111.449 -1.844 1.00306.40 C ANISOU 7467 CB THR A 79 40992 38256 37168 797 2016 2784 C ATOM 7468 OG1 THR A 79 45.924-112.439 -1.523 1.00304.52 O ANISOU 7468 OG1 THR A 79 41267 37807 36627 1182 1526 2661 O ATOM 7469 CG2 THR A 79 43.807-112.134 -2.625 1.00299.21 C ANISOU 7469 CG2 THR A 79 40061 37328 36294 505 2362 2887 C ATOM 7470 N GLU A 80 47.820-109.981 -1.709 1.00315.31 N ANISOU 7470 N GLU A 80 41300 39843 38659 1539 1213 2369 N ATOM 7471 CA GLU A 80 48.793-109.429 -0.749 1.00310.79 C ANISOU 7471 CA GLU A 80 40805 39232 38047 1806 881 2155 C ATOM 7472 C GLU A 80 49.338-108.061 -1.078 1.00306.61 C ANISOU 7472 C GLU A 80 39507 39072 37919 1779 978 2041 C ATOM 7473 O GLU A 80 49.524-107.231 -0.174 1.00296.74 O ANISOU 7473 O GLU A 80 38295 37785 36666 1781 962 1984 O ATOM 7474 CB GLU A 80 49.944-110.403 -0.509 1.00312.81 C ANISOU 7474 CB GLU A 80 41400 39344 38109 2296 272 1872 C ATOM 7475 CG GLU A 80 49.494-111.582 0.332 1.00319.03 C ANISOU 7475 CG GLU A 80 43225 39626 38365 2355 119 1966 C ATOM 7476 CD GLU A 80 48.530-111.195 1.456 1.00321.28 C ANISOU 7476 CD GLU A 80 44084 39605 38383 2029 453 2169 C ATOM 7477 OE1 GLU A 80 47.391-111.723 1.464 1.00326.63 O ANISOU 7477 OE1 GLU A 80 45175 40067 38863 1673 845 2388 O ATOM 7478 OE2 GLU A 80 48.889-110.382 2.340 1.00319.48 O ANISOU 7478 OE2 GLU A 80 43895 39344 38147 2106 351 2078 O ATOM 7479 N ASP A 81 49.588-107.833 -2.367 1.00310.25 N ANISOU 7479 N ASP A 81 39323 39858 38698 1737 1097 2004 N ATOM 7480 CA ASP A 81 50.105-106.551 -2.850 1.00311.16 C ANISOU 7480 CA ASP A 81 38748 40301 39175 1659 1255 1886 C ATOM 7481 C ASP A 81 49.071-105.413 -2.616 1.00312.41 C ANISOU 7481 C ASP A 81 38808 40480 39412 1299 1693 2142 C ATOM 7482 O ASP A 81 49.422-104.306 -2.156 1.00308.91 O ANISOU 7482 O ASP A 81 38130 40135 39104 1263 1751 2056 O ATOM 7483 CB ASP A 81 50.530-106.694 -4.330 1.00308.02 C ANISOU 7483 CB ASP A 81 37830 40175 39025 1658 1324 1796 C ATOM 7484 CG ASP A 81 51.517-107.871 -4.572 1.00304.22 C ANISOU 7484 CG ASP A 81 37423 39679 38488 2020 884 1506 C ATOM 7485 OD1 ASP A 81 52.348-108.180 -3.685 1.00300.56 O ANISOU 7485 OD1 ASP A 81 37181 39099 37917 2348 457 1223 O ATOM 7486 OD2 ASP A 81 51.476-108.486 -5.664 1.00300.85 O ANISOU 7486 OD2 ASP A 81 36834 39349 38125 2002 936 1533 O ATOM 7487 N VAL A 82 47.803-105.745 -2.888 1.00312.86 N ANISOU 7487 N VAL A 82 39054 40431 39386 1050 1974 2411 N ATOM 7488 CA VAL A 82 46.637-104.849 -2.749 1.00301.14 C ANISOU 7488 CA VAL A 82 37485 38947 37988 722 2369 2612 C ATOM 7489 C VAL A 82 46.401-104.394 -1.297 1.00306.15 C ANISOU 7489 C VAL A 82 38479 39381 38462 654 2398 2621 C ATOM 7490 O VAL A 82 46.342-103.198 -1.023 1.00310.03 O ANISOU 7490 O VAL A 82 38705 39979 39111 543 2552 2629 O ATOM 7491 CB VAL A 82 45.316-105.507 -3.270 1.00286.60 C ANISOU 7491 CB VAL A 82 35785 37010 36099 498 2620 2792 C ATOM 7492 CG1 VAL A 82 44.137-104.553 -3.125 1.00270.92 C ANISOU 7492 CG1 VAL A 82 33645 35039 34252 198 2982 2902 C ATOM 7493 CG2 VAL A 82 45.437-106.001 -4.713 1.00280.90 C ANISOU 7493 CG2 VAL A 82 34759 36460 35510 560 2594 2803 C ATOM 7494 N LYS A 83 46.253-105.342 -0.374 1.00306.81 N ANISOU 7494 N LYS A 83 39220 39145 38206 710 2262 2622 N ATOM 7495 CA LYS A 83 46.003-104.992 1.020 1.00302.59 C ANISOU 7495 CA LYS A 83 39136 38368 37464 628 2305 2631 C ATOM 7496 C LYS A 83 47.247-104.357 1.652 1.00302.43 C ANISOU 7496 C LYS A 83 39017 38415 37477 917 1969 2433 C ATOM 7497 O LYS A 83 47.120-103.597 2.616 1.00309.65 O ANISOU 7497 O LYS A 83 40064 39244 38345 833 2047 2439 O ATOM 7498 CB LYS A 83 45.473-106.188 1.825 1.00299.29 C ANISOU 7498 CB LYS A 83 39576 37526 36614 571 2295 2678 C ATOM 7499 CG LYS A 83 44.090-106.636 1.380 1.00293.83 C ANISOU 7499 CG LYS A 83 38949 36764 35930 196 2730 2813 C ATOM 7500 CD LYS A 83 43.382-107.442 2.445 1.00291.31 C ANISOU 7500 CD LYS A 83 39506 35989 35189 -15 2901 2834 C ATOM 7501 CE LYS A 83 43.914-108.854 2.442 1.00293.03 C ANISOU 7501 CE LYS A 83 40347 35943 35047 228 2571 2800 C ATOM 7502 NZ LYS A 83 43.523-109.521 3.698 1.00292.07 N ANISOU 7502 NZ LYS A 83 41258 35299 34416 81 2661 2799 N ATOM 7503 N LEU A 84 48.435-104.629 1.090 1.00293.61 N ANISOU 7503 N LEU A 84 37619 37466 36473 1242 1612 2217 N ATOM 7504 CA LEU A 84 49.658-103.932 1.534 1.00286.19 C ANISOU 7504 CA LEU A 84 36418 36656 35664 1503 1316 1933 C ATOM 7505 C LEU A 84 49.734-102.528 0.913 1.00283.13 C ANISOU 7505 C LEU A 84 35302 36610 35664 1301 1628 1931 C ATOM 7506 O LEU A 84 50.469-101.668 1.392 1.00277.73 O ANISOU 7506 O LEU A 84 34383 36030 35112 1389 1535 1733 O ATOM 7507 CB LEU A 84 50.946-104.753 1.300 1.00284.66 C ANISOU 7507 CB LEU A 84 36195 36495 35464 1940 797 1590 C ATOM 7508 CG LEU A 84 52.208-104.468 2.133 1.00290.60 C ANISOU 7508 CG LEU A 84 36929 37245 36240 2320 330 1187 C ATOM 7509 CD1 LEU A 84 51.992-104.662 3.634 1.00295.79 C ANISOU 7509 CD1 LEU A 84 38387 37502 36498 2442 106 1230 C ATOM 7510 CD2 LEU A 84 53.367-105.326 1.642 1.00296.78 C ANISOU 7510 CD2 LEU A 84 37557 38108 37096 2736 -153 791 C ATOM 7511 N LEU A 85 48.954-102.284 -0.135 1.00288.25 N ANISOU 7511 N LEU A 85 35643 37404 36474 1034 1989 2136 N ATOM 7512 CA LEU A 85 48.847-100.931 -0.669 1.00294.73 C ANISOU 7512 CA LEU A 85 35940 38461 37581 823 2300 2175 C ATOM 7513 C LEU A 85 47.956-100.031 0.216 1.00289.49 C ANISOU 7513 C LEU A 85 35415 37694 36883 596 2548 2346 C ATOM 7514 O LEU A 85 48.166 -98.811 0.313 1.00285.47 O ANISOU 7514 O LEU A 85 34594 37319 36549 507 2687 2307 O ATOM 7515 CB LEU A 85 48.347-100.980 -2.106 1.00307.17 C ANISOU 7515 CB LEU A 85 37219 40184 39305 671 2534 2309 C ATOM 7516 CG LEU A 85 48.881 -99.856 -2.978 1.00315.05 C ANISOU 7516 CG LEU A 85 37706 41428 40568 578 2718 2217 C ATOM 7517 CD1 LEU A 85 50.377-100.026 -3.203 1.00318.09 C ANISOU 7517 CD1 LEU A 85 37831 41961 41066 786 2494 1851 C ATOM 7518 CD2 LEU A 85 48.125 -99.826 -4.297 1.00315.90 C ANISOU 7518 CD2 LEU A 85 37674 41600 40753 416 2955 2402 C ATOM 7519 N ALA A 86 46.981-100.660 0.873 1.00284.77 N ANISOU 7519 N ALA A 86 35304 36842 36052 485 2622 2504 N ATOM 7520 CA ALA A 86 46.100-100.006 1.840 1.00275.39 C ANISOU 7520 CA ALA A 86 34321 35512 34800 258 2861 2617 C ATOM 7521 C ALA A 86 46.705-100.038 3.245 1.00272.92 C ANISOU 7521 C ALA A 86 34446 34995 34256 415 2620 2503 C ATOM 7522 O ALA A 86 45.978-100.135 4.247 1.00268.55 O ANISOU 7522 O ALA A 86 34370 34181 33483 256 2755 2585 O ATOM 7523 CB ALA A 86 44.744-100.687 1.842 1.00275.69 C ANISOU 7523 CB ALA A 86 34667 35365 34714 11 3120 2767 C ATOM 7524 N ARG A 87 48.041 -99.943 3.289 1.00271.73 N ANISOU 7524 N ARG A 87 34124 34955 34164 722 2269 2270 N ATOM 7525 CA ARG A 87 48.878-100.027 4.522 1.00274.70 C ANISOU 7525 CA ARG A 87 34879 35153 34341 993 1899 2072 C ATOM 7526 C ARG A 87 48.859 -98.756 5.388 1.00277.63 C ANISOU 7526 C ARG A 87 35145 35548 34791 883 2029 2063 C ATOM 7527 O ARG A 87 49.300 -98.754 6.554 1.00280.72 O ANISOU 7527 O ARG A 87 35942 35740 34978 1061 1768 1940 O ATOM 7528 CB ARG A 87 50.346-100.361 4.145 1.00271.55 C ANISOU 7528 CB ARG A 87 34208 34909 34059 1387 1451 1719 C ATOM 7529 CG ARG A 87 51.246 -99.163 3.798 1.00265.69 C ANISOU 7529 CG ARG A 87 32758 34499 33691 1407 1488 1476 C ATOM 7530 CD ARG A 87 52.186 -99.426 2.625 1.00261.47 C ANISOU 7530 CD ARG A 87 31702 34232 33413 1547 1376 1204 C ATOM 7531 NE ARG A 87 51.657 -98.884 1.382 1.00255.49 N ANISOU 7531 NE ARG A 87 30514 33687 32873 1227 1821 1398 N ATOM 7532 CZ ARG A 87 52.151 -97.826 0.756 1.00254.65 C ANISOU 7532 CZ ARG A 87 29864 33832 33058 1085 2052 1257 C ATOM 7533 NH1 ARG A 87 53.209 -97.196 1.237 1.00254.84 N ANISOU 7533 NH1 ARG A 87 29617 33968 33242 1209 1912 889 N ATOM 7534 NH2 ARG A 87 51.588 -97.405 -0.359 1.00252.55 N ANISOU 7534 NH2 ARG A 87 29364 33681 32910 818 2422 1459 N ATOM 7535 N ARG A 88 48.323 -97.698 4.795 1.00278.50 N ANISOU 7535 N ARG A 88 34757 35882 35179 606 2411 2190 N ATOM 7536 CA ARG A 88 48.586 -96.331 5.207 1.00282.89 C ANISOU 7536 CA ARG A 88 34991 36573 35919 530 2525 2131 C ATOM 7537 C ARG A 88 47.802 -95.836 6.462 1.00292.00 C ANISOU 7537 C ARG A 88 36528 37510 36907 351 2691 2262 C ATOM 7538 O ARG A 88 48.424 -95.480 7.480 1.00290.56 O ANISOU 7538 O ARG A 88 36519 37242 36637 500 2485 2120 O ATOM 7539 CB ARG A 88 48.432 -95.449 3.969 1.00275.61 C ANISOU 7539 CB ARG A 88 33458 35940 35320 343 2825 2190 C ATOM 7540 CG ARG A 88 49.510 -95.691 2.914 1.00265.89 C ANISOU 7540 CG ARG A 88 31837 34925 34262 508 2677 1970 C ATOM 7541 CD ARG A 88 50.543 -94.584 3.004 1.00260.35 C ANISOU 7541 CD ARG A 88 30719 34416 33784 539 2678 1707 C ATOM 7542 NE ARG A 88 51.911 -95.063 3.004 1.00254.25 N ANISOU 7542 NE ARG A 88 29784 33734 33083 833 2328 1302 N ATOM 7543 CZ ARG A 88 52.586 -95.406 4.095 1.00253.67 C ANISOU 7543 CZ ARG A 88 29940 33544 32896 1124 1932 1058 C ATOM 7544 NH1 ARG A 88 52.030 -95.330 5.295 1.00252.61 N ANISOU 7544 NH1 ARG A 88 30271 33175 32530 1129 1869 1217 N ATOM 7545 NH2 ARG A 88 53.829 -95.824 3.976 1.00252.53 N ANISOU 7545 NH2 ARG A 88 29571 33505 32871 1418 1587 614 N ATOM 7546 N SER A 89 46.461 -95.826 6.393 1.00302.05 N ANISOU 7546 N SER A 89 37921 38692 38151 40 3053 2484 N ATOM 7547 CA SER A 89 45.585 -95.600 7.579 1.00307.92 C ANISOU 7547 CA SER A 89 39100 39186 38709 -179 3263 2572 C ATOM 7548 C SER A 89 45.000 -96.927 8.094 1.00310.99 C ANISOU 7548 C SER A 89 40211 39221 38728 -242 3271 2622 C ATOM 7549 O SER A 89 44.557 -97.780 7.306 1.00315.07 O ANISOU 7549 O SER A 89 40743 39732 39234 -298 3341 2677 O ATOM 7550 CB SER A 89 44.469 -94.558 7.316 1.00308.37 C ANISOU 7550 CB SER A 89 38788 39366 39011 -508 3688 2688 C ATOM 7551 OG SER A 89 43.364 -95.094 6.594 1.00309.86 O ANISOU 7551 OG SER A 89 38938 39539 39252 -710 3933 2772 O ATOM 7552 N ASN A 90 45.016 -97.123 9.407 1.00309.69 N ANISOU 7552 N ASN A 90 40700 38733 38234 -240 3204 2593 N ATOM 7553 CA ASN A 90 44.709 -98.457 9.912 1.00308.54 C ANISOU 7553 CA ASN A 90 41381 38191 37659 -258 3159 2610 C ATOM 7554 C ASN A 90 43.211 -98.701 10.164 1.00305.82 C ANISOU 7554 C ASN A 90 41333 37642 37220 -740 3701 2700 C ATOM 7555 O ASN A 90 42.765 -99.855 10.216 1.00305.59 O ANISOU 7555 O ASN A 90 41874 37332 36903 -849 3787 2713 O ATOM 7556 CB ASN A 90 45.645 -98.855 11.060 1.00310.19 C ANISOU 7556 CB ASN A 90 42305 38081 37472 67 2711 2491 C ATOM 7557 CG ASN A 90 47.099 -98.485 10.777 1.00308.24 C ANISOU 7557 CG ASN A 90 41599 38093 37424 528 2199 2293 C ATOM 7558 OD1 ASN A 90 47.500 -97.335 10.981 1.00304.76 O ANISOU 7558 OD1 ASN A 90 40697 37867 37228 556 2196 2222 O ATOM 7559 ND2 ASN A 90 47.890 -99.453 10.295 1.00307.09 N ANISOU 7559 ND2 ASN A 90 41555 37931 37192 877 1780 2163 N ATOM 7560 N SER A 91 42.441 -97.609 10.251 1.00298.14 N ANISOU 7560 N SER A 91 39932 36824 36520 -1030 4071 2719 N ATOM 7561 CA SER A 91 40.968 -97.656 10.134 1.00292.59 C ANISOU 7561 CA SER A 91 39181 36069 35921 -1485 4605 2710 C ATOM 7562 C SER A 91 40.522 -98.354 8.820 1.00291.56 C ANISOU 7562 C SER A 91 38705 36099 35974 -1512 4669 2721 C ATOM 7563 O SER A 91 39.593 -99.192 8.788 1.00286.34 O ANISOU 7563 O SER A 91 38344 35248 35203 -1797 4974 2666 O ATOM 7564 CB SER A 91 40.384 -96.232 10.245 1.00283.48 C ANISOU 7564 CB SER A 91 37461 35131 35115 -1681 4876 2683 C ATOM 7565 OG SER A 91 40.866 -95.364 9.229 1.00265.40 O ANISOU 7565 OG SER A 91 34402 33237 33200 -1467 4695 2726 O ATOM 7566 N LEU A 92 41.228 -98.009 7.746 1.00293.38 N ANISOU 7566 N LEU A 92 38331 36667 36473 -1227 4392 2768 N ATOM 7567 CA LEU A 92 41.065 -98.616 6.426 1.00295.81 C ANISOU 7567 CA LEU A 92 38306 37146 36943 -1168 4357 2792 C ATOM 7568 C LEU A 92 41.480-100.102 6.391 1.00296.36 C ANISOU 7568 C LEU A 92 38939 36988 36676 -1028 4149 2800 C ATOM 7569 O LEU A 92 40.722-100.947 5.880 1.00301.07 O ANISOU 7569 O LEU A 92 39629 37513 37251 -1198 4340 2790 O ATOM 7570 CB LEU A 92 41.919 -97.825 5.434 1.00297.49 C ANISOU 7570 CB LEU A 92 37861 37719 37453 -899 4111 2826 C ATOM 7571 CG LEU A 92 41.653 -97.669 3.937 1.00298.03 C ANISOU 7571 CG LEU A 92 37352 38059 37825 -872 4142 2857 C ATOM 7572 CD1 LEU A 92 43.007 -97.604 3.251 1.00293.66 C ANISOU 7572 CD1 LEU A 92 36552 37698 37326 -554 3807 2854 C ATOM 7573 CD2 LEU A 92 40.812 -98.782 3.328 1.00303.09 C ANISOU 7573 CD2 LEU A 92 38114 38616 38428 -996 4273 2850 C ATOM 7574 N LEU A 93 42.685-100.396 6.903 1.00291.92 N ANISOU 7574 N LEU A 93 38727 36318 35870 -696 3734 2783 N ATOM 7575 CA LEU A 93 43.257-101.752 6.944 1.00285.97 C ANISOU 7575 CA LEU A 93 38558 35325 34770 -470 3425 2762 C ATOM 7576 C LEU A 93 42.344-102.757 7.653 1.00292.93 C ANISOU 7576 C LEU A 93 40274 35766 35257 -770 3708 2772 C ATOM 7577 O LEU A 93 42.170-103.885 7.178 1.00294.28 O ANISOU 7577 O LEU A 93 40727 35811 35274 -772 3693 2783 O ATOM 7578 CB LEU A 93 44.650-101.743 7.579 1.00276.66 C ANISOU 7578 CB LEU A 93 37636 34072 33408 -38 2896 2659 C ATOM 7579 CG LEU A 93 45.300-103.104 7.790 1.00272.47 C ANISOU 7579 CG LEU A 93 37808 33238 32477 266 2484 2591 C ATOM 7580 CD1 LEU A 93 45.630-103.746 6.454 1.00267.57 C ANISOU 7580 CD1 LEU A 93 36752 32860 32050 431 2331 2578 C ATOM 7581 CD2 LEU A 93 46.551-102.939 8.630 1.00272.95 C ANISOU 7581 CD2 LEU A 93 38147 33191 32368 700 1945 2416 C ATOM 7582 N LYS A 94 41.751-102.343 8.773 1.00299.30 N ANISOU 7582 N LYS A 94 41490 36330 35899 -1053 4004 2752 N ATOM 7583 CA LYS A 94 40.743-103.170 9.447 1.00310.05 C ANISOU 7583 CA LYS A 94 43633 37262 36909 -1459 4420 2717 C ATOM 7584 C LYS A 94 39.442-103.343 8.637 1.00318.39 C ANISOU 7584 C LYS A 94 44253 38459 38260 -1870 4928 2658 C ATOM 7585 O LYS A 94 38.964-104.467 8.499 1.00333.28 O ANISOU 7585 O LYS A 94 46604 40103 39923 -2048 5103 2619 O ATOM 7586 CB LYS A 94 40.491-102.703 10.892 1.00308.56 C ANISOU 7586 CB LYS A 94 44057 36742 36437 -1679 4630 2677 C ATOM 7587 CG LYS A 94 41.413-103.387 11.899 1.00313.00 C ANISOU 7587 CG LYS A 94 45660 36851 36413 -1377 4206 2686 C ATOM 7588 CD LYS A 94 41.444-102.699 13.269 1.00316.92 C ANISOU 7588 CD LYS A 94 46668 37080 36665 -1472 4279 2658 C ATOM 7589 CE LYS A 94 42.768-102.921 14.000 1.00321.89 C ANISOU 7589 CE LYS A 94 47932 37464 36908 -930 3601 2637 C ATOM 7590 NZ LYS A 94 42.922-104.250 14.669 1.00329.60 N ANISOU 7590 NZ LYS A 94 50219 37817 37193 -846 3421 2621 N ATOM 7591 N TYR A 95 38.900-102.265 8.071 1.00316.79 N ANISOU 7591 N TYR A 95 43180 38633 38552 -1988 5125 2622 N ATOM 7592 CA TYR A 95 37.723-102.357 7.186 1.00321.05 C ANISOU 7592 CA TYR A 95 43204 39347 39433 -2281 5499 2506 C ATOM 7593 C TYR A 95 37.920-103.264 5.961 1.00321.89 C ANISOU 7593 C TYR A 95 43117 39584 39602 -2092 5297 2557 C ATOM 7594 O TYR A 95 37.031-104.029 5.600 1.00323.85 O ANISOU 7594 O TYR A 95 43437 39743 39867 -2361 5598 2439 O ATOM 7595 CB TYR A 95 37.305-100.968 6.713 1.00316.75 C ANISOU 7595 CB TYR A 95 41778 39180 39390 -2303 5586 2457 C ATOM 7596 CG TYR A 95 36.087-100.933 5.797 1.00324.25 C ANISOU 7596 CG TYR A 95 42153 40317 40730 -2531 5886 2275 C ATOM 7597 CD1 TYR A 95 36.190-101.216 4.428 1.00323.21 C ANISOU 7597 CD1 TYR A 95 41553 40434 40816 -2310 5670 2324 C ATOM 7598 CD2 TYR A 95 34.833-100.579 6.292 1.00334.77 C ANISOU 7598 CD2 TYR A 95 43384 41579 42234 -2954 6368 2007 C ATOM 7599 CE1 TYR A 95 35.079-101.177 3.587 1.00332.75 C ANISOU 7599 CE1 TYR A 95 42251 41798 42380 -2468 5881 2121 C ATOM 7600 CE2 TYR A 95 33.712-100.524 5.453 1.00344.06 C ANISOU 7600 CE2 TYR A 95 43980 42935 43810 -3117 6587 1754 C ATOM 7601 CZ TYR A 95 33.836-100.825 4.102 1.00342.64 C ANISOU 7601 CZ TYR A 95 43375 42987 43823 -2854 6319 1816 C ATOM 7602 OH TYR A 95 32.731-100.769 3.265 1.00350.43 O ANISOU 7602 OH TYR A 95 43806 44136 45203 -2965 6473 1533 O ATOM 7603 N ILE A 96 39.073-103.175 5.313 1.00320.38 N ANISOU 7603 N ILE A 96 42657 39607 39463 -1650 4813 2695 N ATOM 7604 CA ILE A 96 39.279-103.908 4.057 1.00313.66 C ANISOU 7604 CA ILE A 96 41535 38923 38718 -1466 4626 2738 C ATOM 7605 C ILE A 96 39.614-105.429 4.204 1.00320.41 C ANISOU 7605 C ILE A 96 43134 39458 39148 -1389 4483 2759 C ATOM 7606 O ILE A 96 39.210-106.223 3.343 1.00321.03 O ANISOU 7606 O ILE A 96 43113 39577 39287 -1441 4551 2743 O ATOM 7607 CB ILE A 96 40.243-103.133 3.108 1.00302.29 C ANISOU 7607 CB ILE A 96 39412 37872 37571 -1095 4260 2823 C ATOM 7608 CG1 ILE A 96 39.619-101.803 2.646 1.00294.38 C ANISOU 7608 CG1 ILE A 96 37709 37153 36986 -1214 4456 2796 C ATOM 7609 CG2 ILE A 96 40.670-103.975 1.911 1.00295.32 C ANISOU 7609 CG2 ILE A 96 38360 37118 36728 -876 4028 2865 C ATOM 7610 CD1 ILE A 96 38.514-101.933 1.613 1.00285.50 C ANISOU 7610 CD1 ILE A 96 36173 36163 36140 -1378 4676 2718 C ATOM 7611 N THR A 97 40.317-105.843 5.276 1.00322.11 N ANISOU 7611 N THR A 97 44128 39335 38923 -1253 4267 2780 N ATOM 7612 CA THR A 97 40.581-107.290 5.528 1.00318.21 C ANISOU 7612 CA THR A 97 44494 38456 37956 -1173 4115 2786 C ATOM 7613 C THR A 97 39.288-108.094 5.660 1.00321.91 C ANISOU 7613 C THR A 97 45394 38642 38273 -1675 4665 2703 C ATOM 7614 O THR A 97 39.216-109.238 5.201 1.00321.67 O ANISOU 7614 O THR A 97 45689 38467 38063 -1668 4638 2705 O ATOM 7615 CB THR A 97 41.478-107.571 6.763 1.00315.34 C ANISOU 7615 CB THR A 97 45027 37698 37089 -920 3757 2786 C ATOM 7616 OG1 THR A 97 40.925-106.975 7.948 1.00313.36 O ANISOU 7616 OG1 THR A 97 45177 37204 36680 -1236 4094 2752 O ATOM 7617 CG2 THR A 97 42.884-107.055 6.527 1.00309.27 C ANISOU 7617 CG2 THR A 97 43838 37199 36471 -375 3152 2778 C ATOM 7618 N ASP A 98 38.277-107.472 6.281 1.00324.71 N ANISOU 7618 N ASP A 98 45721 38928 38724 -2120 5178 2592 N ATOM 7619 CA ASP A 98 36.890-107.995 6.376 1.00327.56 C ANISOU 7619 CA ASP A 98 46283 39094 39079 -2690 5819 2401 C ATOM 7620 C ASP A 98 36.214-108.251 5.025 1.00334.08 C ANISOU 7620 C ASP A 98 46359 40245 40331 -2764 5951 2313 C ATOM 7621 O ASP A 98 35.650-109.331 4.778 1.00343.19 O ANISOU 7621 O ASP A 98 47853 41200 41340 -3001 6200 2211 O ATOM 7622 CB ASP A 98 35.993-107.021 7.169 1.00322.45 C ANISOU 7622 CB ASP A 98 45487 38427 38600 -3111 6311 2230 C ATOM 7623 CG ASP A 98 36.233-107.067 8.681 1.00322.77 C ANISOU 7623 CG ASP A 98 46536 37985 38115 -3250 6409 2243 C ATOM 7624 OD1 ASP A 98 37.223-107.688 9.141 1.00318.91 O ANISOU 7624 OD1 ASP A 98 46826 37199 37144 -2925 5988 2397 O ATOM 7625 OD2 ASP A 98 35.417-106.452 9.406 1.00326.95 O ANISOU 7625 OD2 ASP A 98 47076 38428 38721 -3671 6892 2070 O ATOM 7626 N LYS A 99 36.240-107.243 4.162 1.00335.31 N ANISOU 7626 N LYS A 99 45536 40872 40993 -2571 5794 2335 N ATOM 7627 CA LYS A 99 35.605-107.374 2.869 1.00333.49 C ANISOU 7627 CA LYS A 99 44607 40940 41164 -2593 5862 2242 C ATOM 7628 C LYS A 99 36.366-108.352 1.978 1.00332.64 C ANISOU 7628 C LYS A 99 44589 40873 40925 -2259 5479 2400 C ATOM 7629 O LYS A 99 35.789-108.906 1.059 1.00333.36 O ANISOU 7629 O LYS A 99 44394 41070 41197 -2337 5585 2312 O ATOM 7630 CB LYS A 99 35.398-106.005 2.226 1.00326.29 C ANISOU 7630 CB LYS A 99 42760 40448 40764 -2469 5785 2214 C ATOM 7631 CG LYS A 99 34.050-105.360 2.586 1.00326.71 C ANISOU 7631 CG LYS A 99 42498 40519 41115 -2888 6275 1902 C ATOM 7632 CD LYS A 99 33.895-104.945 4.057 1.00326.07 C ANISOU 7632 CD LYS A 99 42909 40167 40813 -3175 6568 1832 C ATOM 7633 CE LYS A 99 32.515-104.360 4.378 1.00325.21 C ANISOU 7633 CE LYS A 99 42437 40086 41040 -3617 7087 1445 C ATOM 7634 NZ LYS A 99 31.405-105.350 4.285 1.00328.52 N ANISOU 7634 NZ LYS A 99 43002 40333 41488 -4059 7571 1097 N ATOM 7635 N SER A 100 37.647-108.576 2.291 1.00328.98 N ANISOU 7635 N SER A 100 44526 40315 40154 -1887 5030 2591 N ATOM 7636 CA SER A 100 38.473-109.607 1.649 1.00323.27 C ANISOU 7636 CA SER A 100 44017 39567 39243 -1558 4643 2701 C ATOM 7637 C SER A 100 38.024-111.026 2.018 1.00330.49 C ANISOU 7637 C SER A 100 45779 40051 39739 -1795 4855 2641 C ATOM 7638 O SER A 100 38.236-111.961 1.255 1.00323.36 O ANISOU 7638 O SER A 100 44932 39155 38775 -1650 4687 2678 O ATOM 7639 CB SER A 100 39.957-109.425 1.985 1.00315.55 C ANISOU 7639 CB SER A 100 43220 38593 38078 -1084 4088 2819 C ATOM 7640 OG SER A 100 40.319-110.145 3.149 1.00309.29 O ANISOU 7640 OG SER A 100 43434 37331 36748 -1058 3985 2815 O ATOM 7641 N GLU A 101 37.421-111.195 3.191 1.00345.12 N ANISOU 7641 N GLU A 101 48344 41505 41280 -2175 5243 2540 N ATOM 7642 CA GLU A 101 36.739-112.467 3.519 1.00357.49 C ANISOU 7642 CA GLU A 101 50728 42632 42468 -2543 5613 2429 C ATOM 7643 C GLU A 101 35.410-112.635 2.724 1.00359.28 C ANISOU 7643 C GLU A 101 50381 43038 43091 -2965 6129 2201 C ATOM 7644 O GLU A 101 34.997-113.766 2.347 1.00358.38 O ANISOU 7644 O GLU A 101 50592 42747 42830 -3142 6311 2121 O ATOM 7645 CB GLU A 101 36.510-112.595 5.042 1.00365.54 C ANISOU 7645 CB GLU A 101 52787 43115 42984 -2867 5922 2363 C ATOM 7646 CG GLU A 101 37.792-112.759 5.865 1.00366.37 C ANISOU 7646 CG GLU A 101 53691 42924 42588 -2421 5362 2539 C ATOM 7647 CD GLU A 101 37.627-112.438 7.353 1.00367.17 C ANISOU 7647 CD GLU A 101 54638 42583 42285 -2678 5609 2490 C ATOM 7648 OE1 GLU A 101 36.507-112.572 7.886 1.00366.99 O ANISOU 7648 OE1 GLU A 101 54975 42297 42167 -3289 6294 2309 O ATOM 7649 OE2 GLU A 101 38.634-112.031 7.990 1.00365.85 O ANISOU 7649 OE2 GLU A 101 54761 42335 41907 -2272 5120 2597 O ATOM 7650 N GLU A 102 34.745-111.507 2.462 1.00359.56 N ANISOU 7650 N GLU A 102 49562 43419 43634 -3102 6335 2065 N ATOM 7651 CA GLU A 102 33.488-111.506 1.705 1.00356.98 C ANISOU 7651 CA GLU A 102 48584 43297 43753 -3430 6742 1772 C ATOM 7652 C GLU A 102 33.741-111.903 0.257 1.00353.95 C ANISOU 7652 C GLU A 102 47644 43227 43614 -3097 6396 1866 C ATOM 7653 O GLU A 102 32.964-112.617 -0.378 1.00351.08 O ANISOU 7653 O GLU A 102 47136 42872 43387 -3308 6638 1669 O ATOM 7654 CB GLU A 102 32.868-110.126 1.751 1.00358.37 C ANISOU 7654 CB GLU A 102 47992 43767 44405 -3533 6902 1601 C ATOM 7655 CG GLU A 102 31.590-110.021 0.962 1.00361.32 C ANISOU 7655 CG GLU A 102 47630 44369 45286 -3789 7228 1228 C ATOM 7656 CD GLU A 102 31.213-108.586 0.740 1.00367.37 C ANISOU 7656 CD GLU A 102 47562 45481 46541 -3694 7167 1108 C ATOM 7657 OE1 GLU A 102 30.701-108.281 -0.352 1.00371.01 O ANISOU 7657 OE1 GLU A 102 47270 46253 47444 -3556 7049 955 O ATOM 7658 OE2 GLU A 102 31.445-107.758 1.650 1.00372.98 O ANISOU 7658 OE2 GLU A 102 48405 46132 47176 -3731 7205 1167 O ATOM 7659 N ILE A 103 34.860-111.418 -0.248 1.00353.67 N ANISOU 7659 N ILE A 103 47303 43441 43633 -2586 5840 2143 N ATOM 7660 CA ILE A 103 35.332-111.772 -1.574 1.00353.99 C ANISOU 7660 CA ILE A 103 46909 43751 43839 -2234 5471 2268 C ATOM 7661 C ILE A 103 35.942-113.221 -1.645 1.00371.30 C ANISOU 7661 C ILE A 103 49799 45675 45601 -2110 5286 2386 C ATOM 7662 O ILE A 103 35.737-113.916 -2.657 1.00387.23 O ANISOU 7662 O ILE A 103 51590 47804 47735 -2060 5243 2365 O ATOM 7663 CB ILE A 103 36.235-110.626 -2.142 1.00334.41 C ANISOU 7663 CB ILE A 103 43803 41641 41614 -1804 5033 2454 C ATOM 7664 CG1 ILE A 103 35.464-109.282 -2.119 1.00319.59 C ANISOU 7664 CG1 ILE A 103 41307 39981 40141 -1952 5240 2311 C ATOM 7665 CG2 ILE A 103 36.741-110.968 -3.542 1.00328.46 C ANISOU 7665 CG2 ILE A 103 42637 41147 41015 -1475 4694 2566 C ATOM 7666 CD1 ILE A 103 36.309-108.024 -1.991 1.00305.79 C ANISOU 7666 CD1 ILE A 103 39257 38432 38495 -1675 4957 2470 C ATOM 7667 N ALA A 104 36.635-113.677 -0.582 1.00375.14 N ANISOU 7667 N ALA A 104 51155 45791 45588 -2050 5163 2487 N ATOM 7668 CA ALA A 104 37.279-115.025 -0.516 1.00372.23 C ANISOU 7668 CA ALA A 104 51573 45105 44751 -1878 4918 2582 C ATOM 7669 C ALA A 104 36.278-116.182 -0.619 1.00372.33 C ANISOU 7669 C ALA A 104 52020 44841 44606 -2300 5371 2423 C ATOM 7670 O ALA A 104 36.644-117.318 -0.919 1.00367.28 O ANISOU 7670 O ALA A 104 51855 44015 43679 -2165 5189 2488 O ATOM 7671 CB ALA A 104 38.137-115.169 0.738 1.00368.11 C ANISOU 7671 CB ALA A 104 51960 44194 43710 -1708 4667 2671 C ATOM 7672 N GLN A 105 35.013-115.865 -0.373 1.00376.09 N ANISOU 7672 N GLN A 105 52302 45298 45294 -2816 5968 2172 N ATOM 7673 CA GLN A 105 33.884-116.763 -0.603 1.00382.37 C ANISOU 7673 CA GLN A 105 53258 45925 46099 -3289 6494 1912 C ATOM 7674 C GLN A 105 33.662-117.246 -2.048 1.00381.47 C ANISOU 7674 C GLN A 105 52491 46126 46323 -3144 6363 1881 C ATOM 7675 O GLN A 105 33.234-118.383 -2.253 1.00382.02 O ANISOU 7675 O GLN A 105 52963 45973 46213 -3371 6596 1770 O ATOM 7676 CB GLN A 105 32.617-116.074 -0.138 1.00390.60 C ANISOU 7676 CB GLN A 105 53972 46990 47446 -3824 7117 1561 C ATOM 7677 CG GLN A 105 32.295-116.293 1.313 1.00408.48 C ANISOU 7677 CG GLN A 105 57214 48734 49252 -4284 7590 1438 C ATOM 7678 CD GLN A 105 30.996-115.631 1.659 1.00421.10 C ANISOU 7678 CD GLN A 105 58366 50401 51230 -4835 8238 1013 C ATOM 7679 OE1 GLN A 105 30.947-114.418 1.828 1.00416.91 O ANISOU 7679 OE1 GLN A 105 57247 50136 51022 -4747 8169 993 O ATOM 7680 NE2 GLN A 105 29.928-116.411 1.730 1.00436.68 N ANISOU 7680 NE2 GLN A 105 60572 52148 53196 -5409 8876 627 N ATOM 7681 N ALA A 106 33.899-116.376 -3.032 1.00380.98 N ANISOU 7681 N ALA A 106 51471 46552 46730 -2798 6026 1961 N ATOM 7682 CA ALA A 106 33.636-116.700 -4.450 1.00380.07 C ANISOU 7682 CA ALA A 106 50709 46744 46956 -2649 5894 1919 C ATOM 7683 C ALA A 106 34.713-117.592 -5.082 1.00381.70 C ANISOU 7683 C ALA A 106 51183 46938 46907 -2239 5419 2188 C ATOM 7684 O ALA A 106 35.069-118.644 -4.542 1.00390.47 O ANISOU 7684 O ALA A 106 53143 47673 47543 -2278 5412 2253 O ATOM 7685 CB ALA A 106 33.433-115.429 -5.272 1.00370.37 C ANISOU 7685 CB ALA A 106 48474 45976 46272 -2448 5727 1885 C TER 7686 ALA A 106 ATOM 7687 N SER B 8 27.183 -99.920 -2.184 1.00325.31 N ANISOU 7687 N SER B 8 41459 39291 42852 -1349 2384 -1749 N ATOM 7688 CA SER B 8 27.156 -99.159 -3.467 1.00324.34 C ANISOU 7688 CA SER B 8 40837 39197 43201 -1115 2096 -1434 C ATOM 7689 C SER B 8 28.560 -98.682 -3.885 1.00331.20 C ANISOU 7689 C SER B 8 41715 40238 43884 -848 1824 -1140 C ATOM 7690 O SER B 8 29.311 -98.215 -3.034 1.00331.47 O ANISOU 7690 O SER B 8 41860 40255 43828 -851 1936 -1258 O ATOM 7691 CB SER B 8 26.212 -97.977 -3.288 1.00317.80 C ANISOU 7691 CB SER B 8 39403 38105 43241 -1238 2275 -1617 C ATOM 7692 OG SER B 8 25.847 -97.443 -4.537 1.00308.05 O ANISOU 7692 OG SER B 8 37668 36868 42510 -1111 1956 -1251 O ATOM 7693 N GLY B 9 28.930 -98.818 -5.168 1.00341.95 N ANISOU 7693 N GLY B 9 42973 41802 45150 -668 1484 -783 N ATOM 7694 CA GLY B 9 30.298 -98.430 -5.623 1.00351.26 C ANISOU 7694 CA GLY B 9 44170 43177 46116 -438 1237 -527 C ATOM 7695 C GLY B 9 30.898 -98.815 -6.977 1.00358.25 C ANISOU 7695 C GLY B 9 45046 44367 46704 -316 914 -215 C ATOM 7696 O GLY B 9 30.183 -98.876 -7.992 1.00368.51 O ANISOU 7696 O GLY B 9 46087 45787 48144 -420 758 -41 O ATOM 7697 N PHE B 10 32.211 -99.129 -6.965 1.00351.41 N ANISOU 7697 N PHE B 10 44464 43641 45411 -145 828 -170 N ATOM 7698 CA PHE B 10 33.126 -99.113 -8.158 1.00341.25 C ANISOU 7698 CA PHE B 10 43089 42670 43898 -35 555 73 C ATOM 7699 C PHE B 10 32.995-100.246 -9.212 1.00333.67 C ANISOU 7699 C PHE B 10 42250 41947 42582 -129 482 67 C ATOM 7700 O PHE B 10 32.830-101.412 -8.846 1.00327.75 O ANISOU 7700 O PHE B 10 41850 41088 41592 -148 636 -153 O ATOM 7701 CB PHE B 10 34.599 -98.962 -7.697 1.00335.63 C ANISOU 7701 CB PHE B 10 42585 41984 42952 176 522 74 C ATOM 7702 CG PHE B 10 35.091 -97.517 -7.620 1.00334.27 C ANISOU 7702 CG PHE B 10 42080 41821 43106 266 419 247 C ATOM 7703 CD1 PHE B 10 34.522 -96.598 -6.729 1.00331.45 C ANISOU 7703 CD1 PHE B 10 41521 41210 43204 207 577 150 C ATOM 7704 CD2 PHE B 10 36.134 -97.072 -8.438 1.00336.17 C ANISOU 7704 CD2 PHE B 10 42184 42318 43227 382 190 466 C ATOM 7705 CE1 PHE B 10 34.973 -95.279 -6.673 1.00332.20 C ANISOU 7705 CE1 PHE B 10 41272 41274 43675 287 498 282 C ATOM 7706 CE2 PHE B 10 36.587 -95.754 -8.380 1.00336.87 C ANISOU 7706 CE2 PHE B 10 41959 42401 43636 460 82 644 C ATOM 7707 CZ PHE B 10 36.004 -94.856 -7.495 1.00335.42 C ANISOU 7707 CZ PHE B 10 41563 41927 43953 426 232 557 C ATOM 7708 N ARG B 11 33.083 -99.899 -10.508 1.00320.77 N ANISOU 7708 N ARG B 11 40313 40649 40913 -234 249 305 N ATOM 7709 CA ARG B 11 32.878-100.880 -11.593 1.00309.40 C ANISOU 7709 CA ARG B 11 38926 39504 39126 -427 211 252 C ATOM 7710 C ARG B 11 34.147-101.596 -11.945 1.00303.46 C ANISOU 7710 C ARG B 11 38405 38921 37972 -328 239 85 C ATOM 7711 O ARG B 11 35.185-100.968 -12.141 1.00300.99 O ANISOU 7711 O ARG B 11 38000 38749 37612 -217 121 199 O ATOM 7712 CB ARG B 11 32.389-100.241 -12.871 1.00314.60 C ANISOU 7712 CB ARG B 11 39150 40528 39855 -710 -62 590 C ATOM 7713 CG ARG B 11 31.240 -99.273 -12.731 1.00323.66 C ANISOU 7713 CG ARG B 11 39900 41497 41577 -813 -183 860 C ATOM 7714 CD ARG B 11 30.658 -98.993 -14.103 1.00334.40 C ANISOU 7714 CD ARG B 11 40869 43253 42934 -1185 -504 1240 C ATOM 7715 NE ARG B 11 31.679 -99.027 -15.154 1.00349.62 N ANISOU 7715 NE ARG B 11 42780 45686 44370 -1338 -678 1359 N ATOM 7716 CZ ARG B 11 32.505 -98.023 -15.451 1.00360.90 C ANISOU 7716 CZ ARG B 11 43980 47272 45871 -1307 -905 1653 C ATOM 7717 NH1 ARG B 11 32.441 -96.879 -14.777 1.00361.92 N ANISOU 7717 NH1 ARG B 11 43857 47061 46593 -1105 -992 1865 N ATOM 7718 NH2 ARG B 11 33.394 -98.166 -16.427 1.00369.90 N ANISOU 7718 NH2 ARG B 11 45125 48914 46506 -1510 -1019 1697 N ATOM 7719 N LYS B 12 34.029-102.916 -12.066 1.00303.56 N ANISOU 7719 N LYS B 12 38678 38905 37756 -383 402 -202 N ATOM 7720 CA LYS B 12 35.179-103.810 -12.187 1.00311.16 C ANISOU 7720 CA LYS B 12 39858 39873 38495 -261 494 -458 C ATOM 7721 C LYS B 12 36.060-103.489 -13.386 1.00310.73 C ANISOU 7721 C LYS B 12 39574 40266 38221 -382 381 -434 C ATOM 7722 O LYS B 12 37.301-103.431 -13.277 1.00322.32 O ANISOU 7722 O LYS B 12 41092 41719 39653 -192 379 -508 O ATOM 7723 CB LYS B 12 34.731-105.279 -12.247 1.00319.88 C ANISOU 7723 CB LYS B 12 41189 40844 39505 -352 691 -779 C ATOM 7724 CG LYS B 12 34.636-105.973 -10.897 1.00323.64 C ANISOU 7724 CG LYS B 12 42016 40827 40125 -164 814 -877 C ATOM 7725 CD LYS B 12 34.311-107.445 -11.074 1.00331.43 C ANISOU 7725 CD LYS B 12 43182 41670 41074 -255 981 -1175 C ATOM 7726 CE LYS B 12 35.533-108.219 -11.540 1.00333.01 C ANISOU 7726 CE LYS B 12 43393 41853 41282 -159 1035 -1425 C ATOM 7727 NZ LYS B 12 36.334-108.605 -10.356 1.00331.20 N ANISOU 7727 NZ LYS B 12 43408 41171 41260 109 997 -1372 N ATOM 7728 N GLU B 13 35.420-103.289 -14.527 1.00297.61 N ANISOU 7728 N GLU B 13 37652 39025 36400 -744 280 -322 N ATOM 7729 CA GLU B 13 36.170-103.169 -15.763 1.00284.01 C ANISOU 7729 CA GLU B 13 35730 37819 34360 -1002 208 -356 C ATOM 7730 C GLU B 13 36.906-101.826 -15.830 1.00276.70 C ANISOU 7730 C GLU B 13 34586 37047 33499 -917 -32 -2 C ATOM 7731 O GLU B 13 38.067-101.761 -16.248 1.00271.49 O ANISOU 7731 O GLU B 13 33896 36603 32655 -905 -22 -119 O ATOM 7732 CB GLU B 13 35.273-103.459 -16.956 1.00281.88 C ANISOU 7732 CB GLU B 13 35269 38012 33820 -1516 163 -336 C ATOM 7733 CG GLU B 13 36.048-103.678 -18.222 1.00282.59 C ANISOU 7733 CG GLU B 13 35212 38682 33477 -1896 193 -533 C ATOM 7734 CD GLU B 13 35.719-102.614 -19.217 1.00285.60 C ANISOU 7734 CD GLU B 13 35229 39623 33662 -2344 -152 -43 C ATOM 7735 OE1 GLU B 13 35.536-102.942 -20.405 1.00288.57 O ANISOU 7735 OE1 GLU B 13 35456 40581 33604 -2913 -160 -126 O ATOM 7736 OE2 GLU B 13 35.577-101.465 -18.767 1.00286.29 O ANISOU 7736 OE2 GLU B 13 35165 39547 34066 -2161 -422 433 O ATOM 7737 N LEU B 14 36.238-100.781 -15.344 1.00270.78 N ANISOU 7737 N LEU B 14 33672 36130 33079 -844 -218 388 N ATOM 7738 CA LEU B 14 36.858 -99.486 -15.068 1.00261.54 C ANISOU 7738 CA LEU B 14 32314 34932 32125 -674 -414 707 C ATOM 7739 C LEU B 14 38.192 -99.581 -14.317 1.00255.02 C ANISOU 7739 C LEU B 14 31729 33892 31275 -300 -289 495 C ATOM 7740 O LEU B 14 39.215 -99.116 -14.817 1.00252.33 O ANISOU 7740 O LEU B 14 31274 33814 30785 -306 -389 558 O ATOM 7741 CB LEU B 14 35.897 -98.621 -14.257 1.00259.22 C ANISOU 7741 CB LEU B 14 31864 34274 32351 -564 -494 971 C ATOM 7742 CG LEU B 14 36.427 -97.245 -13.855 1.00252.99 C ANISOU 7742 CG LEU B 14 30843 33373 31907 -383 -660 1260 C ATOM 7743 CD1 LEU B 14 36.424 -96.300 -15.045 1.00251.83 C ANISOU 7743 CD1 LEU B 14 30249 33643 31788 -693 -1025 1730 C ATOM 7744 CD2 LEU B 14 35.611 -96.686 -12.715 1.00252.13 C ANISOU 7744 CD2 LEU B 14 30668 32780 32348 -221 -566 1274 C ATOM 7745 N VAL B 15 38.167-100.169 -13.117 1.00249.86 N ANISOU 7745 N VAL B 15 31393 32777 30763 -17 -94 276 N ATOM 7746 CA VAL B 15 39.348-100.270 -12.230 1.00242.64 C ANISOU 7746 CA VAL B 15 30710 31607 29875 316 -20 147 C ATOM 7747 C VAL B 15 40.513-100.975 -12.943 1.00246.23 C ANISOU 7747 C VAL B 15 31205 32265 30086 319 35 -105 C ATOM 7748 O VAL B 15 41.671-100.524 -12.874 1.00243.61 O ANISOU 7748 O VAL B 15 30839 31973 29746 486 -26 -77 O ATOM 7749 CB VAL B 15 39.022-101.004 -10.887 1.00236.43 C ANISOU 7749 CB VAL B 15 30273 30343 29214 489 148 -14 C ATOM 7750 CG1 VAL B 15 40.221-101.024 -9.950 1.00230.43 C ANISOU 7750 CG1 VAL B 15 29720 29349 28485 766 150 -45 C ATOM 7751 CG2 VAL B 15 37.835-100.376 -10.165 1.00232.19 C ANISOU 7751 CG2 VAL B 15 29678 29612 28928 428 172 119 C ATOM 7752 N SER B 16 40.179-102.065 -13.638 1.00251.49 N ANISOU 7752 N SER B 16 31912 33052 30590 112 176 -388 N ATOM 7753 CA SER B 16 41.150-102.929 -14.312 1.00254.32 C ANISOU 7753 CA SER B 16 32272 33545 30812 66 320 -768 C ATOM 7754 C SER B 16 41.884-102.189 -15.404 1.00261.91 C ANISOU 7754 C SER B 16 32952 35032 31528 -150 220 -713 C ATOM 7755 O SER B 16 43.117-102.225 -15.463 1.00267.21 O ANISOU 7755 O SER B 16 33604 35709 32212 -10 267 -887 O ATOM 7756 CB SER B 16 40.461-104.159 -14.918 1.00250.27 C ANISOU 7756 CB SER B 16 31800 33093 30198 -195 524 -1117 C ATOM 7757 OG SER B 16 41.394-105.057 -15.503 1.00245.66 O ANISOU 7757 OG SER B 16 31174 32565 29598 -247 729 -1584 O ATOM 7758 N ARG B 17 41.112-101.539 -16.272 1.00266.87 N ANISOU 7758 N ARG B 17 33346 36102 31947 -527 64 -450 N ATOM 7759 CA ARG B 17 41.651-100.813 -17.417 1.00272.32 C ANISOU 7759 CA ARG B 17 33750 37385 32331 -870 -79 -319 C ATOM 7760 C ARG B 17 42.630 -99.725 -16.963 1.00270.11 C ANISOU 7760 C ARG B 17 33406 37031 32192 -582 -246 -59 C ATOM 7761 O ARG B 17 43.696 -99.547 -17.567 1.00274.53 O ANISOU 7761 O ARG B 17 33854 37901 32554 -680 -234 -185 O ATOM 7762 CB ARG B 17 40.513-100.203 -18.258 1.00275.77 C ANISOU 7762 CB ARG B 17 33930 38247 32602 -1342 -323 86 C ATOM 7763 CG ARG B 17 39.733-101.184 -19.131 1.00279.68 C ANISOU 7763 CG ARG B 17 34411 39062 32789 -1808 -181 -177 C ATOM 7764 CD ARG B 17 38.775-100.443 -20.060 1.00285.19 C ANISOU 7764 CD ARG B 17 34799 40258 33299 -2345 -512 329 C ATOM 7765 NE ARG B 17 38.306-101.273 -21.171 1.00289.94 N ANISOU 7765 NE ARG B 17 35341 41381 33440 -2949 -395 71 N ATOM 7766 CZ ARG B 17 38.429-100.953 -22.459 1.00292.60 C ANISOU 7766 CZ ARG B 17 35420 42475 33279 -3623 -555 216 C ATOM 7767 NH1 ARG B 17 39.002 -99.808 -22.811 1.00291.17 N ANISOU 7767 NH1 ARG B 17 35012 42593 33026 -3754 -868 664 N ATOM 7768 NH2 ARG B 17 37.964-101.777 -23.392 1.00294.21 N ANISOU 7768 NH2 ARG B 17 35587 43157 33039 -4214 -404 -80 N ATOM 7769 N LEU B 18 42.253 -99.025 -15.889 1.00261.63 N ANISOU 7769 N LEU B 18 32393 35549 31464 -257 -369 252 N ATOM 7770 CA LEU B 18 42.998 -97.875 -15.374 1.00250.69 C ANISOU 7770 CA LEU B 18 30924 34068 30258 -2 -531 528 C ATOM 7771 C LEU B 18 44.384 -98.274 -14.937 1.00241.36 C ANISOU 7771 C LEU B 18 29916 32722 29067 300 -394 234 C ATOM 7772 O LEU B 18 45.351 -97.643 -15.304 1.00235.63 O ANISOU 7772 O LEU B 18 29052 32226 28250 305 -484 302 O ATOM 7773 CB LEU B 18 42.256 -97.206 -14.212 1.00251.52 C ANISOU 7773 CB LEU B 18 31065 33732 30769 241 -593 781 C ATOM 7774 CG LEU B 18 41.350 -96.021 -14.571 1.00253.02 C ANISOU 7774 CG LEU B 18 30892 34042 31201 35 -852 1248 C ATOM 7775 CD1 LEU B 18 40.379 -95.772 -13.429 1.00252.00 C ANISOU 7775 CD1 LEU B 18 30809 33427 31512 213 -776 1289 C ATOM 7776 CD2 LEU B 18 42.120 -94.748 -14.913 1.00251.22 C ANISOU 7776 CD2 LEU B 18 30382 34019 31051 30 -1094 1585 C ATOM 7777 N LEU B 19 44.470 -99.334 -14.154 1.00235.90 N ANISOU 7777 N LEU B 19 29508 31619 28504 534 -200 -65 N ATOM 7778 CA LEU B 19 45.751 -99.775 -13.636 1.00234.76 C ANISOU 7778 CA LEU B 19 29499 31229 28468 831 -116 -289 C ATOM 7779 C LEU B 19 46.706-100.351 -14.717 1.00245.31 C ANISOU 7779 C LEU B 19 30689 32873 29643 664 20 -674 C ATOM 7780 O LEU B 19 47.914-100.097 -14.658 1.00246.05 O ANISOU 7780 O LEU B 19 30728 32961 29797 832 5 -742 O ATOM 7781 CB LEU B 19 45.543-100.698 -12.417 1.00228.07 C ANISOU 7781 CB LEU B 19 28965 29825 27865 1085 -20 -395 C ATOM 7782 CG LEU B 19 45.065 -99.910 -11.171 1.00219.78 C ANISOU 7782 CG LEU B 19 28047 28504 26954 1247 -127 -70 C ATOM 7783 CD1 LEU B 19 44.302-100.750 -10.151 1.00220.52 C ANISOU 7783 CD1 LEU B 19 28428 28194 27166 1290 -37 -121 C ATOM 7784 CD2 LEU B 19 46.245 -99.210 -10.501 1.00214.25 C ANISOU 7784 CD2 LEU B 19 27365 27701 26337 1500 -235 63 C ATOM 7785 N HIS B 20 46.169-101.071 -15.710 1.00259.21 N ANISOU 7785 N HIS B 20 32360 34926 31200 295 171 -952 N ATOM 7786 CA HIS B 20 46.988-101.652 -16.805 1.00271.95 C ANISOU 7786 CA HIS B 20 33795 36885 32648 25 381 -1432 C ATOM 7787 C HIS B 20 47.541-100.612 -17.792 1.00271.03 C ANISOU 7787 C HIS B 20 33415 37392 32172 -293 255 -1286 C ATOM 7788 O HIS B 20 48.381-100.927 -18.640 1.00272.87 O ANISOU 7788 O HIS B 20 33482 37951 32245 -541 442 -1700 O ATOM 7789 CB HIS B 20 46.230-102.755 -17.559 1.00286.70 C ANISOU 7789 CB HIS B 20 35638 38912 34381 -346 622 -1833 C ATOM 7790 CG HIS B 20 46.535-104.146 -17.082 1.00300.56 C ANISOU 7790 CG HIS B 20 37515 40137 36544 -115 885 -2312 C ATOM 7791 ND1 HIS B 20 45.649-104.886 -16.330 1.00306.68 N ANISOU 7791 ND1 HIS B 20 38514 40464 37546 43 910 -2272 N ATOM 7792 CD2 HIS B 20 47.623-104.933 -17.260 1.00308.07 C ANISOU 7792 CD2 HIS B 20 38355 40904 37791 -35 1124 -2833 C ATOM 7793 CE1 HIS B 20 46.175-106.067 -16.063 1.00312.70 C ANISOU 7793 CE1 HIS B 20 39301 40782 38726 210 1118 -2694 C ATOM 7794 NE2 HIS B 20 47.372-106.123 -16.618 1.00314.79 N ANISOU 7794 NE2 HIS B 20 39346 41172 39089 178 1255 -3051 N ATOM 7795 N LEU B 21 47.072 -99.373 -17.678 1.00268.30 N ANISOU 7795 N LEU B 21 33000 37199 31742 -316 -51 -712 N ATOM 7796 CA LEU B 21 47.661 -98.279 -18.447 1.00268.61 C ANISOU 7796 CA LEU B 21 32791 37755 31514 -572 -239 -461 C ATOM 7797 C LEU B 21 49.023 -97.786 -17.914 1.00264.57 C ANISOU 7797 C LEU B 21 32289 37056 31179 -193 -260 -480 C ATOM 7798 O LEU B 21 49.797 -97.207 -18.673 1.00267.86 O ANISOU 7798 O LEU B 21 32507 37919 31348 -432 -314 -470 O ATOM 7799 CB LEU B 21 46.694 -97.094 -18.580 1.00267.27 C ANISOU 7799 CB LEU B 21 32463 37773 31312 -754 -596 196 C ATOM 7800 CG LEU B 21 45.881 -96.871 -19.857 1.00269.17 C ANISOU 7800 CG LEU B 21 32458 38652 31162 -1429 -760 428 C ATOM 7801 CD1 LEU B 21 45.545 -95.398 -19.980 1.00265.24 C ANISOU 7801 CD1 LEU B 21 31698 38303 30775 -1538 -1191 1149 C ATOM 7802 CD2 LEU B 21 46.603 -97.373 -21.094 1.00274.81 C ANISOU 7802 CD2 LEU B 21 33050 40002 31363 -1961 -576 6 C ATOM 7803 N HIS B 22 49.316 -98.009 -16.631 1.00255.18 N ANISOU 7803 N HIS B 22 31325 35250 30383 340 -232 -489 N ATOM 7804 CA HIS B 22 50.510 -97.425 -16.022 1.00246.07 C ANISOU 7804 CA HIS B 22 30181 33911 29402 693 -307 -414 C ATOM 7805 C HIS B 22 51.554 -98.445 -15.557 1.00242.40 C ANISOU 7805 C HIS B 22 29821 33059 29219 989 -103 -857 C ATOM 7806 O HIS B 22 52.677 -98.075 -15.241 1.00231.66 O ANISOU 7806 O HIS B 22 28426 31605 27989 1224 -149 -855 O ATOM 7807 CB HIS B 22 50.117 -96.449 -14.909 1.00245.52 C ANISOU 7807 CB HIS B 22 30209 33526 29550 994 -525 65 C ATOM 7808 CG HIS B 22 49.097 -95.428 -15.329 1.00249.36 C ANISOU 7808 CG HIS B 22 30508 34283 29951 731 -740 507 C ATOM 7809 ND1 HIS B 22 49.325 -94.508 -16.332 1.00252.72 N ANISOU 7809 ND1 HIS B 22 30645 35218 30157 409 -925 759 N ATOM 7810 CD2 HIS B 22 47.850 -95.170 -14.865 1.00249.28 C ANISOU 7810 CD2 HIS B 22 30521 34075 30119 724 -818 764 C ATOM 7811 CE1 HIS B 22 48.259 -93.739 -16.477 1.00253.38 C ANISOU 7811 CE1 HIS B 22 30560 35373 30337 227 -1145 1198 C ATOM 7812 NE2 HIS B 22 47.351 -94.119 -15.597 1.00250.06 N ANISOU 7812 NE2 HIS B 22 30312 34515 30182 428 -1064 1177 N ATOM 7813 N PHE B 23 51.180 -99.724 -15.526 1.00249.50 N ANISOU 7813 N PHE B 23 30817 33710 30271 970 103 -1216 N ATOM 7814 CA PHE B 23 52.140-100.823 -15.388 1.00259.93 C ANISOU 7814 CA PHE B 23 32119 34682 31959 1151 310 -1693 C ATOM 7815 C PHE B 23 53.159-100.696 -16.510 1.00267.02 C ANISOU 7815 C PHE B 23 32723 36023 32706 893 473 -2081 C ATOM 7816 O PHE B 23 52.769-100.431 -17.655 1.00270.99 O ANISOU 7816 O PHE B 23 33066 37137 32760 400 546 -2180 O ATOM 7817 CB PHE B 23 51.458-102.193 -15.574 1.00267.24 C ANISOU 7817 CB PHE B 23 33092 35397 33050 1024 544 -2082 C ATOM 7818 CG PHE B 23 50.495-102.597 -14.472 1.00272.83 C ANISOU 7818 CG PHE B 23 34092 35629 33941 1241 436 -1799 C ATOM 7819 CD1 PHE B 23 50.710-102.267 -13.132 1.00275.96 C ANISOU 7819 CD1 PHE B 23 34701 35594 34558 1616 217 -1407 C ATOM 7820 CD2 PHE B 23 49.384-103.379 -14.783 1.00277.47 C ANISOU 7820 CD2 PHE B 23 34739 36225 34461 1015 577 -1964 C ATOM 7821 CE1 PHE B 23 49.814-102.674 -12.146 1.00281.56 C ANISOU 7821 CE1 PHE B 23 35675 35929 35376 1716 147 -1189 C ATOM 7822 CE2 PHE B 23 48.484-103.787 -13.805 1.00281.52 C ANISOU 7822 CE2 PHE B 23 35515 36327 35122 1169 500 -1736 C ATOM 7823 CZ PHE B 23 48.697-103.435 -12.480 1.00283.84 C ANISOU 7823 CZ PHE B 23 36019 36221 35604 1504 289 -1352 C ATOM 7824 N LYS B 24 54.443-100.904 -16.204 1.00274.50 N ANISOU 7824 N LYS B 24 33584 36691 34021 1167 526 -2300 N ATOM 7825 CA LYS B 24 55.486-100.939 -17.256 1.00286.86 C ANISOU 7825 CA LYS B 24 34839 38634 35519 904 757 -2802 C ATOM 7826 C LYS B 24 55.972-102.350 -17.711 1.00306.97 C ANISOU 7826 C LYS B 24 37179 40935 38519 812 1154 -3581 C ATOM 7827 O LYS B 24 56.768-102.443 -18.645 1.00313.18 O ANISOU 7827 O LYS B 24 37674 42063 39257 513 1423 -4113 O ATOM 7828 CB LYS B 24 56.665 -99.982 -16.958 1.00275.41 C ANISOU 7828 CB LYS B 24 33317 37211 34113 1145 587 -2589 C ATOM 7829 CG LYS B 24 56.296 -98.494 -16.879 1.00261.17 C ANISOU 7829 CG LYS B 24 31591 35781 31858 1097 268 -1949 C ATOM 7830 CD LYS B 24 55.689 -97.931 -18.169 1.00256.95 C ANISOU 7830 CD LYS B 24 30896 36015 30715 489 278 -1908 C ATOM 7831 CE LYS B 24 54.490 -97.009 -17.931 1.00247.78 C ANISOU 7831 CE LYS B 24 29847 34979 29316 430 -34 -1247 C ATOM 7832 NZ LYS B 24 54.799 -95.573 -17.670 1.00242.32 N ANISOU 7832 NZ LYS B 24 29105 34418 28547 545 -339 -709 N ATOM 7833 N ASP B 25 55.509-103.428 -17.055 1.00323.47 N ANISOU 7833 N ASP B 25 39389 42430 41084 1037 1204 -3671 N ATOM 7834 CA ASP B 25 55.486-104.802 -17.681 1.00341.53 C ANISOU 7834 CA ASP B 25 41462 44553 43751 815 1614 -4421 C ATOM 7835 C ASP B 25 54.039-105.327 -17.966 1.00350.67 C ANISOU 7835 C ASP B 25 42769 45855 44612 521 1701 -4437 C ATOM 7836 O ASP B 25 53.197-105.376 -17.056 1.00349.48 O ANISOU 7836 O ASP B 25 42915 45364 44505 774 1460 -3951 O ATOM 7837 CB ASP B 25 56.313-105.867 -16.898 1.00343.20 C ANISOU 7837 CB ASP B 25 41554 43895 44948 1253 1663 -4666 C ATOM 7838 CG ASP B 25 56.485-107.201 -17.686 1.00348.82 C ANISOU 7838 CG ASP B 25 41919 44430 46186 995 2149 -5561 C ATOM 7839 OD1 ASP B 25 56.041-107.289 -18.856 1.00352.77 O ANISOU 7839 OD1 ASP B 25 42285 45548 46202 438 2485 -6048 O ATOM 7840 OD2 ASP B 25 57.064-108.167 -17.146 1.00348.44 O ANISOU 7840 OD2 ASP B 25 41701 43622 47068 1310 2196 -5784 O ATOM 7841 N ASP B 26 53.764-105.737 -19.219 1.00362.26 N ANISOU 7841 N ASP B 26 44023 47845 45771 -53 2062 -5023 N ATOM 7842 CA ASP B 26 52.431-106.244 -19.641 1.00365.83 C ANISOU 7842 CA ASP B 26 44578 48517 45901 -412 2170 -5093 C ATOM 7843 C ASP B 26 52.167-107.732 -19.385 1.00370.89 C ANISOU 7843 C ASP B 26 45180 48543 47195 -301 2439 -5576 C ATOM 7844 O ASP B 26 51.050-108.208 -19.638 1.00371.59 O ANISOU 7844 O ASP B 26 45372 48752 47061 -557 2525 -5627 O ATOM 7845 CB ASP B 26 52.155-105.927 -21.112 1.00365.76 C ANISOU 7845 CB ASP B 26 44374 49448 45149 -1188 2387 -5420 C ATOM 7846 CG ASP B 26 51.723-104.500 -21.323 1.00359.26 C ANISOU 7846 CG ASP B 26 43661 49232 43610 -1378 1999 -4698 C ATOM 7847 OD1 ASP B 26 51.137-103.893 -20.400 1.00352.66 O ANISOU 7847 OD1 ASP B 26 43082 48110 42801 -984 1617 -3988 O ATOM 7848 OD2 ASP B 26 51.981-103.971 -22.418 1.00359.71 O ANISOU 7848 OD2 ASP B 26 43515 50052 43104 -1963 2077 -4848 O ATOM 7849 N LYS B 27 53.189-108.449 -18.900 1.00371.47 N ANISOU 7849 N LYS B 27 45076 47947 48118 66 2551 -5905 N ATOM 7850 CA LYS B 27 53.061-109.858 -18.488 1.00366.63 C ANISOU 7850 CA LYS B 27 44384 46587 48330 254 2731 -6267 C ATOM 7851 C LYS B 27 52.162-109.981 -17.264 1.00361.24 C ANISOU 7851 C LYS B 27 44102 45416 47735 632 2348 -5553 C ATOM 7852 O LYS B 27 51.509-111.001 -17.057 1.00361.03 O ANISOU 7852 O LYS B 27 44115 44992 48067 636 2453 -5711 O ATOM 7853 CB LYS B 27 54.435-110.482 -18.226 1.00361.38 C ANISOU 7853 CB LYS B 27 43369 45273 48662 565 2862 -6685 C ATOM 7854 CG LYS B 27 55.267-110.584 -19.484 1.00354.59 C ANISOU 7854 CG LYS B 27 42057 44852 47819 120 3361 -7583 C ATOM 7855 CD LYS B 27 56.720-110.921 -19.234 1.00343.91 C ANISOU 7855 CD LYS B 27 40322 42912 47433 441 3454 -7941 C ATOM 7856 CE LYS B 27 57.556-110.187 -20.266 1.00338.91 C ANISOU 7856 CE LYS B 27 39422 43001 46345 39 3730 -8416 C ATOM 7857 NZ LYS B 27 59.013-110.349 -20.029 1.00339.17 N ANISOU 7857 NZ LYS B 27 39074 42512 47281 356 3801 -8732 N ATOM 7858 N THR B 28 52.123-108.913 -16.474 1.00354.86 N ANISOU 7858 N THR B 28 43576 44671 46581 902 1928 -4800 N ATOM 7859 CA THR B 28 51.184-108.736 -15.351 1.00347.09 C ANISOU 7859 CA THR B 28 42992 43413 45471 1147 1579 -4106 C ATOM 7860 C THR B 28 49.692-109.100 -15.663 1.00342.63 C ANISOU 7860 C THR B 28 42594 43067 44521 846 1680 -4121 C ATOM 7861 O THR B 28 49.048-108.465 -16.516 1.00348.07 O ANISOU 7861 O THR B 28 43274 44438 44539 462 1743 -4127 O ATOM 7862 CB THR B 28 51.305-107.281 -14.786 1.00341.09 C ANISOU 7862 CB THR B 28 42436 42923 44237 1317 1218 -3438 C ATOM 7863 OG1 THR B 28 52.674-106.988 -14.448 1.00339.64 O ANISOU 7863 OG1 THR B 28 42111 42519 44415 1598 1114 -3412 O ATOM 7864 CG2 THR B 28 50.396-107.042 -13.561 1.00335.49 C ANISOU 7864 CG2 THR B 28 42110 41941 43420 1522 909 -2798 C ATOM 7865 N LYS B 29 49.175-110.122 -14.966 1.00332.42 N ANISOU 7865 N LYS B 29 41433 41188 43680 1000 1664 -4090 N ATOM 7866 CA LYS B 29 47.735-110.456 -14.954 1.00317.47 C ANISOU 7866 CA LYS B 29 39757 39386 41481 804 1693 -3988 C ATOM 7867 C LYS B 29 47.175-110.288 -13.513 1.00304.10 C ANISOU 7867 C LYS B 29 38438 37273 39830 1108 1333 -3306 C ATOM 7868 O LYS B 29 47.877-110.601 -12.557 1.00303.11 O ANISOU 7868 O LYS B 29 38362 36591 40214 1426 1139 -3083 O ATOM 7869 CB LYS B 29 47.498-111.885 -15.506 1.00318.55 C ANISOU 7869 CB LYS B 29 39705 39257 42071 614 2055 -4638 C ATOM 7870 CG LYS B 29 48.159-112.223 -16.847 1.00312.08 C ANISOU 7870 CG LYS B 29 38472 38787 41318 258 2491 -5453 C ATOM 7871 CD LYS B 29 47.297-111.878 -18.070 1.00301.92 C ANISOU 7871 CD LYS B 29 37146 38352 39217 -334 2708 -5701 C ATOM 7872 CE LYS B 29 47.820-112.576 -19.311 1.00296.48 C ANISOU 7872 CE LYS B 29 36048 37932 38666 -786 3226 -6641 C ATOM 7873 NZ LYS B 29 47.099-112.234 -20.585 1.00289.96 N ANISOU 7873 NZ LYS B 29 35153 38041 36974 -1491 3427 -6890 N ATOM 7874 N VAL B 30 45.951-109.761 -13.357 1.00288.35 N ANISOU 7874 N VAL B 30 36680 35565 37314 968 1239 -2975 N ATOM 7875 CA VAL B 30 45.354-109.559 -12.003 1.00276.94 C ANISOU 7875 CA VAL B 30 35576 33790 35855 1165 962 -2410 C ATOM 7876 C VAL B 30 44.192-110.516 -11.720 1.00287.09 C ANISOU 7876 C VAL B 30 37036 34822 37220 1048 1042 -2450 C ATOM 7877 O VAL B 30 43.202-110.562 -12.461 1.00288.65 O ANISOU 7877 O VAL B 30 37213 35372 37089 767 1208 -2629 O ATOM 7878 CB VAL B 30 44.916-108.089 -11.703 1.00260.32 C ANISOU 7878 CB VAL B 30 33601 32080 33228 1153 768 -1947 C ATOM 7879 CG1 VAL B 30 44.489-107.936 -10.239 1.00256.53 C ANISOU 7879 CG1 VAL B 30 33438 31246 32785 1307 548 -1482 C ATOM 7880 CG2 VAL B 30 46.026-107.096 -12.023 1.00250.23 C ANISOU 7880 CG2 VAL B 30 32146 31076 31851 1249 684 -1891 C ATOM 7881 N SER B 31 44.346-111.274 -10.635 1.00297.59 N ANISOU 7881 N SER B 31 38528 35548 38992 1237 891 -2243 N ATOM 7882 CA SER B 31 43.337-112.210 -10.156 1.00306.87 C ANISOU 7882 CA SER B 31 39897 36407 40290 1144 915 -2204 C ATOM 7883 C SER B 31 42.050-111.471 -9.794 1.00314.90 C ANISOU 7883 C SER B 31 41169 37737 40740 990 865 -1903 C ATOM 7884 O SER B 31 42.084-110.304 -9.366 1.00329.07 O ANISOU 7884 O SER B 31 43048 39769 42213 1039 714 -1575 O ATOM 7885 CB SER B 31 43.862-112.978 -8.942 1.00304.23 C ANISOU 7885 CB SER B 31 39688 35398 40505 1333 663 -1890 C ATOM 7886 OG SER B 31 44.026-112.110 -7.830 1.00301.06 O ANISOU 7886 OG SER B 31 39526 35019 39843 1415 368 -1344 O ATOM 7887 N GLY B 32 40.926-112.168 -9.961 1.00316.06 N ANISOU 7887 N GLY B 32 41404 37850 40834 801 1008 -2046 N ATOM 7888 CA GLY B 32 39.579-111.598 -9.788 1.00311.88 C ANISOU 7888 CA GLY B 32 41046 37600 39853 619 1017 -1859 C ATOM 7889 C GLY B 32 39.215-111.098 -8.400 1.00306.08 C ANISOU 7889 C GLY B 32 40600 36694 39000 665 817 -1404 C ATOM 7890 O GLY B 32 38.569-110.062 -8.246 1.00300.70 O ANISOU 7890 O GLY B 32 39954 36308 37990 583 799 -1232 O ATOM 7891 N ASP B 33 39.627-111.831 -7.383 1.00304.68 N ANISOU 7891 N ASP B 33 40600 36041 39123 748 667 -1211 N ATOM 7892 CA ASP B 33 39.421-111.364 -6.033 1.00303.41 C ANISOU 7892 CA ASP B 33 40713 35780 38789 697 483 -797 C ATOM 7893 C ASP B 33 40.284-110.148 -5.676 1.00302.50 C ANISOU 7893 C ASP B 33 40557 35855 38523 826 337 -575 C ATOM 7894 O ASP B 33 39.775-109.274 -4.994 1.00302.72 O ANISOU 7894 O ASP B 33 40713 36052 38251 711 321 -392 O ATOM 7895 CB ASP B 33 39.570-112.506 -5.044 1.00307.53 C ANISOU 7895 CB ASP B 33 41436 35787 39624 651 310 -576 C ATOM 7896 CG ASP B 33 38.621-113.642 -5.337 1.00309.05 C ANISOU 7896 CG ASP B 33 41675 35789 39961 509 463 -786 C ATOM 7897 OD1 ASP B 33 37.603-113.409 -6.039 1.00300.60 O ANISOU 7897 OD1 ASP B 33 40563 35031 38617 390 696 -1040 O ATOM 7898 OD2 ASP B 33 38.905-114.761 -4.861 1.00316.51 O ANISOU 7898 OD2 ASP B 33 42675 36254 41329 505 324 -666 O ATOM 7899 N ALA B 34 41.541-110.063 -6.160 1.00301.69 N ANISOU 7899 N ALA B 34 40249 35730 38647 1040 266 -641 N ATOM 7900 CA ALA B 34 42.387-108.836 -6.022 1.00295.72 C ANISOU 7900 CA ALA B 34 39413 35208 37737 1171 152 -475 C ATOM 7901 C ALA B 34 41.778-107.562 -6.666 1.00291.69 C ANISOU 7901 C ALA B 34 38773 35196 36860 1102 276 -541 C ATOM 7902 O ALA B 34 41.939-106.458 -6.127 1.00283.12 O ANISOU 7902 O ALA B 34 37710 34260 35603 1121 194 -331 O ATOM 7903 CB ALA B 34 43.811-109.068 -6.533 1.00295.93 C ANISOU 7903 CB ALA B 34 39211 35114 38114 1399 82 -588 C ATOM 7904 N LEU B 35 41.086-107.723 -7.807 1.00294.54 N ANISOU 7904 N LEU B 35 38971 35800 37140 991 455 -813 N ATOM 7905 CA LEU B 35 40.316-106.629 -8.474 1.00288.25 C ANISOU 7905 CA LEU B 35 38010 35443 36066 859 516 -799 C ATOM 7906 C LEU B 35 39.011-106.258 -7.725 1.00280.04 C ANISOU 7906 C LEU B 35 37114 34371 34915 700 554 -655 C ATOM 7907 O LEU B 35 38.649-105.069 -7.640 1.00274.92 O ANISOU 7907 O LEU B 35 36347 33921 34190 661 530 -514 O ATOM 7908 CB LEU B 35 40.038-106.951 -9.960 1.00293.58 C ANISOU 7908 CB LEU B 35 38449 36439 36658 701 655 -1094 C ATOM 7909 CG LEU B 35 39.434-105.886 -10.887 1.00293.38 C ANISOU 7909 CG LEU B 35 38178 36908 36385 510 635 -1011 C ATOM 7910 CD1 LEU B 35 40.319-104.648 -10.984 1.00291.65 C ANISOU 7910 CD1 LEU B 35 37793 36904 36116 628 485 -807 C ATOM 7911 CD2 LEU B 35 39.172-106.483 -12.263 1.00294.39 C ANISOU 7911 CD2 LEU B 35 38119 37363 36369 246 771 -1313 C ATOM 7912 N GLN B 36 38.319-107.280 -7.203 1.00274.70 N ANISOU 7912 N GLN B 36 36658 33425 34290 595 626 -715 N ATOM 7913 CA AGLN B 36 37.169-107.076 -6.320 0.50274.09 C ANISOU 7913 CA AGLN B 36 36745 33271 34124 414 691 -626 C ATOM 7914 CA BGLN B 36 37.173-107.081 -6.318 0.50273.79 C ANISOU 7914 CA BGLN B 36 36708 33232 34087 415 691 -626 C ATOM 7915 C GLN B 36 37.615-106.242 -5.116 1.00280.14 C ANISOU 7915 C GLN B 36 37628 33975 34835 428 604 -409 C ATOM 7916 O GLN B 36 36.886-105.367 -4.670 1.00279.10 O ANISOU 7916 O GLN B 36 37455 33938 34651 295 690 -387 O ATOM 7917 CB AGLN B 36 36.573-108.411 -5.854 0.50268.61 C ANISOU 7917 CB AGLN B 36 36299 32274 33483 288 753 -698 C ATOM 7918 CB BGLN B 36 36.595-108.424 -5.857 0.50267.95 C ANISOU 7918 CB BGLN B 36 36217 32189 33403 291 751 -698 C ATOM 7919 CG AGLN B 36 35.814-109.206 -6.909 0.50265.44 C ANISOU 7919 CG AGLN B 36 35799 31943 33113 195 897 -956 C ATOM 7920 CG BGLN B 36 35.690-109.122 -6.864 0.50264.05 C ANISOU 7920 CG BGLN B 36 35625 31781 32919 177 904 -947 C ATOM 7921 CD AGLN B 36 34.438-108.645 -7.205 0.50263.43 C ANISOU 7921 CD AGLN B 36 35445 31913 32732 0 1016 -996 C ATOM 7922 CD BGLN B 36 34.413-108.352 -7.118 0.50261.32 C ANISOU 7922 CD BGLN B 36 35156 31680 32452 1 1006 -958 C ATOM 7923 OE1AGLN B 36 34.138-107.497 -6.886 0.50259.97 O ANISOU 7923 OE1AGLN B 36 34907 31607 32260 -28 1001 -866 O ATOM 7924 OE1BGLN B 36 34.322-107.168 -6.807 0.50257.11 O ANISOU 7924 OE1BGLN B 36 34514 31275 31900 3 973 -821 O ATOM 7925 NE2AGLN B 36 33.592-109.458 -7.824 0.50265.12 N ANISOU 7925 NE2AGLN B 36 35648 32144 32940 -143 1139 -1186 N ATOM 7926 NE2BGLN B 36 33.420-109.020 -7.690 0.50262.76 N ANISOU 7926 NE2BGLN B 36 35319 31899 32618 -160 1129 -1126 N ATOM 7927 N LEU B 37 38.829-106.528 -4.616 1.00300.55 N ANISOU 7927 N LEU B 37 40323 36392 37477 565 442 -272 N ATOM 7928 CA LEU B 37 39.530-105.762 -3.564 1.00319.60 C ANISOU 7928 CA LEU B 37 42832 38794 39805 565 325 -56 C ATOM 7929 C LEU B 37 39.780-104.314 -3.983 1.00319.19 C ANISOU 7929 C LEU B 37 42519 39031 39726 667 346 -55 C ATOM 7930 O LEU B 37 39.652-103.397 -3.174 1.00324.74 O ANISOU 7930 O LEU B 37 43239 39792 40352 557 385 8 O ATOM 7931 CB LEU B 37 40.895-106.402 -3.225 1.00326.81 C ANISOU 7931 CB LEU B 37 43834 39476 40860 720 95 119 C ATOM 7932 CG LEU B 37 41.109-107.420 -2.085 1.00335.26 C ANISOU 7932 CG LEU B 37 45195 40209 41979 562 -82 363 C ATOM 7933 CD1 LEU B 37 42.497-108.052 -2.177 1.00337.95 C ANISOU 7933 CD1 LEU B 37 45465 40283 42656 789 -331 514 C ATOM 7934 CD2 LEU B 37 40.912-106.809 -0.698 1.00336.74 C ANISOU 7934 CD2 LEU B 37 45609 40478 41857 254 -121 573 C ATOM 7935 N MET B 38 40.157-104.114 -5.241 1.00306.36 N ANISOU 7935 N MET B 38 40635 37593 38174 835 327 -139 N ATOM 7936 CA MET B 38 40.429-102.775 -5.748 1.00289.85 C ANISOU 7936 CA MET B 38 38266 35775 36086 913 298 -82 C ATOM 7937 C MET B 38 39.191-101.911 -5.911 1.00286.87 C ANISOU 7937 C MET B 38 37699 35532 35765 752 408 -95 C ATOM 7938 O MET B 38 39.253-100.697 -5.682 1.00286.40 O ANISOU 7938 O MET B 38 37460 35557 35802 763 397 -7 O ATOM 7939 CB MET B 38 41.235-102.842 -7.030 1.00278.32 C ANISOU 7939 CB MET B 38 36586 34520 34640 1055 231 -150 C ATOM 7940 CG MET B 38 42.689-103.139 -6.730 1.00269.77 C ANISOU 7940 CG MET B 38 35577 33300 33622 1258 107 -108 C ATOM 7941 SD MET B 38 43.285-102.150 -5.339 1.00256.81 S ANISOU 7941 SD MET B 38 34060 31575 31938 1305 -3 144 S ATOM 7942 CE MET B 38 43.381-100.522 -6.087 1.00260.66 C ANISOU 7942 CE MET B 38 34197 32422 32420 1356 -12 200 C ATOM 7943 N VAL B 39 38.084-102.547 -6.297 1.00279.45 N ANISOU 7943 N VAL B 39 36768 34578 34832 602 511 -210 N ATOM 7944 CA VAL B 39 36.745-101.953 -6.217 1.00272.77 C ANISOU 7944 CA VAL B 39 35765 33749 34124 418 627 -234 C ATOM 7945 C VAL B 39 36.484-101.362 -4.814 1.00283.39 C ANISOU 7945 C VAL B 39 37219 34922 35534 308 751 -261 C ATOM 7946 O VAL B 39 36.117-100.185 -4.694 1.00281.77 O ANISOU 7946 O VAL B 39 36739 34749 35572 263 804 -252 O ATOM 7947 CB VAL B 39 35.673-102.991 -6.599 1.00262.58 C ANISOU 7947 CB VAL B 39 34559 32413 32795 261 728 -371 C ATOM 7948 CG1 VAL B 39 34.282-102.543 -6.174 1.00260.62 C ANISOU 7948 CG1 VAL B 39 34206 32085 32732 59 876 -428 C ATOM 7949 CG2 VAL B 39 35.742-103.264 -8.089 1.00254.36 C ANISOU 7949 CG2 VAL B 39 33310 31642 31693 258 646 -383 C ATOM 7950 N GLU B 40 36.715-102.174 -3.767 1.00296.62 N ANISOU 7950 N GLU B 40 39266 36419 37017 221 789 -294 N ATOM 7951 CA GLU B 40 36.643-101.749 -2.333 1.00301.35 C ANISOU 7951 CA GLU B 40 40029 36928 37542 6 910 -336 C ATOM 7952 C GLU B 40 37.635-100.621 -1.952 1.00301.36 C ANISOU 7952 C GLU B 40 39913 37018 37570 99 849 -252 C ATOM 7953 O GLU B 40 37.234 -99.623 -1.346 1.00302.07 O ANISOU 7953 O GLU B 40 39852 37121 37799 -61 1023 -381 O ATOM 7954 CB GLU B 40 36.860-102.931 -1.352 1.00301.27 C ANISOU 7954 CB GLU B 40 40449 36759 37258 -168 869 -277 C ATOM 7955 CG GLU B 40 35.972-104.159 -1.530 1.00299.52 C ANISOU 7955 CG GLU B 40 40394 36407 37000 -285 925 -349 C ATOM 7956 CD GLU B 40 34.662-104.075 -0.771 1.00299.99 C ANISOU 7956 CD GLU B 40 40521 36439 37023 -648 1182 -544 C ATOM 7957 OE1 GLU B 40 33.918-105.073 -0.804 1.00300.93 O ANISOU 7957 OE1 GLU B 40 40800 36450 37090 -775 1234 -599 O ATOM 7958 OE2 GLU B 40 34.373-103.034 -0.136 1.00299.83 O ANISOU 7958 OE2 GLU B 40 40375 36491 37053 -827 1359 -681 O ATOM 7959 N LEU B 41 38.917-100.799 -2.285 1.00297.54 N ANISOU 7959 N LEU B 41 39477 36575 36997 342 628 -76 N ATOM 7960 CA LEU B 41 39.969 -99.828 -1.936 1.00282.99 C ANISOU 7960 CA LEU B 41 37550 34819 35152 444 546 22 C ATOM 7961 C LEU B 41 39.744 -98.437 -2.552 1.00272.02 C ANISOU 7961 C LEU B 41 35740 33559 34057 533 601 -12 C ATOM 7962 O LEU B 41 39.902 -97.416 -1.875 1.00270.18 O ANISOU 7962 O LEU B 41 35395 33338 33920 451 694 -65 O ATOM 7963 CB LEU B 41 41.336-100.387 -2.318 1.00279.15 C ANISOU 7963 CB LEU B 41 37154 34327 34580 702 297 200 C ATOM 7964 CG LEU B 41 42.610 -99.574 -2.090 1.00273.42 C ANISOU 7964 CG LEU B 41 36359 33689 33838 853 164 333 C ATOM 7965 CD1 LEU B 41 42.656 -98.851 -0.750 1.00274.30 C ANISOU 7965 CD1 LEU B 41 36578 33815 33827 602 255 326 C ATOM 7966 CD2 LEU B 41 43.783-100.524 -2.216 1.00272.39 C ANISOU 7966 CD2 LEU B 41 36375 33447 33673 1037 -63 481 C ATOM 7967 N LEU B 42 39.363 -98.406 -3.824 1.00261.63 N ANISOU 7967 N LEU B 42 34169 32338 32898 653 533 27 N ATOM 7968 CA LEU B 42 39.014 -97.162 -4.486 1.00254.35 C ANISOU 7968 CA LEU B 42 32806 31514 32320 686 518 85 C ATOM 7969 C LEU B 42 37.719 -96.569 -3.949 1.00257.69 C ANISOU 7969 C LEU B 42 33034 31784 33090 464 743 -82 C ATOM 7970 O LEU B 42 37.631 -95.361 -3.764 1.00262.62 O ANISOU 7970 O LEU B 42 33332 32362 34088 447 800 -99 O ATOM 7971 CB LEU B 42 38.915 -97.380 -5.983 1.00249.23 C ANISOU 7971 CB LEU B 42 31949 31062 31683 764 348 221 C ATOM 7972 CG LEU B 42 40.221 -97.455 -6.768 1.00244.06 C ANISOU 7972 CG LEU B 42 31284 30618 30830 954 153 347 C ATOM 7973 CD1 LEU B 42 39.907 -97.674 -8.238 1.00244.22 C ANISOU 7973 CD1 LEU B 42 31083 30903 30806 880 36 425 C ATOM 7974 CD2 LEU B 42 41.033 -96.184 -6.578 1.00240.09 C ANISOU 7974 CD2 LEU B 42 30577 30171 30472 1070 67 481 C ATOM 7975 N LYS B 43 36.729 -97.425 -3.696 1.00257.02 N ANISOU 7975 N LYS B 43 33121 31596 32936 286 886 -232 N ATOM 7976 CA LYS B 43 35.489 -97.024 -3.033 1.00257.57 C ANISOU 7976 CA LYS B 43 33042 31496 33325 33 1157 -473 C ATOM 7977 C LYS B 43 35.841 -96.274 -1.749 1.00265.94 C ANISOU 7977 C LYS B 43 34138 32489 34418 -122 1365 -673 C ATOM 7978 O LYS B 43 35.446 -95.123 -1.567 1.00269.81 O ANISOU 7978 O LYS B 43 34233 32877 35402 -192 1516 -814 O ATOM 7979 CB LYS B 43 34.599 -98.255 -2.780 1.00250.74 C ANISOU 7979 CB LYS B 43 32473 30554 32240 -151 1281 -613 C ATOM 7980 CG LYS B 43 33.535 -98.133 -1.694 1.00249.37 C ANISOU 7980 CG LYS B 43 32315 30222 32212 -492 1624 -946 C ATOM 7981 CD LYS B 43 33.315 -99.479 -1.009 1.00250.20 C ANISOU 7981 CD LYS B 43 32914 30301 31848 -698 1697 -1025 C ATOM 7982 CE LYS B 43 32.661 -99.330 0.359 1.00253.85 C ANISOU 7982 CE LYS B 43 33491 30696 32264 -1131 2044 -1364 C ATOM 7983 NZ LYS B 43 31.178 -99.302 0.292 1.00252.37 N ANISOU 7983 NZ LYS B 43 33081 30378 32429 -1329 2299 -1636 N ATOM 7984 N VAL B 44 36.635 -96.916 -0.893 1.00274.34 N ANISOU 7984 N VAL B 44 35639 33606 34990 -200 1352 -668 N ATOM 7985 CA VAL B 44 37.031 -96.335 0.397 1.00284.02 C ANISOU 7985 CA VAL B 44 36963 34848 36103 -451 1541 -851 C ATOM 7986 C VAL B 44 37.956 -95.111 0.236 1.00289.31 C ANISOU 7986 C VAL B 44 37351 35577 36996 -258 1462 -772 C ATOM 7987 O VAL B 44 37.902 -94.186 1.053 1.00296.58 O ANISOU 7987 O VAL B 44 38113 36473 38100 -476 1708 -1029 O ATOM 7988 CB VAL B 44 37.627 -97.391 1.379 1.00283.77 C ANISOU 7988 CB VAL B 44 37471 34881 35467 -664 1474 -770 C ATOM 7989 CG1 VAL B 44 37.794 -96.798 2.773 1.00285.55 C ANISOU 7989 CG1 VAL B 44 37791 35193 35511 -1088 1710 -998 C ATOM 7990 CG2 VAL B 44 36.734 -98.625 1.478 1.00280.87 C ANISOU 7990 CG2 VAL B 44 37368 34434 34914 -846 1521 -808 C ATOM 7991 N PHE B 45 38.774 -95.084 -0.817 1.00288.44 N ANISOU 7991 N PHE B 45 37154 35553 36886 109 1152 -462 N ATOM 7992 CA PHE B 45 39.592 -93.900 -1.105 1.00286.89 C ANISOU 7992 CA PHE B 45 36656 35415 36932 299 1056 -358 C ATOM 7993 C PHE B 45 38.725 -92.646 -1.225 1.00285.29 C ANISOU 7993 C PHE B 45 35919 35063 37412 223 1240 -524 C ATOM 7994 O PHE B 45 38.931 -91.665 -0.504 1.00282.93 O ANISOU 7994 O PHE B 45 35440 34707 37354 107 1428 -723 O ATOM 7995 CB PHE B 45 40.415 -94.071 -2.389 1.00286.06 C ANISOU 7995 CB PHE B 45 36485 35454 36749 647 715 -25 C ATOM 7996 CG PHE B 45 41.256 -92.856 -2.741 1.00290.02 C ANISOU 7996 CG PHE B 45 36674 36033 37487 825 594 114 C ATOM 7997 CD1 PHE B 45 42.616 -92.842 -2.468 1.00295.77 C ANISOU 7997 CD1 PHE B 45 37595 36873 37909 964 462 221 C ATOM 7998 CD2 PHE B 45 40.691 -91.714 -3.338 1.00289.27 C ANISOU 7998 CD2 PHE B 45 36060 35874 37976 842 587 168 C ATOM 7999 CE1 PHE B 45 43.399 -91.730 -2.779 1.00299.16 C ANISOU 7999 CE1 PHE B 45 37745 37378 38542 1120 357 343 C ATOM 8000 CE2 PHE B 45 41.470 -90.596 -3.649 1.00292.51 C ANISOU 8000 CE2 PHE B 45 36171 36337 38630 989 456 327 C ATOM 8001 CZ PHE B 45 42.828 -90.606 -3.369 1.00296.44 C ANISOU 8001 CZ PHE B 45 36903 36977 38752 1131 356 396 C ATOM 8002 N VAL B 46 37.766 -92.694 -2.152 1.00284.35 N ANISOU 8002 N VAL B 46 35519 34869 37650 270 1175 -437 N ATOM 8003 CA VAL B 46 36.891 -91.559 -2.457 1.00283.38 C ANISOU 8003 CA VAL B 46 34800 34542 38330 222 1261 -496 C ATOM 8004 C VAL B 46 36.011 -91.240 -1.258 1.00287.10 C ANISOU 8004 C VAL B 46 35180 34789 39115 -108 1709 -993 C ATOM 8005 O VAL B 46 35.828 -90.071 -0.946 1.00281.10 O ANISOU 8005 O VAL B 46 33971 33836 38997 -178 1888 -1189 O ATOM 8006 CB VAL B 46 36.015 -91.791 -3.720 1.00284.60 C ANISOU 8006 CB VAL B 46 34678 34688 38768 282 1038 -229 C ATOM 8007 CG1 VAL B 46 35.159 -90.568 -4.022 1.00283.92 C ANISOU 8007 CG1 VAL B 46 33904 34332 39637 227 1055 -203 C ATOM 8008 CG2 VAL B 46 36.878 -92.114 -4.929 1.00284.74 C ANISOU 8008 CG2 VAL B 46 34774 34998 38414 504 644 191 C ATOM 8009 N VAL B 47 35.493 -92.283 -0.597 1.00295.22 N ANISOU 8009 N VAL B 47 36614 35843 39711 -342 1901 -1216 N ATOM 8010 CA VAL B 47 34.716 -92.174 0.659 1.00303.97 C ANISOU 8010 CA VAL B 47 37737 36826 40928 -766 2370 -1746 C ATOM 8011 C VAL B 47 35.420 -91.294 1.706 1.00311.71 C ANISOU 8011 C VAL B 47 38681 37844 41908 -963 2615 -2039 C ATOM 8012 O VAL B 47 34.844 -90.320 2.187 1.00321.09 O ANISOU 8012 O VAL B 47 39430 38830 43737 -1177 2970 -2457 O ATOM 8013 CB VAL B 47 34.335 -93.585 1.245 1.00300.22 C ANISOU 8013 CB VAL B 47 37827 36463 39780 -1018 2460 -1842 C ATOM 8014 CG1 VAL B 47 34.034 -93.567 2.750 1.00297.94 C ANISOU 8014 CG1 VAL B 47 37727 36210 39266 -1555 2901 -2340 C ATOM 8015 CG2 VAL B 47 33.161 -94.190 0.489 1.00298.80 C ANISOU 8015 CG2 VAL B 47 37532 36159 39836 -976 2422 -1793 C ATOM 8016 N GLU B 48 36.664 -91.620 2.049 1.00310.09 N ANISOU 8016 N GLU B 48 38896 37883 41041 -909 2436 -1839 N ATOM 8017 CA GLU B 48 37.347 -90.884 3.112 1.00305.58 C ANISOU 8017 CA GLU B 48 38344 37407 40355 -1168 2665 -2112 C ATOM 8018 C GLU B 48 37.879 -89.547 2.611 1.00297.55 C ANISOU 8018 C GLU B 48 36826 36278 39949 -895 2596 -2046 C ATOM 8019 O GLU B 48 37.957 -88.594 3.380 1.00300.25 O ANISOU 8019 O GLU B 48 36924 36568 40590 -1142 2923 -2439 O ATOM 8020 CB GLU B 48 38.408 -91.742 3.818 1.00305.72 C ANISOU 8020 CB GLU B 48 38980 37714 39464 -1300 2493 -1912 C ATOM 8021 CG GLU B 48 37.821 -92.871 4.687 1.00298.31 C ANISOU 8021 CG GLU B 48 38494 36878 37973 -1755 2640 -2055 C ATOM 8022 CD GLU B 48 37.369 -92.410 6.073 1.00293.58 C ANISOU 8022 CD GLU B 48 37891 36381 37274 -2429 3138 -2622 C ATOM 8023 OE1 GLU B 48 38.121 -91.638 6.707 1.00292.38 O ANISOU 8023 OE1 GLU B 48 37690 36370 37030 -2611 3248 -2764 O ATOM 8024 OE2 GLU B 48 36.280 -92.826 6.535 1.00284.86 O ANISOU 8024 OE2 GLU B 48 36833 35244 36155 -2817 3440 -2955 O ATOM 8025 N ALA B 49 38.187 -89.472 1.314 1.00280.18 N ANISOU 8025 N ALA B 49 34449 34050 37957 -437 2191 -1575 N ATOM 8026 CA ALA B 49 38.416 -88.189 0.648 1.00266.14 C ANISOU 8026 CA ALA B 49 32098 32117 36903 -199 2083 -1447 C ATOM 8027 C ALA B 49 37.199 -87.278 0.875 1.00264.78 C ANISOU 8027 C ALA B 49 31315 31579 37710 -404 2439 -1853 C ATOM 8028 O ALA B 49 37.347 -86.160 1.375 1.00263.82 O ANISOU 8028 O ALA B 49 30809 31296 38133 -510 2684 -2153 O ATOM 8029 CB ALA B 49 38.706 -88.377 -0.839 1.00256.45 C ANISOU 8029 CB ALA B 49 30772 30966 35699 197 1594 -872 C ATOM 8030 N ALA B 50 36.001 -87.776 0.553 1.00263.20 N ANISOU 8030 N ALA B 50 31005 31226 37772 -479 2490 -1902 N ATOM 8031 CA ALA B 50 34.744 -87.043 0.779 1.00267.06 C ANISOU 8031 CA ALA B 50 30887 31317 39266 -689 2839 -2314 C ATOM 8032 C ALA B 50 34.435 -86.795 2.262 1.00272.46 C ANISOU 8032 C ALA B 50 31602 31950 39970 -1180 3463 -3080 C ATOM 8033 O ALA B 50 34.103 -85.672 2.614 1.00274.70 O ANISOU 8033 O ALA B 50 31300 31925 41148 -1317 3787 -3489 O ATOM 8034 CB ALA B 50 33.568 -87.730 0.086 1.00266.34 C ANISOU 8034 CB ALA B 50 30709 31105 39381 -669 2725 -2164 C ATOM 8035 N VAL B 51 34.554 -87.828 3.111 1.00276.18 N ANISOU 8035 N VAL B 51 32722 32725 39488 -1484 3627 -3269 N ATOM 8036 CA VAL B 51 34.288 -87.726 4.562 1.00280.80 C ANISOU 8036 CA VAL B 51 33422 33388 39880 -2085 4211 -3982 C ATOM 8037 C VAL B 51 35.144 -86.638 5.170 1.00287.77 C ANISOU 8037 C VAL B 51 34103 34307 40927 -2205 4411 -4247 C ATOM 8038 O VAL B 51 34.646 -85.810 5.911 1.00294.10 O ANISOU 8038 O VAL B 51 34483 34929 42330 -2587 4944 -4921 O ATOM 8039 CB VAL B 51 34.530 -89.049 5.343 1.00276.28 C ANISOU 8039 CB VAL B 51 33640 33214 38117 -2421 4214 -3959 C ATOM 8040 CG1 VAL B 51 34.391 -88.831 6.834 1.00274.11 C ANISOU 8040 CG1 VAL B 51 33475 33116 37557 -3142 4784 -4651 C ATOM 8041 CG2 VAL B 51 33.525 -90.112 4.948 1.00278.86 C ANISOU 8041 CG2 VAL B 51 34142 33480 38330 -2412 4142 -3850 C ATOM 8042 N ARG B 52 36.427 -86.630 4.837 1.00290.34 N ANISOU 8042 N ARG B 52 34696 34854 40763 -1889 4005 -3756 N ATOM 8043 CA ARG B 52 37.334 -85.608 5.357 1.00297.20 C ANISOU 8043 CA ARG B 52 35396 35781 41744 -1973 4151 -3956 C ATOM 8044 C ARG B 52 37.117 -84.208 4.772 1.00311.09 C ANISOU 8044 C ARG B 52 36338 37110 44751 -1722 4210 -4048 C ATOM 8045 O ARG B 52 37.312 -83.207 5.478 1.00324.78 O ANISOU 8045 O ARG B 52 37734 38749 46917 -1983 4604 -4555 O ATOM 8046 CB ARG B 52 38.782 -86.057 5.223 1.00280.37 C ANISOU 8046 CB ARG B 52 33794 34009 38724 -1730 3701 -3411 C ATOM 8047 CG ARG B 52 39.071 -87.233 6.125 1.00274.32 C ANISOU 8047 CG ARG B 52 33744 33623 36860 -2118 3708 -3405 C ATOM 8048 CD ARG B 52 40.488 -87.714 5.983 1.00267.02 C ANISOU 8048 CD ARG B 52 33282 32983 35191 -1866 3238 -2847 C ATOM 8049 NE ARG B 52 40.555 -89.066 6.499 1.00272.64 N ANISOU 8049 NE ARG B 52 34615 33940 35036 -2120 3097 -2658 N ATOM 8050 CZ ARG B 52 41.681 -89.712 6.723 1.00275.05 C ANISOU 8050 CZ ARG B 52 35380 34492 34632 -2080 2738 -2236 C ATOM 8051 NH1 ARG B 52 42.835 -89.116 6.466 1.00272.20 N ANISOU 8051 NH1 ARG B 52 34946 34194 34284 -1787 2514 -2000 N ATOM 8052 NH2 ARG B 52 41.647 -90.948 7.202 1.00280.12 N ANISOU 8052 NH2 ARG B 52 36526 35291 34615 -2340 2590 -2036 N ATOM 8053 N GLY B 53 36.719 -84.148 3.499 1.00315.15 N ANISOU 8053 N GLY B 53 36521 37371 45848 -1267 3810 -3548 N ATOM 8054 CA GLY B 53 36.251 -82.913 2.862 1.00321.59 C ANISOU 8054 CA GLY B 53 36486 37705 47999 -1072 3799 -3543 C ATOM 8055 C GLY B 53 35.066 -82.353 3.627 1.00333.41 C ANISOU 8055 C GLY B 53 37441 38809 50427 -1488 4429 -4338 C ATOM 8056 O GLY B 53 35.060 -81.169 3.973 1.00334.75 O ANISOU 8056 O GLY B 53 37008 38660 51522 -1597 4744 -4756 O ATOM 8057 N VAL B 54 34.079 -83.223 3.888 1.00337.22 N ANISOU 8057 N VAL B 54 38127 39309 50689 -1734 4629 -4577 N ATOM 8058 CA VAL B 54 32.906 -82.941 4.751 1.00344.85 C ANISOU 8058 CA VAL B 54 38693 39983 52348 -2228 5306 -5438 C ATOM 8059 C VAL B 54 33.298 -82.403 6.139 1.00360.11 C ANISOU 8059 C VAL B 54 40658 42070 54096 -2787 5949 -6264 C ATOM 8060 O VAL B 54 32.781 -81.364 6.545 1.00366.29 O ANISOU 8060 O VAL B 54 40725 42444 56003 -3021 6449 -6929 O ATOM 8061 CB VAL B 54 31.930 -84.164 4.865 1.00335.05 C ANISOU 8061 CB VAL B 54 37835 38860 50606 -2436 5389 -5519 C ATOM 8062 CG1 VAL B 54 30.977 -84.062 6.058 1.00338.31 C ANISOU 8062 CG1 VAL B 54 38061 39168 51314 -3097 6172 -6514 C ATOM 8063 CG2 VAL B 54 31.133 -84.337 3.581 1.00326.29 C ANISOU 8063 CG2 VAL B 54 36372 37432 50168 -2020 4945 -4960 C ATOM 8064 N ARG B 55 34.213 -83.076 6.844 1.00369.54 N ANISOU 8064 N ARG B 55 42627 43837 53944 -3027 5930 -6218 N ATOM 8065 CA ARG B 55 34.602 -82.669 8.219 1.00376.76 C ANISOU 8065 CA ARG B 55 43647 45019 54486 -3684 6523 -6977 C ATOM 8066 C ARG B 55 35.285 -81.296 8.339 1.00380.85 C ANISOU 8066 C ARG B 55 43634 45343 55728 -3626 6690 -7227 C ATOM 8067 O ARG B 55 35.104 -80.594 9.338 1.00379.66 O ANISOU 8067 O ARG B 55 43172 45163 55918 -4199 7363 -8105 O ATOM 8068 CB ARG B 55 35.432 -83.751 8.913 1.00376.84 C ANISOU 8068 CB ARG B 55 44597 45691 52893 -3988 6360 -6738 C ATOM 8069 CG ARG B 55 34.686 -85.058 9.107 1.00375.62 C ANISOU 8069 CG ARG B 55 44937 45729 52049 -4234 6345 -6679 C ATOM 8070 CD ARG B 55 35.439 -85.947 10.079 1.00381.27 C ANISOU 8070 CD ARG B 55 46462 47062 51338 -4733 6292 -6581 C ATOM 8071 NE ARG B 55 35.660 -87.312 9.580 1.00379.92 N ANISOU 8071 NE ARG B 55 46927 47083 50343 -4434 5711 -5819 N ATOM 8072 CZ ARG B 55 36.847 -87.812 9.223 1.00379.77 C ANISOU 8072 CZ ARG B 55 47362 47290 49643 -4066 5131 -5097 C ATOM 8073 NH1 ARG B 55 37.944 -87.068 9.292 1.00387.84 N ANISOU 8073 NH1 ARG B 55 48313 48409 50638 -3935 5022 -4988 N ATOM 8074 NH2 ARG B 55 36.939 -89.066 8.794 1.00370.82 N ANISOU 8074 NH2 ARG B 55 46725 46261 47905 -3835 4676 -4510 N ATOM 8075 N GLN B 56 36.043 -80.900 7.320 1.00383.54 N ANISOU 8075 N GLN B 56 43845 45555 56327 -2978 6111 -6500 N ATOM 8076 CA GLN B 56 36.635 -79.558 7.295 1.00385.45 C ANISOU 8076 CA GLN B 56 43516 45541 57394 -2860 6216 -6666 C ATOM 8077 C GLN B 56 35.627 -78.421 6.983 1.00390.08 C ANISOU 8077 C GLN B 56 43045 45385 59782 -2804 6524 -7091 C ATOM 8078 O GLN B 56 35.683 -77.359 7.610 1.00400.63 O ANISOU 8078 O GLN B 56 43843 46481 61895 -3091 7038 -7780 O ATOM 8079 CB GLN B 56 37.863 -79.525 6.376 1.00378.69 C ANISOU 8079 CB GLN B 56 42904 44849 56129 -2253 5500 -5755 C ATOM 8080 CG GLN B 56 38.705 -78.250 6.462 1.00375.98 C ANISOU 8080 CG GLN B 56 42129 44362 56363 -2165 5574 -5876 C ATOM 8081 CD GLN B 56 39.610 -78.162 7.683 1.00375.39 C ANISOU 8081 CD GLN B 56 42471 44755 55404 -2657 5939 -6351 C ATOM 8082 OE1 GLN B 56 39.821 -79.146 8.392 1.00376.58 O ANISOU 8082 OE1 GLN B 56 43332 45410 54340 -3024 5995 -6405 O ATOM 8083 NE2 GLN B 56 40.166 -76.968 7.926 1.00373.41 N ANISOU 8083 NE2 GLN B 56 41759 44337 55779 -2694 6160 -6660 N ATOM 8084 N ALA B 57 34.717 -78.645 6.031 1.00382.99 N ANISOU 8084 N ALA B 57 41821 44111 59583 -2463 6209 -6683 N ATOM 8085 CA ALA B 57 33.638 -77.693 5.709 1.00384.92 C ANISOU 8085 CA ALA B 57 41031 43598 61623 -2424 6436 -7007 C ATOM 8086 C ALA B 57 32.797 -77.361 6.938 1.00398.25 C ANISOU 8086 C ALA B 57 42349 45091 63874 -3105 7370 -8234 C ATOM 8087 O ALA B 57 32.537 -76.194 7.221 1.00401.72 O ANISOU 8087 O ALA B 57 41950 45009 65674 -3247 7808 -8844 O ATOM 8088 CB ALA B 57 32.758 -78.251 4.607 1.00373.16 C ANISOU 8088 CB ALA B 57 39403 41870 60507 -2065 5937 -6356 C ATOM 8089 N GLN B 58 32.392 -78.413 7.655 1.00412.60 N ANISOU 8089 N GLN B 58 44791 47339 64637 -3552 7672 -8594 N ATOM 8090 CA GLN B 58 31.736 -78.332 8.973 1.00437.97 C ANISOU 8090 CA GLN B 58 47883 50606 67918 -4360 8591 -9793 C ATOM 8091 C GLN B 58 32.557 -77.470 9.939 1.00452.18 C ANISOU 8091 C GLN B 58 49581 52587 69640 -4802 9108 -10483 C ATOM 8092 O GLN B 58 32.010 -76.600 10.626 1.00462.19 O ANISOU 8092 O GLN B 58 50142 53499 71970 -5273 9868 -11513 O ATOM 8093 CB GLN B 58 31.577 -79.742 9.619 1.00439.86 C ANISOU 8093 CB GLN B 58 49063 51504 66559 -4803 8675 -9847 C ATOM 8094 CG GLN B 58 30.472 -80.676 9.088 1.00442.00 C ANISOU 8094 CG GLN B 58 49429 51637 66872 -4662 8483 -9579 C ATOM 8095 CD GLN B 58 30.342 -82.022 9.838 1.00440.67 C ANISOU 8095 CD GLN B 58 50163 52106 65163 -5170 8607 -9683 C ATOM 8096 OE1 GLN B 58 31.305 -82.790 9.967 1.00432.98 O ANISOU 8096 OE1 GLN B 58 50015 51705 62792 -5145 8215 -9139 O ATOM 8097 NE2 GLN B 58 29.130 -82.315 10.311 1.00442.22 N ANISOU 8097 NE2 GLN B 58 50165 52169 65687 -5637 9132 -10357 N ATOM 8098 N ALA B 59 33.868 -77.742 9.982 1.00457.76 N ANISOU 8098 N ALA B 59 50979 53848 69099 -4669 8702 -9931 N ATOM 8099 CA ALA B 59 34.766 -77.255 11.039 1.00467.68 C ANISOU 8099 CA ALA B 59 52417 55512 69765 -5204 9138 -10505 C ATOM 8100 C ALA B 59 34.991 -75.752 11.023 1.00470.82 C ANISOU 8100 C ALA B 59 51926 55390 71572 -5125 9449 -10964 C ATOM 8101 O ALA B 59 34.864 -75.099 12.056 1.00480.01 O ANISOU 8101 O ALA B 59 52752 56566 73064 -5808 10249 -12033 O ATOM 8102 CB ALA B 59 36.099 -78.001 11.022 1.00463.89 C ANISOU 8102 CB ALA B 59 52890 55722 67645 -5040 8544 -9703 C ATOM 8103 N GLU B 60 35.323 -75.191 9.869 1.00462.39 N ANISOU 8103 N GLU B 60 50459 53879 71349 -4351 8838 -10186 N ATOM 8104 CA GLU B 60 35.445 -73.738 9.789 1.00452.63 C ANISOU 8104 CA GLU B 60 48287 52046 71644 -4251 9096 -10573 C ATOM 8105 C GLU B 60 34.085 -73.144 9.460 1.00436.35 C ANISOU 8105 C GLU B 60 45193 49122 71475 -4205 9396 -11004 C ATOM 8106 O GLU B 60 33.953 -71.928 9.295 1.00424.44 O ANISOU 8106 O GLU B 60 42734 46939 71594 -4092 9594 -11314 O ATOM 8107 CB GLU B 60 36.507 -73.326 8.778 1.00469.58 C ANISOU 8107 CB GLU B 60 50453 54139 73825 -3529 8310 -9547 C ATOM 8108 CG GLU B 60 36.412 -74.062 7.451 1.00484.23 C ANISOU 8108 CG GLU B 60 52582 55975 75428 -2846 7412 -8352 C ATOM 8109 CD GLU B 60 37.714 -74.045 6.657 1.00489.22 C ANISOU 8109 CD GLU B 60 53606 56899 75377 -2298 6659 -7362 C ATOM 8110 OE1 GLU B 60 37.773 -73.307 5.646 1.00495.77 O ANISOU 8110 OE1 GLU B 60 53844 57265 77259 -1809 6200 -6778 O ATOM 8111 OE2 GLU B 60 38.674 -74.765 7.035 1.00485.45 O ANISOU 8111 OE2 GLU B 60 53995 57102 73349 -2382 6511 -7152 O ATOM 8112 N ASP B 61 33.092 -74.037 9.391 1.00426.78 N ANISOU 8112 N ASP B 61 44170 47930 70054 -4310 9419 -11016 N ATOM 8113 CA ASP B 61 31.671 -73.717 9.208 1.00430.65 C ANISOU 8113 CA ASP B 61 43779 47676 72172 -4365 9749 -11488 C ATOM 8114 C ASP B 61 31.361 -73.198 7.800 1.00426.50 C ANISOU 8114 C ASP B 61 42545 46434 73069 -3603 9013 -10551 C ATOM 8115 O ASP B 61 30.874 -72.071 7.631 1.00435.81 O ANISOU 8115 O ASP B 61 42633 46800 76153 -3537 9227 -10891 O ATOM 8116 CB ASP B 61 31.158 -72.762 10.308 1.00443.62 C ANISOU 8116 CB ASP B 61 44630 48942 74983 -5060 10827 -12957 C ATOM 8117 CG ASP B 61 29.649 -72.812 10.478 1.00455.30 C ANISOU 8117 CG ASP B 61 45451 49877 77663 -5350 11351 -13682 C ATOM 8118 OD1 ASP B 61 29.081 -73.916 10.357 1.00451.64 O ANISOU 8118 OD1 ASP B 61 45540 49717 76346 -5381 11169 -13402 O ATOM 8119 OD2 ASP B 61 29.041 -71.750 10.742 1.00466.10 O ANISOU 8119 OD2 ASP B 61 45728 50495 80872 -5554 11958 -14554 O ATOM 8120 N ALA B 62 31.642 -74.026 6.793 1.00412.80 N ANISOU 8120 N ALA B 62 41406 45006 70433 -3078 8141 -9371 N ATOM 8121 CA ALA B 62 31.431 -73.636 5.402 1.00404.32 C ANISOU 8121 CA ALA B 62 39772 43410 70439 -2439 7351 -8354 C ATOM 8122 C ALA B 62 30.006 -73.862 4.959 1.00403.60 C ANISOU 8122 C ALA B 62 39133 42792 71421 -2415 7324 -8343 C ATOM 8123 O ALA B 62 29.291 -74.694 5.531 1.00404.93 O ANISOU 8123 O ALA B 62 39656 43181 71015 -2777 7737 -8869 O ATOM 8124 CB ALA B 62 32.381 -74.372 4.487 1.00393.51 C ANISOU 8124 CB ALA B 62 39226 42628 67659 -1959 6469 -7159 C ATOM 8125 N LEU B 63 29.631 -73.117 3.917 1.00399.53 N ANISOU 8125 N LEU B 63 37754 41596 72451 -2007 6789 -7677 N ATOM 8126 CA LEU B 63 28.292 -73.134 3.322 1.00400.74 C ANISOU 8126 CA LEU B 63 37197 41123 73940 -1929 6624 -7497 C ATOM 8127 C LEU B 63 28.009 -74.439 2.574 1.00401.58 C ANISOU 8127 C LEU B 63 38055 41729 72795 -1733 6028 -6676 C ATOM 8128 O LEU B 63 26.845 -74.778 2.323 1.00401.55 O ANISOU 8128 O LEU B 63 37715 41398 73456 -1789 6026 -6696 O ATOM 8129 CB LEU B 63 28.113 -71.976 2.347 1.00396.18 C ANISOU 8129 CB LEU B 63 35513 39732 75286 -1566 6067 -6814 C ATOM 8130 CG LEU B 63 29.070 -70.792 2.357 1.00391.83 C ANISOU 8130 CG LEU B 63 34518 38932 75424 -1430 6014 -6758 C ATOM 8131 CD1 LEU B 63 28.974 -70.091 1.020 1.00389.39 C ANISOU 8131 CD1 LEU B 63 33442 38077 76432 -1003 5088 -5564 C ATOM 8132 CD2 LEU B 63 28.774 -69.840 3.504 1.00399.51 C ANISOU 8132 CD2 LEU B 63 34718 39331 77747 -1841 7011 -8123 C ATOM 8133 N ARG B 64 29.084 -75.142 2.196 1.00405.79 N ANISOU 8133 N ARG B 64 39557 43023 71598 -1505 5527 -5971 N ATOM 8134 CA ARG B 64 29.053 -76.475 1.543 1.00410.41 C ANISOU 8134 CA ARG B 64 40991 44196 70748 -1339 5003 -5248 C ATOM 8135 C ARG B 64 30.431 -77.151 1.737 1.00406.57 C ANISOU 8135 C ARG B 64 41588 44545 68342 -1261 4842 -4996 C ATOM 8136 O ARG B 64 31.301 -76.593 2.420 1.00408.17 O ANISOU 8136 O ARG B 64 41871 44868 68346 -1368 5153 -5399 O ATOM 8137 CB ARG B 64 28.697 -76.362 0.050 1.00410.95 C ANISOU 8137 CB ARG B 64 40626 44010 71503 -953 4115 -4103 C ATOM 8138 CG ARG B 64 29.446 -75.259 -0.683 1.00410.90 C ANISOU 8138 CG ARG B 64 40082 43750 72292 -662 3587 -3425 C ATOM 8139 CD ARG B 64 29.411 -75.480 -2.168 1.00403.61 C ANISOU 8139 CD ARG B 64 39109 42941 71301 -374 2626 -2167 C ATOM 8140 NE ARG B 64 28.095 -75.137 -2.669 1.00404.25 N ANISOU 8140 NE ARG B 64 38281 42342 72972 -421 2439 -1959 N ATOM 8141 CZ ARG B 64 27.565 -75.676 -3.750 1.00398.66 C ANISOU 8141 CZ ARG B 64 37579 41756 72135 -343 1774 -1093 C ATOM 8142 NH1 ARG B 64 28.241 -76.584 -4.435 1.00390.40 N ANISOU 8142 NH1 ARG B 64 37397 41487 69446 -224 1293 -435 N ATOM 8143 NH2 ARG B 64 26.356 -75.314 -4.146 1.00400.43 N ANISOU 8143 NH2 ARG B 64 36920 41324 73902 -414 1601 -907 N ATOM 8144 N VAL B 65 30.641 -78.327 1.137 1.00400.56 N ANISOU 8144 N VAL B 65 41612 44333 66247 -1086 4362 -4344 N ATOM 8145 CA VAL B 65 32.014 -78.829 0.924 1.00391.98 C ANISOU 8145 CA VAL B 65 41356 43908 63666 -878 3987 -3836 C ATOM 8146 C VAL B 65 32.602 -78.266 -0.413 1.00402.75 C ANISOU 8146 C VAL B 65 42411 45215 65400 -450 3198 -2822 C ATOM 8147 O VAL B 65 32.221 -78.698 -1.515 1.00397.88 O ANISOU 8147 O VAL B 65 41769 44650 64757 -265 2625 -2080 O ATOM 8148 CB VAL B 65 32.078 -80.376 1.011 1.00375.15 C ANISOU 8148 CB VAL B 65 40213 42390 59937 -934 3909 -3711 C ATOM 8149 CG1 VAL B 65 33.519 -80.870 0.949 1.00362.04 C ANISOU 8149 CG1 VAL B 65 39345 41341 56872 -756 3608 -3313 C ATOM 8150 CG2 VAL B 65 31.379 -80.868 2.271 1.00372.56 C ANISOU 8150 CG2 VAL B 65 40106 42094 59353 -1423 4641 -4644 C ATOM 8151 N ASP B 66 33.509 -77.280 -0.297 1.00418.20 N ANISOU 8151 N ASP B 66 44112 47084 67700 -352 3184 -2810 N ATOM 8152 CA ASP B 66 34.141 -76.553 -1.452 1.00419.02 C ANISOU 8152 CA ASP B 66 43847 47113 68246 -17 2485 -1907 C ATOM 8153 C ASP B 66 35.706 -76.661 -1.406 1.00421.31 C ANISOU 8153 C ASP B 66 44804 47979 67292 143 2315 -1680 C ATOM 8154 O ASP B 66 36.283 -77.078 -0.375 1.00434.65 O ANISOU 8154 O ASP B 66 47096 50013 68037 -18 2769 -2266 O ATOM 8155 CB ASP B 66 33.672 -75.079 -1.468 1.00408.46 C ANISOU 8155 CB ASP B 66 41369 44976 68851 -35 2574 -2041 C ATOM 8156 CG ASP B 66 33.422 -74.518 -2.858 1.00390.39 C ANISOU 8156 CG ASP B 66 38425 42389 67514 183 1773 -1005 C ATOM 8157 OD1 ASP B 66 33.901 -75.068 -3.859 1.00377.33 O ANISOU 8157 OD1 ASP B 66 37206 41228 64932 347 1132 -159 O ATOM 8158 OD2 ASP B 66 32.743 -73.469 -2.928 1.00383.52 O ANISOU 8158 OD2 ASP B 66 36540 40763 68414 144 1796 -1055 O ATOM 8159 N VAL B 67 36.389 -76.280 -2.498 1.00406.24 N ANISOU 8159 N VAL B 67 42772 46187 65391 413 1658 -829 N ATOM 8160 CA VAL B 67 37.820 -76.667 -2.732 1.00378.01 C ANISOU 8160 CA VAL B 67 39909 43240 60475 596 1378 -472 C ATOM 8161 C VAL B 67 38.850 -76.387 -1.569 1.00366.09 C ANISOU 8161 C VAL B 67 38748 41910 58437 523 1856 -1095 C ATOM 8162 O VAL B 67 39.707 -77.246 -1.277 1.00358.01 O ANISOU 8162 O VAL B 67 38536 41441 56049 552 1860 -1112 O ATOM 8163 CB VAL B 67 38.332 -76.244 -4.160 1.00368.76 C ANISOU 8163 CB VAL B 67 38482 42181 59446 823 601 532 C ATOM 8164 CG1 VAL B 67 39.328 -77.253 -4.671 1.00357.39 C ANISOU 8164 CG1 VAL B 67 37883 41464 56444 957 284 923 C ATOM 8165 CG2 VAL B 67 37.196 -76.163 -5.178 1.00366.02 C ANISOU 8165 CG2 VAL B 67 37553 41538 59979 778 160 1111 C ATOM 8166 N ASP B 68 38.726 -75.231 -0.904 1.00359.43 N ANISOU 8166 N ASP B 68 37271 40589 58708 395 2258 -1614 N ATOM 8167 CA ASP B 68 39.610 -74.788 0.203 1.00345.59 C ANISOU 8167 CA ASP B 68 35713 38966 56629 248 2739 -2245 C ATOM 8168 C ASP B 68 39.775 -75.770 1.324 1.00329.98 C ANISOU 8168 C ASP B 68 34522 37441 53415 -44 3210 -2856 C ATOM 8169 O ASP B 68 40.877 -75.982 1.824 1.00316.43 O ANISOU 8169 O ASP B 68 33364 36167 50698 -69 3257 -2924 O ATOM 8170 CB ASP B 68 39.047 -73.535 0.860 1.00364.44 C ANISOU 8170 CB ASP B 68 37217 40692 60560 34 3260 -2927 C ATOM 8171 CG ASP B 68 39.592 -72.269 0.267 1.00379.67 C ANISOU 8171 CG ASP B 68 38480 42269 63508 263 2938 -2514 C ATOM 8172 OD1 ASP B 68 40.104 -72.308 -0.875 1.00387.56 O ANISOU 8172 OD1 ASP B 68 39554 43456 64244 573 2228 -1583 O ATOM 8173 OD2 ASP B 68 39.461 -71.219 0.918 1.00389.60 O ANISOU 8173 OD2 ASP B 68 39091 43044 65892 95 3404 -3133 O ATOM 8174 N GLN B 69 38.635 -76.303 1.745 1.00328.85 N ANISOU 8174 N GLN B 69 34355 37152 53441 -305 3559 -3298 N ATOM 8175 CA GLN B 69 38.549 -77.226 2.844 1.00331.88 C ANISOU 8175 CA GLN B 69 35397 37913 52788 -685 4024 -3893 C ATOM 8176 C GLN B 69 39.263 -78.506 2.477 1.00331.21 C ANISOU 8176 C GLN B 69 36214 38428 51203 -497 3578 -3316 C ATOM 8177 O GLN B 69 40.156 -78.966 3.202 1.00334.79 O ANISOU 8177 O GLN B 69 37292 39329 50583 -646 3684 -3458 O ATOM 8178 CB GLN B 69 37.084 -77.513 3.179 1.00336.08 C ANISOU 8178 CB GLN B 69 35641 38125 53929 -980 4427 -4405 C ATOM 8179 CG GLN B 69 36.415 -76.408 3.982 1.00346.83 C ANISOU 8179 CG GLN B 69 36205 38950 56622 -1336 5110 -5303 C ATOM 8180 CD GLN B 69 35.793 -75.329 3.119 1.00353.27 C ANISOU 8180 CD GLN B 69 35991 39035 59199 -1065 4887 -5035 C ATOM 8181 OE1 GLN B 69 35.152 -75.621 2.125 1.00359.98 O ANISOU 8181 OE1 GLN B 69 36645 39697 60431 -807 4410 -4413 O ATOM 8182 NE2 GLN B 69 35.963 -74.075 3.515 1.00356.18 N ANISOU 8182 NE2 GLN B 69 35666 38977 60689 -1164 5227 -5501 N ATOM 8183 N LEU B 70 38.869 -79.076 1.343 1.00335.24 N ANISOU 8183 N LEU B 70 36751 38933 51690 -201 3074 -2664 N ATOM 8184 CA LEU B 70 39.514 -80.285 0.848 1.00341.74 C ANISOU 8184 CA LEU B 70 38337 40266 51243 -3 2649 -2131 C ATOM 8185 C LEU B 70 41.030 -80.113 0.793 1.00344.59 C ANISOU 8185 C LEU B 70 39032 40970 50925 193 2401 -1837 C ATOM 8186 O LEU B 70 41.777 -80.982 1.240 1.00346.44 O ANISOU 8186 O LEU B 70 39955 41621 50056 150 2377 -1826 O ATOM 8187 CB LEU B 70 38.989 -80.662 -0.536 1.00347.77 C ANISOU 8187 CB LEU B 70 38945 40977 52215 272 2118 -1451 C ATOM 8188 CG LEU B 70 39.653 -81.885 -1.183 1.00351.78 C ANISOU 8188 CG LEU B 70 40154 41982 51523 471 1700 -943 C ATOM 8189 CD1 LEU B 70 39.064 -83.189 -0.659 1.00350.20 C ANISOU 8189 CD1 LEU B 70 40499 41946 50613 274 1911 -1210 C ATOM 8190 CD2 LEU B 70 39.568 -81.805 -2.697 1.00361.35 C ANISOU 8190 CD2 LEU B 70 41087 43215 52992 721 1120 -212 C ATOM 8191 N GLU B 71 41.482 -78.988 0.256 1.00347.63 N ANISOU 8191 N GLU B 71 38900 41156 52025 396 2199 -1582 N ATOM 8192 CA GLU B 71 42.916 -78.789 0.058 1.00334.27 C ANISOU 8192 CA GLU B 71 37481 39782 49744 612 1921 -1252 C ATOM 8193 C GLU B 71 43.697 -78.593 1.378 1.00310.43 C ANISOU 8193 C GLU B 71 34763 36946 46239 360 2342 -1803 C ATOM 8194 O GLU B 71 44.903 -78.861 1.453 1.00296.83 O ANISOU 8194 O GLU B 71 33495 35592 43695 478 2147 -1584 O ATOM 8195 CB GLU B 71 43.145 -77.697 -0.992 1.00363.56 C ANISOU 8195 CB GLU B 71 40561 43256 54318 875 1527 -740 C ATOM 8196 CG GLU B 71 42.566 -78.062 -2.365 1.00407.06 C ANISOU 8196 CG GLU B 71 45902 48758 60004 1047 1007 -68 C ATOM 8197 CD GLU B 71 42.563 -76.900 -3.377 1.00443.84 C ANISOU 8197 CD GLU B 71 49825 53136 65677 1188 591 484 C ATOM 8198 OE1 GLU B 71 42.506 -75.705 -2.990 1.00464.30 O ANISOU 8198 OE1 GLU B 71 51815 55304 69293 1144 784 255 O ATOM 8199 OE2 GLU B 71 42.607 -77.177 -4.596 1.00459.79 O ANISOU 8199 OE2 GLU B 71 51838 55363 67497 1301 55 1167 O ATOM 8200 N LYS B 72 42.976 -78.172 2.414 1.00297.10 N ANISOU 8200 N LYS B 72 32813 35020 45050 -34 2928 -2533 N ATOM 8201 CA LYS B 72 43.484 -78.204 3.779 1.00287.11 C ANISOU 8201 CA LYS B 72 31900 34017 43172 -448 3387 -3129 C ATOM 8202 C LYS B 72 43.666 -79.647 4.307 1.00284.75 C ANISOU 8202 C LYS B 72 32437 34183 41572 -641 3346 -3082 C ATOM 8203 O LYS B 72 44.503 -79.886 5.182 1.00278.01 O ANISOU 8203 O LYS B 72 32035 33691 39903 -895 3454 -3235 O ATOM 8204 CB LYS B 72 42.566 -77.400 4.709 1.00284.39 C ANISOU 8204 CB LYS B 72 31010 33316 43727 -911 4078 -4001 C ATOM 8205 CG LYS B 72 42.564 -75.903 4.457 1.00279.23 C ANISOU 8205 CG LYS B 72 29511 32175 44406 -793 4192 -4154 C ATOM 8206 CD LYS B 72 41.935 -75.129 5.599 1.00277.91 C ANISOU 8206 CD LYS B 72 28865 31729 44998 -1334 4982 -5176 C ATOM 8207 CE LYS B 72 41.849 -73.666 5.212 1.00276.99 C ANISOU 8207 CE LYS B 72 27812 31012 46419 -1158 5046 -5272 C ATOM 8208 NZ LYS B 72 41.683 -72.776 6.388 1.00279.83 N ANISOU 8208 NZ LYS B 72 27732 31175 47412 -1688 5841 -6320 N ATOM 8209 N VAL B 73 42.880 -80.598 3.786 1.00290.02 N ANISOU 8209 N VAL B 73 33281 34828 42084 -548 3172 -2847 N ATOM 8210 CA VAL B 73 42.958 -82.024 4.196 1.00287.12 C ANISOU 8210 CA VAL B 73 33655 34828 40608 -709 3094 -2751 C ATOM 8211 C VAL B 73 43.562 -82.895 3.093 1.00279.89 C ANISOU 8211 C VAL B 73 33094 34094 39155 -234 2485 -2009 C ATOM 8212 O VAL B 73 43.612 -84.120 3.240 1.00284.89 O ANISOU 8212 O VAL B 73 34275 34954 39014 -291 2356 -1856 O ATOM 8213 CB VAL B 73 41.590 -82.664 4.620 1.00286.05 C ANISOU 8213 CB VAL B 73 33549 34578 40557 -1058 3430 -3143 C ATOM 8214 CG1 VAL B 73 40.817 -81.801 5.617 1.00289.91 C ANISOU 8214 CG1 VAL B 73 33586 34844 41720 -1569 4104 -3981 C ATOM 8215 CG2 VAL B 73 40.721 -83.003 3.407 1.00282.22 C ANISOU 8215 CG2 VAL B 73 32825 33842 40561 -706 3132 -2757 C ATOM 8216 N LEU B 74 43.988 -82.269 1.989 1.00266.53 N ANISOU 8216 N LEU B 74 31060 32298 37910 186 2128 -1573 N ATOM 8217 CA LEU B 74 44.722 -82.969 0.919 1.00252.27 C ANISOU 8217 CA LEU B 74 29545 30717 35588 580 1596 -943 C ATOM 8218 C LEU B 74 46.079 -83.461 1.409 1.00252.36 C ANISOU 8218 C LEU B 74 30091 31070 34721 609 1460 -823 C ATOM 8219 O LEU B 74 46.520 -84.558 1.014 1.00253.93 O ANISOU 8219 O LEU B 74 30721 31470 34289 770 1169 -503 O ATOM 8220 CB LEU B 74 44.895 -82.110 -0.338 1.00240.25 C ANISOU 8220 CB LEU B 74 27515 29066 34701 914 1253 -511 C ATOM 8221 CG LEU B 74 43.722 -82.120 -1.307 1.00238.30 C ANISOU 8221 CG LEU B 74 26874 28593 35075 974 1102 -291 C ATOM 8222 CD1 LEU B 74 44.194 -81.701 -2.678 1.00233.92 C ANISOU 8222 CD1 LEU B 74 26046 28119 34713 1256 607 320 C ATOM 8223 CD2 LEU B 74 43.081 -83.498 -1.368 1.00237.57 C ANISOU 8223 CD2 LEU B 74 27217 28627 34421 900 1096 -293 C ATOM 8224 N PRO B 75 46.745 -82.645 2.259 1.00254.62 N ANISOU 8224 N PRO B 75 30313 31402 35027 440 1671 -1089 N ATOM 8225 CA PRO B 75 47.876 -83.145 3.040 1.00261.45 C ANISOU 8225 CA PRO B 75 31693 32585 35059 325 1604 -1047 C ATOM 8226 C PRO B 75 47.533 -84.484 3.720 1.00272.42 C ANISOU 8226 C PRO B 75 33621 34127 35755 36 1645 -1099 C ATOM 8227 O PRO B 75 48.189 -85.498 3.455 1.00281.81 O ANISOU 8227 O PRO B 75 35219 35477 36377 214 1301 -719 O ATOM 8228 CB PRO B 75 48.082 -82.045 4.084 1.00258.09 C ANISOU 8228 CB PRO B 75 31043 32148 34869 -21 2000 -1524 C ATOM 8229 CG PRO B 75 47.607 -80.791 3.417 1.00254.22 C ANISOU 8229 CG PRO B 75 29856 31311 35422 167 2090 -1609 C ATOM 8230 CD PRO B 75 46.545 -81.186 2.434 1.00251.93 C ANISOU 8230 CD PRO B 75 29366 30801 35554 366 1938 -1393 C ATOM 8231 N GLN B 76 46.483 -84.468 4.548 1.00277.79 N ANISOU 8231 N GLN B 76 34252 34730 36563 -416 2069 -1578 N ATOM 8232 CA GLN B 76 46.019 -85.640 5.286 1.00278.60 C ANISOU 8232 CA GLN B 76 34825 34977 36051 -788 2150 -1662 C ATOM 8233 C GLN B 76 45.698 -86.860 4.402 1.00276.33 C ANISOU 8233 C GLN B 76 34779 34642 35571 -475 1811 -1256 C ATOM 8234 O GLN B 76 46.059 -87.986 4.747 1.00276.58 O ANISOU 8234 O GLN B 76 35294 34834 34957 -573 1614 -1032 O ATOM 8235 CB GLN B 76 44.828 -85.270 6.182 1.00280.01 C ANISOU 8235 CB GLN B 76 34806 35065 36519 -1341 2717 -2315 C ATOM 8236 CG GLN B 76 44.565 -86.274 7.293 1.00282.82 C ANISOU 8236 CG GLN B 76 35675 35681 36101 -1921 2857 -2465 C ATOM 8237 CD GLN B 76 45.842 -86.779 7.966 1.00286.31 C ANISOU 8237 CD GLN B 76 36613 36480 35690 -2095 2568 -2134 C ATOM 8238 OE1 GLN B 76 46.680 -85.999 8.431 1.00288.16 O ANISOU 8238 OE1 GLN B 76 36774 36864 35847 -2220 2627 -2228 O ATOM 8239 NE2 GLN B 76 45.992 -88.100 8.020 1.00289.48 N ANISOU 8239 NE2 GLN B 76 37495 36993 35499 -2113 2236 -1726 N ATOM 8240 N LEU B 77 45.045 -86.636 3.264 1.00272.13 N ANISOU 8240 N LEU B 77 33886 33888 35623 -133 1727 -1145 N ATOM 8241 CA LEU B 77 44.679 -87.729 2.338 1.00258.80 C ANISOU 8241 CA LEU B 77 32373 32174 33782 124 1445 -815 C ATOM 8242 C LEU B 77 45.868 -88.389 1.641 1.00248.01 C ANISOU 8242 C LEU B 77 31276 30968 31988 493 1003 -346 C ATOM 8243 O LEU B 77 45.906 -89.608 1.495 1.00242.44 O ANISOU 8243 O LEU B 77 30924 30310 30882 536 830 -167 O ATOM 8244 CB LEU B 77 43.666 -87.253 1.283 1.00258.45 C ANISOU 8244 CB LEU B 77 31836 31895 34464 316 1444 -789 C ATOM 8245 CG LEU B 77 43.125 -88.241 0.230 1.00252.22 C ANISOU 8245 CG LEU B 77 31143 31100 33587 520 1195 -499 C ATOM 8246 CD1 LEU B 77 42.245 -89.329 0.832 1.00248.95 C ANISOU 8246 CD1 LEU B 77 31065 30664 32860 238 1377 -701 C ATOM 8247 CD2 LEU B 77 42.361 -87.490 -0.847 1.00253.20 C ANISOU 8247 CD2 LEU B 77 30703 31043 34458 676 1111 -370 C ATOM 8248 N LEU B 78 46.836 -87.595 1.205 1.00238.98 N ANISOU 8248 N LEU B 78 29936 29883 30980 748 838 -176 N ATOM 8249 CA LEU B 78 47.924 -88.169 0.420 1.00229.31 C ANISOU 8249 CA LEU B 78 28890 28795 29442 1096 457 208 C ATOM 8250 C LEU B 78 49.063 -88.742 1.265 1.00237.25 C ANISOU 8250 C LEU B 78 30307 29940 29895 1022 330 310 C ATOM 8251 O LEU B 78 49.842 -89.569 0.768 1.00235.40 O ANISOU 8251 O LEU B 78 30270 29758 29411 1259 41 579 O ATOM 8252 CB LEU B 78 48.395 -87.210 -0.665 1.00215.22 C ANISOU 8252 CB LEU B 78 26702 27034 28037 1405 283 407 C ATOM 8253 CG LEU B 78 47.300 -87.098 -1.727 1.00207.97 C ANISOU 8253 CG LEU B 78 25449 26011 27558 1469 249 484 C ATOM 8254 CD1 LEU B 78 47.387 -85.775 -2.468 1.00203.70 C ANISOU 8254 CD1 LEU B 78 24381 25426 27588 1597 151 636 C ATOM 8255 CD2 LEU B 78 47.333 -88.273 -2.679 1.00205.20 C ANISOU 8255 CD2 LEU B 78 25306 25780 26879 1620 17 702 C ATOM 8256 N LEU B 79 49.134 -88.321 2.540 1.00250.51 N ANISOU 8256 N LEU B 79 32086 31678 31417 647 550 82 N ATOM 8257 CA LEU B 79 49.897 -89.044 3.597 1.00261.12 C ANISOU 8257 CA LEU B 79 33866 33167 32179 387 431 201 C ATOM 8258 C LEU B 79 49.346 -90.474 3.802 1.00275.30 C ANISOU 8258 C LEU B 79 36016 34911 33674 236 341 311 C ATOM 8259 O LEU B 79 50.118 -91.429 3.963 1.00278.76 O ANISOU 8259 O LEU B 79 36751 35367 33798 283 32 629 O ATOM 8260 CB LEU B 79 49.887 -88.335 4.984 1.00256.59 C ANISOU 8260 CB LEU B 79 33331 32740 31418 -150 731 -111 C ATOM 8261 CG LEU B 79 50.251 -86.904 5.411 1.00251.59 C ANISOU 8261 CG LEU B 79 32399 32181 31012 -279 975 -392 C ATOM 8262 CD1 LEU B 79 49.938 -86.768 6.896 1.00251.17 C ANISOU 8262 CD1 LEU B 79 32516 32319 30598 -994 1312 -759 C ATOM 8263 CD2 LEU B 79 51.706 -86.542 5.156 1.00246.52 C ANISOU 8263 CD2 LEU B 79 31754 31645 30265 23 672 -89 C ATOM 8264 N ASP B 80 48.012 -90.611 3.833 1.00290.95 N ANISOU 8264 N ASP B 80 37938 36797 35812 40 608 51 N ATOM 8265 CA ASP B 80 47.347 -91.917 4.015 1.00304.39 C ANISOU 8265 CA ASP B 80 39951 38436 37264 -125 559 123 C ATOM 8266 C ASP B 80 47.402 -92.786 2.749 1.00303.31 C ANISOU 8266 C ASP B 80 39810 38167 37265 334 292 377 C ATOM 8267 O ASP B 80 47.099 -93.990 2.795 1.00309.22 O ANISOU 8267 O ASP B 80 40819 38834 37833 272 184 495 O ATOM 8268 CB ASP B 80 45.894 -91.741 4.493 1.00311.52 C ANISOU 8268 CB ASP B 80 40774 39290 38297 -516 965 -285 C ATOM 8269 CG ASP B 80 45.782 -91.524 6.007 1.00320.41 C ANISOU 8269 CG ASP B 80 42088 40605 39046 -1180 1228 -548 C ATOM 8270 OD1 ASP B 80 46.788 -91.625 6.748 1.00325.41 O ANISOU 8270 OD1 ASP B 80 42963 41428 39247 -1384 1048 -347 O ATOM 8271 OD2 ASP B 80 44.655 -91.258 6.468 1.00326.54 O ANISOU 8271 OD2 ASP B 80 42754 41358 39956 -1553 1627 -975 O ATOM 8272 N PHE B 81 47.806 -92.161 1.641 1.00295.84 N ANISOU 8272 N PHE B 81 38556 37218 36631 742 196 447 N ATOM 8273 CA PHE B 81 47.891 -92.790 0.331 1.00287.75 C ANISOU 8273 CA PHE B 81 37458 36147 35728 1110 -2 612 C ATOM 8274 C PHE B 81 49.173 -92.445 -0.417 1.00276.66 C ANISOU 8274 C PHE B 81 35916 34833 34368 1459 -236 804 C ATOM 8275 O PHE B 81 50.039 -93.299 -0.577 1.00264.93 O ANISOU 8275 O PHE B 81 34602 33322 32734 1613 -457 973 O ATOM 8276 CB PHE B 81 46.667 -92.408 -0.493 1.00291.74 C ANISOU 8276 CB PHE B 81 37659 36602 36586 1137 156 470 C ATOM 8277 CG PHE B 81 45.402 -93.050 -0.006 1.00296.94 C ANISOU 8277 CG PHE B 81 38462 37151 37209 852 357 289 C ATOM 8278 CD1 PHE B 81 45.297 -94.447 0.052 1.00297.94 C ANISOU 8278 CD1 PHE B 81 38921 37216 37064 817 251 379 C ATOM 8279 CD2 PHE B 81 44.320 -92.272 0.412 1.00296.60 C ANISOU 8279 CD2 PHE B 81 38194 37036 37463 605 663 8 C ATOM 8280 CE1 PHE B 81 44.131 -95.055 0.502 1.00297.29 C ANISOU 8280 CE1 PHE B 81 38982 37043 36928 537 432 221 C ATOM 8281 CE2 PHE B 81 43.153 -92.877 0.865 1.00297.39 C ANISOU 8281 CE2 PHE B 81 38421 37043 37528 320 869 -189 C ATOM 8282 CZ PHE B 81 43.061 -94.266 0.907 1.00298.06 C ANISOU 8282 CZ PHE B 81 38876 37109 37263 284 746 -68 C TER 8283 PHE B 81 ATOM 8284 N SER I 14 65.001 36.244 51.676 1.00271.62 N ANISOU 8284 N SER I 14 36640 42173 24388 -871 -2039 579 N ATOM 8285 CA SER I 14 66.281 35.673 51.169 1.00265.78 C ANISOU 8285 CA SER I 14 36063 41006 23914 -841 -1760 665 C ATOM 8286 C SER I 14 67.499 36.593 51.390 1.00261.78 C ANISOU 8286 C SER I 14 35383 40779 23302 -699 -1783 320 C ATOM 8287 O SER I 14 67.391 37.815 51.636 1.00264.80 O ANISOU 8287 O SER I 14 35642 41508 23461 -692 -2016 -128 O ATOM 8288 CB SER I 14 66.145 35.294 49.682 1.00260.47 C ANISOU 8288 CB SER I 14 36034 39403 23527 -1152 -1625 521 C ATOM 8289 OG SER I 14 67.249 34.530 49.226 1.00252.14 O ANISOU 8289 OG SER I 14 35130 37900 22771 -1112 -1288 666 O ATOM 8290 N TYR I 15 68.661 35.956 51.318 1.00250.78 N ANISOU 8290 N TYR I 15 33948 39208 22128 -585 -1522 553 N ATOM 8291 CA TYR I 15 69.952 36.608 51.255 1.00238.97 C ANISOU 8291 CA TYR I 15 32367 37766 20664 -492 -1480 293 C ATOM 8292 C TYR I 15 69.993 37.883 50.383 1.00230.00 C ANISOU 8292 C TYR I 15 31563 36311 19516 -677 -1623 -337 C ATOM 8293 O TYR I 15 70.659 38.884 50.703 1.00224.41 O ANISOU 8293 O TYR I 15 30623 35918 18724 -596 -1752 -677 O ATOM 8294 CB TYR I 15 70.923 35.586 50.703 1.00240.80 C ANISOU 8294 CB TYR I 15 32762 37445 21283 -455 -1099 625 C ATOM 8295 CG TYR I 15 72.309 35.812 51.149 1.00249.07 C ANISOU 8295 CG TYR I 15 33467 38782 22384 -250 -1017 676 C ATOM 8296 CD1 TYR I 15 72.746 35.331 52.382 1.00257.36 C ANISOU 8296 CD1 TYR I 15 33912 40535 23335 11 -1015 1147 C ATOM 8297 CD2 TYR I 15 73.201 36.511 50.346 1.00251.80 C ANISOU 8297 CD2 TYR I 15 34056 38734 22880 -318 -947 296 C ATOM 8298 CE1 TYR I 15 74.052 35.541 52.803 1.00266.78 C ANISOU 8298 CE1 TYR I 15 34751 42037 24576 183 -969 1223 C ATOM 8299 CE2 TYR I 15 74.507 36.732 50.752 1.00261.64 C ANISOU 8299 CE2 TYR I 15 34957 40237 24214 -139 -883 361 C ATOM 8300 CZ TYR I 15 74.936 36.248 51.980 1.00266.64 C ANISOU 8300 CZ TYR I 15 34990 41574 24746 103 -906 815 C ATOM 8301 OH TYR I 15 76.248 36.482 52.375 1.00268.31 O ANISOU 8301 OH TYR I 15 34829 42072 25044 259 -873 897 O ATOM 8302 N GLN I 16 69.272 37.851 49.280 1.00227.88 N ANISOU 8302 N GLN I 16 31809 35426 19349 -935 -1608 -475 N ATOM 8303 CA GLN I 16 69.307 38.980 48.388 1.00229.68 C ANISOU 8303 CA GLN I 16 32331 35337 19599 -1107 -1715 -962 C ATOM 8304 C GLN I 16 68.429 40.128 48.812 1.00232.59 C ANISOU 8304 C GLN I 16 32508 36101 19763 -1140 -2044 -1290 C ATOM 8305 O GLN I 16 68.837 41.248 48.583 1.00235.65 O ANISOU 8305 O GLN I 16 32863 36469 20202 -1158 -2136 -1683 O ATOM 8306 CB GLN I 16 69.054 38.552 46.971 1.00231.13 C ANISOU 8306 CB GLN I 16 33125 34752 19940 -1375 -1558 -984 C ATOM 8307 CG GLN I 16 70.176 37.683 46.490 1.00239.33 C ANISOU 8307 CG GLN I 16 34342 35363 21228 -1319 -1182 -798 C ATOM 8308 CD GLN I 16 69.683 36.467 45.741 1.00249.94 C ANISOU 8308 CD GLN I 16 36106 36150 22708 -1504 -966 -589 C ATOM 8309 OE1 GLN I 16 68.985 36.562 44.713 1.00258.21 O ANISOU 8309 OE1 GLN I 16 37611 36796 23700 -1791 -1020 -787 O ATOM 8310 NE2 GLN I 16 70.025 35.302 46.277 1.00254.83 N ANISOU 8310 NE2 GLN I 16 36537 36761 23524 -1350 -724 -175 N ATOM 8311 N GLN I 17 67.264 39.863 49.431 1.00235.32 N ANISOU 8311 N GLN I 17 32700 36780 19930 -1137 -2191 -1120 N ATOM 8312 CA GLN I 17 66.389 40.889 50.083 1.00235.59 C ANISOU 8312 CA GLN I 17 32451 37291 19768 -1111 -2467 -1399 C ATOM 8313 C GLN I 17 67.187 41.745 51.007 1.00240.71 C ANISOU 8313 C GLN I 17 32645 38511 20302 -904 -2549 -1716 C ATOM 8314 O GLN I 17 66.953 42.951 51.151 1.00237.31 O ANISOU 8314 O GLN I 17 32072 38234 19859 -921 -2717 -2167 O ATOM 8315 CB GLN I 17 65.437 40.233 51.063 1.00231.75 C ANISOU 8315 CB GLN I 17 31676 37307 19070 -1004 -2532 -1047 C ATOM 8316 CG GLN I 17 64.005 40.042 50.661 1.00226.77 C ANISOU 8316 CG GLN I 17 31256 36454 18453 -1195 -2640 -908 C ATOM 8317 CD GLN I 17 63.304 39.174 51.655 1.00225.75 C ANISOU 8317 CD GLN I 17 30807 36798 18169 -1051 -2636 -449 C ATOM 8318 OE1 GLN I 17 63.780 38.090 51.947 1.00228.86 O ANISOU 8318 OE1 GLN I 17 31116 37221 18619 -945 -2457 -34 O ATOM 8319 NE2 GLN I 17 62.206 39.655 52.211 1.00222.06 N ANISOU 8319 NE2 GLN I 17 30119 36713 17540 -1026 -2807 -491 N ATOM 8320 N ARG I 18 68.054 41.029 51.710 1.00250.15 N ANISOU 8320 N ARG I 18 33569 40054 21422 -709 -2428 -1436 N ATOM 8321 CA ARG I 18 68.994 41.522 52.688 1.00258.87 C ANISOU 8321 CA ARG I 18 34194 41788 22375 -507 -2493 -1623 C ATOM 8322 C ARG I 18 69.947 42.528 52.013 1.00258.13 C ANISOU 8322 C ARG I 18 34214 41324 22537 -583 -2497 -2086 C ATOM 8323 O ARG I 18 70.040 43.702 52.425 1.00260.80 O ANISOU 8323 O ARG I 18 34293 41960 22836 -566 -2675 -2592 O ATOM 8324 CB ARG I 18 69.776 40.313 53.171 1.00267.07 C ANISOU 8324 CB ARG I 18 35036 43038 23400 -336 -2304 -1067 C ATOM 8325 CG ARG I 18 69.702 39.938 54.643 1.00277.43 C ANISOU 8325 CG ARG I 18 35767 45310 24334 -100 -2387 -780 C ATOM 8326 CD ARG I 18 70.504 38.663 54.785 1.00286.88 C ANISOU 8326 CD ARG I 18 36846 46476 25678 34 -2143 -130 C ATOM 8327 NE ARG I 18 71.725 38.894 54.043 1.00297.80 N ANISOU 8327 NE ARG I 18 38412 47365 27374 -9 -2013 -297 N ATOM 8328 CZ ARG I 18 72.936 38.851 54.560 1.00310.48 C ANISOU 8328 CZ ARG I 18 39651 49330 28985 144 -1977 -172 C ATOM 8329 NH1 ARG I 18 73.983 39.142 53.792 1.00314.87 N ANISOU 8329 NH1 ARG I 18 40397 49370 29867 93 -1851 -345 N ATOM 8330 NH2 ARG I 18 73.106 38.517 55.833 1.00319.19 N ANISOU 8330 NH2 ARG I 18 40180 51335 29762 349 -2067 156 N ATOM 8331 N LEU I 19 70.621 42.080 50.946 1.00253.94 N ANISOU 8331 N LEU I 19 34069 40115 22301 -674 -2279 -1926 N ATOM 8332 CA LEU I 19 71.610 42.907 50.228 1.00252.11 C ANISOU 8332 CA LEU I 19 33948 39492 22350 -731 -2231 -2258 C ATOM 8333 C LEU I 19 71.009 44.058 49.401 1.00261.82 C ANISOU 8333 C LEU I 19 35419 40322 23736 -923 -2353 -2677 C ATOM 8334 O LEU I 19 71.631 45.119 49.260 1.00259.42 O ANISOU 8334 O LEU I 19 34982 39946 23637 -930 -2413 -3058 O ATOM 8335 CB LEU I 19 72.519 42.033 49.378 1.00241.16 C ANISOU 8335 CB LEU I 19 32876 37544 21209 -742 -1916 -1931 C ATOM 8336 CG LEU I 19 73.434 41.165 50.241 1.00237.78 C ANISOU 8336 CG LEU I 19 32081 37518 20748 -518 -1787 -1540 C ATOM 8337 CD1 LEU I 19 74.165 40.195 49.332 1.00236.32 C ANISOU 8337 CD1 LEU I 19 32244 36682 20864 -532 -1415 -1194 C ATOM 8338 CD2 LEU I 19 74.417 41.977 51.067 1.00236.85 C ANISOU 8338 CD2 LEU I 19 31453 37940 20599 -380 -1940 -1794 C ATOM 8339 N LYS I 20 69.802 43.836 48.873 1.00280.52 N ANISOU 8339 N LYS I 20 38101 42436 26044 -1081 -2392 -2569 N ATOM 8340 CA LYS I 20 68.966 44.877 48.219 1.00297.02 C ANISOU 8340 CA LYS I 20 40348 44250 28255 -1259 -2540 -2864 C ATOM 8341 C LYS I 20 68.662 46.086 49.131 1.00308.73 C ANISOU 8341 C LYS I 20 41370 46205 29728 -1171 -2757 -3311 C ATOM 8342 O LYS I 20 68.812 47.255 48.732 1.00317.94 O ANISOU 8342 O LYS I 20 42485 47141 31176 -1236 -2817 -3675 O ATOM 8343 CB LYS I 20 67.610 44.289 47.761 1.00299.71 C ANISOU 8343 CB LYS I 20 41001 44400 28474 -1430 -2587 -2599 C ATOM 8344 CG LYS I 20 67.618 43.342 46.564 1.00297.50 C ANISOU 8344 CG LYS I 20 41264 43528 28244 -1618 -2405 -2301 C ATOM 8345 CD LYS I 20 66.249 42.693 46.363 1.00296.48 C ANISOU 8345 CD LYS I 20 41342 43329 27978 -1786 -2498 -2050 C ATOM 8346 CE LYS I 20 66.353 41.420 45.536 1.00293.38 C ANISOU 8346 CE LYS I 20 41397 42472 27599 -1933 -2289 -1757 C ATOM 8347 NZ LYS I 20 65.400 40.353 45.964 1.00286.57 N ANISOU 8347 NZ LYS I 20 40525 41721 26634 -1970 -2319 -1420 N ATOM 8348 N ALA I 21 68.191 45.801 50.342 1.00312.40 N ANISOU 8348 N ALA I 21 41489 47322 29887 -1024 -2855 -3281 N ATOM 8349 CA ALA I 21 67.825 46.861 51.272 1.00311.96 C ANISOU 8349 CA ALA I 21 40999 47760 29768 -939 -3030 -3748 C ATOM 8350 C ALA I 21 69.079 47.658 51.704 1.00316.17 C ANISOU 8350 C ALA I 21 41198 48493 30438 -848 -3058 -4184 C ATOM 8351 O ALA I 21 68.984 48.843 52.022 1.00317.74 O ANISOU 8351 O ALA I 21 41130 48798 30797 -851 -3171 -4715 O ATOM 8352 CB ALA I 21 67.051 46.296 52.460 1.00306.41 C ANISOU 8352 CB ALA I 21 40008 47767 28643 -794 -3098 -3583 C ATOM 8353 N ALA I 22 70.252 47.014 51.664 1.00315.83 N ANISOU 8353 N ALA I 22 41163 48445 30394 -780 -2944 -3958 N ATOM 8354 CA ALA I 22 71.542 47.656 51.975 1.00312.81 C ANISOU 8354 CA ALA I 22 40470 48204 30178 -715 -2973 -4293 C ATOM 8355 C ALA I 22 71.872 48.760 50.988 1.00304.83 C ANISOU 8355 C ALA I 22 39602 46542 29675 -853 -2954 -4628 C ATOM 8356 O ALA I 22 72.336 49.842 51.362 1.00307.53 O ANISOU 8356 O ALA I 22 39603 47004 30239 -845 -3063 -5142 O ATOM 8357 CB ALA I 22 72.657 46.625 51.985 1.00313.21 C ANISOU 8357 CB ALA I 22 40532 48293 30179 -618 -2818 -3855 C ATOM 8358 N VAL I 23 71.633 48.468 49.720 1.00290.56 N ANISOU 8358 N VAL I 23 38284 44056 28059 -987 -2809 -4327 N ATOM 8359 CA VAL I 23 71.769 49.451 48.670 1.00275.82 C ANISOU 8359 CA VAL I 23 36577 41573 26649 -1123 -2774 -4521 C ATOM 8360 C VAL I 23 70.928 50.687 49.004 1.00274.67 C ANISOU 8360 C VAL I 23 36166 41509 26686 -1165 -2947 -4985 C ATOM 8361 O VAL I 23 71.432 51.809 48.959 1.00273.68 O ANISOU 8361 O VAL I 23 35788 41220 26974 -1179 -2983 -5388 O ATOM 8362 CB VAL I 23 71.358 48.863 47.301 1.00267.47 C ANISOU 8362 CB VAL I 23 36098 39903 25624 -1281 -2617 -4102 C ATOM 8363 CG1 VAL I 23 71.596 49.867 46.192 1.00262.76 C ANISOU 8363 CG1 VAL I 23 35631 38733 25473 -1407 -2567 -4222 C ATOM 8364 CG2 VAL I 23 72.134 47.594 47.004 1.00263.38 C ANISOU 8364 CG2 VAL I 23 35839 39271 24961 -1233 -2398 -3690 C ATOM 8365 N HIS I 24 69.662 50.472 49.370 1.00273.83 N ANISOU 8365 N HIS I 24 36084 41639 26319 -1176 -3034 -4921 N ATOM 8366 CA HIS I 24 68.732 51.570 49.665 1.00272.62 C ANISOU 8366 CA HIS I 24 35690 41530 26361 -1206 -3154 -5313 C ATOM 8367 C HIS I 24 69.253 52.533 50.698 1.00266.82 C ANISOU 8367 C HIS I 24 34428 41192 25760 -1102 -3246 -5951 C ATOM 8368 O HIS I 24 69.065 53.743 50.589 1.00260.45 O ANISOU 8368 O HIS I 24 33412 40135 25410 -1150 -3274 -6373 O ATOM 8369 CB HIS I 24 67.383 51.052 50.163 1.00278.59 C ANISOU 8369 CB HIS I 24 36473 42625 26753 -1187 -3221 -5128 C ATOM 8370 CG HIS I 24 66.365 52.137 50.358 1.00286.67 C ANISOU 8370 CG HIS I 24 37272 43621 28027 -1214 -3297 -5470 C ATOM 8371 ND1 HIS I 24 65.878 52.886 49.308 1.00291.98 N ANISOU 8371 ND1 HIS I 24 38096 43679 29162 -1366 -3282 -5414 N ATOM 8372 CD2 HIS I 24 65.753 52.608 51.472 1.00291.90 C ANISOU 8372 CD2 HIS I 24 37548 44795 28564 -1099 -3364 -5856 C ATOM 8373 CE1 HIS I 24 65.000 53.763 49.762 1.00298.00 C ANISOU 8373 CE1 HIS I 24 38564 44527 30133 -1341 -3328 -5726 C ATOM 8374 NE2 HIS I 24 64.910 53.619 51.073 1.00299.93 N ANISOU 8374 NE2 HIS I 24 38493 45442 30024 -1178 -3367 -6034 N ATOM 8375 N TYR I 25 69.884 51.972 51.718 1.00266.02 N ANISOU 8375 N TYR I 25 34086 41725 25264 -966 -3290 -6011 N ATOM 8376 CA TYR I 25 70.393 52.743 52.827 1.00271.91 C ANISOU 8376 CA TYR I 25 34314 42998 26001 -883 -3408 -6642 C ATOM 8377 C TYR I 25 71.319 53.861 52.323 1.00269.54 C ANISOU 8377 C TYR I 25 33865 42208 26339 -965 -3400 -7048 C ATOM 8378 O TYR I 25 71.074 55.045 52.604 1.00271.37 O ANISOU 8378 O TYR I 25 33794 42376 26937 -999 -3455 -7641 O ATOM 8379 CB TYR I 25 71.067 51.806 53.865 1.00283.51 C ANISOU 8379 CB TYR I 25 35566 45250 26902 -740 -3462 -6489 C ATOM 8380 CG TYR I 25 72.036 52.482 54.828 1.00295.82 C ANISOU 8380 CG TYR I 25 36613 47338 28446 -694 -3600 -7083 C ATOM 8381 CD1 TYR I 25 71.593 53.048 56.035 1.00300.44 C ANISOU 8381 CD1 TYR I 25 36777 48637 28738 -635 -3735 -7667 C ATOM 8382 CD2 TYR I 25 73.404 52.545 54.532 1.00300.11 C ANISOU 8382 CD2 TYR I 25 37081 47688 29258 -717 -3593 -7071 C ATOM 8383 CE1 TYR I 25 72.485 53.676 56.894 1.00305.63 C ANISOU 8383 CE1 TYR I 25 36965 49801 29357 -631 -3883 -8270 C ATOM 8384 CE2 TYR I 25 74.294 53.173 55.379 1.00304.12 C ANISOU 8384 CE2 TYR I 25 37103 48671 29775 -709 -3750 -7616 C ATOM 8385 CZ TYR I 25 73.838 53.729 56.556 1.00306.43 C ANISOU 8385 CZ TYR I 25 36994 49682 29753 -679 -3908 -8232 C ATOM 8386 OH TYR I 25 74.757 54.339 57.372 1.00310.19 O ANISOU 8386 OH TYR I 25 36989 50652 30218 -705 -4084 -8817 O ATOM 8387 N THR I 26 72.357 53.502 51.560 1.00265.24 N ANISOU 8387 N THR I 26 33515 41279 25982 -995 -3305 -6725 N ATOM 8388 CA THR I 26 73.341 54.523 51.151 1.00263.18 C ANISOU 8388 CA THR I 26 33057 40594 26345 -1057 -3293 -7067 C ATOM 8389 C THR I 26 72.797 55.452 50.078 1.00264.59 C ANISOU 8389 C THR I 26 33385 40017 27130 -1178 -3210 -7092 C ATOM 8390 O THR I 26 73.154 56.622 50.038 1.00266.76 O ANISOU 8390 O THR I 26 33349 40014 27992 -1224 -3231 -7545 O ATOM 8391 CB THR I 26 74.724 53.991 50.710 1.00258.99 C ANISOU 8391 CB THR I 26 32609 39892 25901 -1034 -3197 -6741 C ATOM 8392 OG1 THR I 26 75.021 52.735 51.338 1.00257.03 O ANISOU 8392 OG1 THR I 26 32389 40203 25065 -920 -3199 -6379 O ATOM 8393 CG2 THR I 26 75.803 55.023 51.065 1.00259.47 C ANISOU 8393 CG2 THR I 26 32203 39946 26436 -1055 -3288 -7280 C ATOM 8394 N VAL I 27 71.932 54.928 49.218 1.00263.62 N ANISOU 8394 N VAL I 27 33704 39574 26883 -1239 -3122 -6588 N ATOM 8395 CA VAL I 27 71.186 55.757 48.277 1.00262.22 C ANISOU 8395 CA VAL I 27 33636 38801 27191 -1355 -3072 -6534 C ATOM 8396 C VAL I 27 70.419 56.837 49.043 1.00262.08 C ANISOU 8396 C VAL I 27 33198 38929 27448 -1340 -3167 -7112 C ATOM 8397 O VAL I 27 70.493 57.997 48.670 1.00263.28 O ANISOU 8397 O VAL I 27 33124 38629 28281 -1395 -3131 -7378 O ATOM 8398 CB VAL I 27 70.267 54.918 47.357 1.00257.86 C ANISOU 8398 CB VAL I 27 33607 38025 26342 -1445 -3011 -5912 C ATOM 8399 CG1 VAL I 27 69.448 55.799 46.424 1.00256.28 C ANISOU 8399 CG1 VAL I 27 33462 37298 26614 -1573 -2990 -5803 C ATOM 8400 CG2 VAL I 27 71.105 53.982 46.509 1.00255.15 C ANISOU 8400 CG2 VAL I 27 33669 37448 25828 -1472 -2867 -5437 C ATOM 8401 N GLY I 28 69.729 56.460 50.124 1.00258.91 N ANISOU 8401 N GLY I 28 32666 39153 26553 -1254 -3260 -7306 N ATOM 8402 CA GLY I 28 69.024 57.417 50.996 1.00261.85 C ANISOU 8402 CA GLY I 28 32623 39751 27115 -1215 -3314 -7926 C ATOM 8403 C GLY I 28 69.915 58.561 51.455 1.00270.68 C ANISOU 8403 C GLY I 28 33272 40806 28767 -1219 -3339 -8645 C ATOM 8404 O GLY I 28 69.552 59.729 51.342 1.00270.75 O ANISOU 8404 O GLY I 28 33019 40424 29429 -1263 -3291 -9038 O ATOM 8405 N CYS I 29 71.100 58.211 51.949 1.00279.57 N ANISOU 8405 N CYS I 29 34270 42290 29661 -1182 -3412 -8790 N ATOM 8406 CA CYS I 29 72.111 59.171 52.405 1.00288.69 C ANISOU 8406 CA CYS I 29 34971 43433 31283 -1211 -3472 -9461 C ATOM 8407 C CYS I 29 72.652 60.136 51.314 1.00284.14 C ANISOU 8407 C CYS I 29 34348 41966 31644 -1315 -3365 -9441 C ATOM 8408 O CYS I 29 72.597 61.356 51.473 1.00296.51 O ANISOU 8408 O CYS I 29 35535 43232 33890 -1365 -3351 -10022 O ATOM 8409 CB CYS I 29 73.291 58.427 53.081 1.00292.21 C ANISOU 8409 CB CYS I 29 35308 44485 31233 -1158 -3590 -9460 C ATOM 8410 SG CYS I 29 73.133 57.920 54.816 1.00298.90 S ANISOU 8410 SG CYS I 29 35829 46550 31188 -1048 -3774 -9884 S ATOM 8411 N LEU I 30 73.194 59.601 50.224 1.00265.81 N ANISOU 8411 N LEU I 30 32386 39225 29385 -1343 -3269 -8780 N ATOM 8412 CA LEU I 30 73.912 60.435 49.255 1.00254.37 C ANISOU 8412 CA LEU I 30 30851 37033 28764 -1419 -3161 -8709 C ATOM 8413 C LEU I 30 72.952 61.280 48.417 1.00258.73 C ANISOU 8413 C LEU I 30 31428 36952 29922 -1485 -3046 -8570 C ATOM 8414 O LEU I 30 73.295 62.359 47.928 1.00254.57 O ANISOU 8414 O LEU I 30 30625 35849 30249 -1540 -2967 -8720 O ATOM 8415 CB LEU I 30 74.826 59.578 48.376 1.00238.98 C ANISOU 8415 CB LEU I 30 29266 34887 26647 -1412 -3059 -8052 C ATOM 8416 CG LEU I 30 75.664 58.494 49.073 1.00230.09 C ANISOU 8416 CG LEU I 30 28180 34369 24874 -1329 -3134 -7967 C ATOM 8417 CD1 LEU I 30 76.506 57.733 48.060 1.00223.96 C ANISOU 8417 CD1 LEU I 30 27769 33259 24064 -1317 -2961 -7308 C ATOM 8418 CD2 LEU I 30 76.541 59.053 50.184 1.00230.70 C ANISOU 8418 CD2 LEU I 30 27704 34855 25095 -1321 -3303 -8645 C ATOM 8419 N CYS I 31 71.731 60.780 48.266 1.00269.03 N ANISOU 8419 N CYS I 31 33029 38374 30815 -1480 -3040 -8241 N ATOM 8420 CA CYS I 31 70.676 61.563 47.633 1.00285.63 C ANISOU 8420 CA CYS I 31 35094 39987 33443 -1538 -2958 -8104 C ATOM 8421 C CYS I 31 70.265 62.730 48.526 1.00290.42 C ANISOU 8421 C CYS I 31 35159 40597 34590 -1514 -2969 -8884 C ATOM 8422 O CYS I 31 69.782 63.761 48.034 1.00291.14 O ANISOU 8422 O CYS I 31 35023 40123 35471 -1557 -2862 -8908 O ATOM 8423 CB CYS I 31 69.450 60.700 47.305 1.00296.04 C ANISOU 8423 CB CYS I 31 36836 41472 34172 -1554 -2974 -7560 C ATOM 8424 SG CYS I 31 69.261 60.161 45.584 1.00322.70 S ANISOU 8424 SG CYS I 31 40760 44356 37495 -1677 -2881 -6610 S ATOM 8425 N GLU I 32 70.443 62.567 49.835 1.00296.56 N ANISOU 8425 N GLU I 32 35710 42022 34944 -1446 -3081 -9514 N ATOM 8426 CA GLU I 32 70.241 63.678 50.745 1.00304.01 C ANISOU 8426 CA GLU I 32 36125 43005 36379 -1435 -3076 -10390 C ATOM 8427 C GLU I 32 71.243 64.800 50.517 1.00299.00 C ANISOU 8427 C GLU I 32 35086 41820 36699 -1509 -3030 -10809 C ATOM 8428 O GLU I 32 70.857 65.968 50.598 1.00300.56 O ANISOU 8428 O GLU I 32 34895 41584 37721 -1536 -2925 -11272 O ATOM 8429 CB GLU I 32 70.159 63.227 52.201 1.00314.46 C ANISOU 8429 CB GLU I 32 37300 45243 36937 -1354 -3208 -10970 C ATOM 8430 CG GLU I 32 68.748 62.761 52.529 1.00315.43 C ANISOU 8430 CG GLU I 32 37593 45705 36549 -1277 -3178 -10779 C ATOM 8431 CD GLU I 32 67.714 63.841 52.235 1.00317.44 C ANISOU 8431 CD GLU I 32 37632 45394 37585 -1292 -3016 -10947 C ATOM 8432 OE1 GLU I 32 67.876 64.959 52.772 1.00323.72 O ANISOU 8432 OE1 GLU I 32 37957 46025 39013 -1304 -2952 -11746 O ATOM 8433 OE2 GLU I 32 66.752 63.592 51.477 1.00315.83 O ANISOU 8433 OE2 GLU I 32 37697 44899 37403 -1301 -2950 -10294 O ATOM 8434 N GLU I 33 72.486 64.442 50.182 1.00290.31 N ANISOU 8434 N GLU I 33 34067 40685 35553 -1537 -3082 -10598 N ATOM 8435 CA GLU I 33 73.505 65.409 49.704 1.00288.94 C ANISOU 8435 CA GLU I 33 33556 39887 36340 -1613 -3022 -10780 C ATOM 8436 C GLU I 33 73.004 66.354 48.577 1.00288.92 C ANISOU 8436 C GLU I 33 33468 38989 37318 -1656 -2821 -10417 C ATOM 8437 O GLU I 33 73.172 67.577 48.658 1.00294.68 O ANISOU 8437 O GLU I 33 33704 39224 39035 -1702 -2742 -10910 O ATOM 8438 CB GLU I 33 74.781 64.676 49.265 1.00286.90 C ANISOU 8438 CB GLU I 33 33505 39687 35815 -1615 -3064 -10340 C ATOM 8439 CG GLU I 33 75.545 64.000 50.403 1.00293.11 C ANISOU 8439 CG GLU I 33 34194 41282 35890 -1586 -3264 -10740 C ATOM 8440 CD GLU I 33 77.016 63.770 50.103 1.00298.43 C ANISOU 8440 CD GLU I 33 34818 41865 36705 -1607 -3291 -10534 C ATOM 8441 OE1 GLU I 33 77.525 64.350 49.121 1.00303.30 O ANISOU 8441 OE1 GLU I 33 35381 41762 38095 -1649 -3151 -10245 O ATOM 8442 OE2 GLU I 33 77.660 63.009 50.856 1.00301.58 O ANISOU 8442 OE2 GLU I 33 35200 42930 36454 -1573 -3444 -10621 O ATOM 8443 N VAL I 34 72.393 65.775 47.538 1.00283.84 N ANISOU 8443 N VAL I 34 33279 38159 36407 -1649 -2741 -9547 N ATOM 8444 CA VAL I 34 71.770 66.537 46.425 1.00283.88 C ANISOU 8444 CA VAL I 34 33230 37439 37191 -1689 -2569 -9047 C ATOM 8445 C VAL I 34 70.444 67.293 46.777 1.00285.97 C ANISOU 8445 C VAL I 34 33223 37554 37876 -1674 -2501 -9328 C ATOM 8446 O VAL I 34 70.211 68.409 46.273 1.00290.62 O ANISOU 8446 O VAL I 34 33446 37477 39497 -1700 -2346 -9287 O ATOM 8447 CB VAL I 34 71.607 65.661 45.151 1.00277.46 C ANISOU 8447 CB VAL I 34 32987 36533 35901 -1715 -2523 -8031 C ATOM 8448 CG1 VAL I 34 71.117 66.497 43.975 1.00276.64 C ANISOU 8448 CG1 VAL I 34 32767 35746 36597 -1767 -2363 -7469 C ATOM 8449 CG2 VAL I 34 72.926 64.986 44.783 1.00274.96 C ANISOU 8449 CG2 VAL I 34 32904 36293 35274 -1711 -2525 -7776 C ATOM 8450 N ALA I 35 69.591 66.711 47.628 1.00283.07 N ANISOU 8450 N ALA I 35 32997 37780 36775 -1621 -2589 -9573 N ATOM 8451 CA ALA I 35 68.379 67.400 48.121 1.00287.80 C ANISOU 8451 CA ALA I 35 33308 38299 37744 -1584 -2501 -9922 C ATOM 8452 C ALA I 35 68.766 68.694 48.839 1.00304.93 C ANISOU 8452 C ALA I 35 34841 40162 40857 -1587 -2408 -10871 C ATOM 8453 O ALA I 35 68.118 69.725 48.657 1.00311.52 O ANISOU 8453 O ALA I 35 35309 40435 42616 -1585 -2228 -10984 O ATOM 8454 CB ALA I 35 67.561 66.496 49.034 1.00278.47 C ANISOU 8454 CB ALA I 35 32359 37889 35556 -1510 -2607 -10072 C ATOM 8455 N LEU I 36 69.845 68.621 49.629 1.00321.12 N ANISOU 8455 N LEU I 36 36744 42568 42699 -1604 -2530 -11530 N ATOM 8456 CA LEU I 36 70.463 69.766 50.352 1.00337.98 C ANISOU 8456 CA LEU I 36 38280 44469 45669 -1651 -2488 -12532 C ATOM 8457 C LEU I 36 70.920 70.876 49.395 1.00345.38 C ANISOU 8457 C LEU I 36 38869 44418 47942 -1717 -2316 -12327 C ATOM 8458 O LEU I 36 70.584 72.058 49.548 1.00347.77 O ANISOU 8458 O LEU I 36 38673 44165 49298 -1733 -2140 -12820 O ATOM 8459 CB LEU I 36 71.664 69.292 51.236 1.00338.15 C ANISOU 8459 CB LEU I 36 38259 45139 45081 -1686 -2712 -13105 C ATOM 8460 CG LEU I 36 71.689 69.075 52.786 1.00339.41 C ANISOU 8460 CG LEU I 36 38247 46199 44511 -1670 -2868 -14066 C ATOM 8461 CD1 LEU I 36 71.129 67.743 53.272 1.00334.04 C ANISOU 8461 CD1 LEU I 36 38011 46416 42491 -1567 -2993 -13714 C ATOM 8462 CD2 LEU I 36 73.093 69.257 53.367 1.00341.08 C ANISOU 8462 CD2 LEU I 36 38160 46654 44781 -1770 -3049 -14692 C ATOM 8463 N ASP I 37 71.693 70.445 48.407 1.00348.78 N ANISOU 8463 N ASP I 37 39561 44643 48314 -1745 -2347 -11569 N ATOM 8464 CA ASP I 37 72.357 71.281 47.421 1.00353.50 C ANISOU 8464 CA ASP I 37 39883 44414 50015 -1797 -2203 -11211 C ATOM 8465 C ASP I 37 71.364 72.131 46.577 1.00355.69 C ANISOU 8465 C ASP I 37 39956 43968 51222 -1781 -1967 -10710 C ATOM 8466 O ASP I 37 71.643 73.299 46.273 1.00353.23 O ANISOU 8466 O ASP I 37 39120 42914 52178 -1812 -1796 -10848 O ATOM 8467 CB ASP I 37 73.311 70.346 46.608 1.00351.26 C ANISOU 8467 CB ASP I 37 40040 44269 49151 -1803 -2282 -10447 C ATOM 8468 CG ASP I 37 73.751 70.903 45.246 1.00353.72 C ANISOU 8468 CG ASP I 37 40253 43814 50329 -1826 -2102 -9677 C ATOM 8469 OD1 ASP I 37 74.370 71.992 45.192 1.00356.97 O ANISOU 8469 OD1 ASP I 37 40119 43631 51879 -1867 -1999 -9991 O ATOM 8470 OD2 ASP I 37 73.524 70.211 44.218 1.00354.88 O ANISOU 8470 OD2 ASP I 37 40868 43981 49987 -1809 -2062 -8746 O ATOM 8471 N LYS I 38 70.188 71.580 46.277 1.00357.46 N ANISOU 8471 N LYS I 38 40533 44410 50874 -1735 -1959 -10159 N ATOM 8472 CA LYS I 38 69.328 72.142 45.226 1.00359.39 C ANISOU 8472 CA LYS I 38 40676 44057 51818 -1731 -1776 -9380 C ATOM 8473 C LYS I 38 68.094 72.906 45.702 1.00365.89 C ANISOU 8473 C LYS I 38 41132 44655 53235 -1684 -1624 -9719 C ATOM 8474 O LYS I 38 67.384 73.521 44.901 1.00376.02 O ANISOU 8474 O LYS I 38 42209 45394 55264 -1677 -1455 -9098 O ATOM 8475 CB LYS I 38 68.902 71.030 44.254 1.00348.36 C ANISOU 8475 CB LYS I 38 39920 42967 49474 -1746 -1867 -8330 C ATOM 8476 CG LYS I 38 69.850 70.777 43.080 1.00339.67 C ANISOU 8476 CG LYS I 38 39036 41642 48378 -1792 -1850 -7579 C ATOM 8477 CD LYS I 38 69.496 71.638 41.862 1.00337.65 C ANISOU 8477 CD LYS I 38 38509 40704 49077 -1815 -1659 -6778 C ATOM 8478 CE LYS I 38 69.956 71.030 40.538 1.00329.60 C ANISOU 8478 CE LYS I 38 37910 39700 47621 -1860 -1656 -5792 C ATOM 8479 NZ LYS I 38 69.519 71.832 39.355 1.00329.07 N ANISOU 8479 NZ LYS I 38 37565 39087 48380 -1883 -1486 -4933 N ATOM 8480 N ALA I 39 67.837 72.871 47.001 1.00362.95 N ANISOU 8480 N ALA I 39 40652 44719 52532 -1645 -1668 -10673 N ATOM 8481 CA ALA I 39 66.564 73.377 47.553 1.00357.72 C ANISOU 8481 CA ALA I 39 39730 43985 52199 -1575 -1511 -11003 C ATOM 8482 C ALA I 39 65.284 72.708 46.960 1.00350.03 C ANISOU 8482 C ALA I 39 39137 43210 50648 -1540 -1531 -10079 C ATOM 8483 O ALA I 39 64.245 73.376 46.792 1.00344.31 O ANISOU 8483 O ALA I 39 38113 42084 50624 -1496 -1338 -9888 O ATOM 8484 CB ALA I 39 66.491 74.909 47.479 1.00359.72 C ANISOU 8484 CB ALA I 39 39266 43333 54078 -1574 -1218 -11372 C ATOM 8485 N MET I 40 65.370 71.392 46.691 1.00338.17 N ANISOU 8485 N MET I 40 38263 42320 47905 -1565 -1760 -9542 N ATOM 8486 CA MET I 40 64.233 70.533 46.262 1.00323.36 C ANISOU 8486 CA MET I 40 36814 40773 45272 -1563 -1844 -8763 C ATOM 8487 C MET I 40 64.278 69.078 46.851 1.00319.86 C ANISOU 8487 C MET I 40 36936 41219 43376 -1550 -2079 -8815 C ATOM 8488 O MET I 40 65.297 68.370 46.740 1.00314.86 O ANISOU 8488 O MET I 40 36613 40856 42163 -1587 -2218 -8765 O ATOM 8489 CB MET I 40 64.113 70.558 44.719 1.00305.48 C ANISOU 8489 CB MET I 40 34700 38069 43297 -1651 -1831 -7628 C ATOM 8490 CG MET I 40 62.707 70.645 44.140 1.00288.52 C ANISOU 8490 CG MET I 40 32538 35785 41299 -1665 -1786 -6895 C ATOM 8491 SD MET I 40 62.286 72.173 43.303 1.00275.89 S ANISOU 8491 SD MET I 40 30268 33246 41310 -1662 -1512 -6429 S ATOM 8492 CE MET I 40 61.785 73.160 44.699 1.00287.66 C ANISOU 8492 CE MET I 40 31151 34528 43619 -1523 -1272 -7560 C ATOM 8493 N GLN I 41 63.173 68.661 47.490 1.00317.30 N ANISOU 8493 N GLN I 41 36696 41321 42539 -1485 -2098 -8895 N ATOM 8494 CA GLN I 41 63.075 67.381 48.227 1.00306.87 C ANISOU 8494 CA GLN I 41 35795 40842 39958 -1445 -2281 -8995 C ATOM 8495 C GLN I 41 62.438 66.265 47.419 1.00300.20 C ANISOU 8495 C GLN I 41 35489 40204 38367 -1515 -2423 -8035 C ATOM 8496 O GLN I 41 61.553 66.502 46.610 1.00300.37 O ANISOU 8496 O GLN I 41 35508 39882 38738 -1571 -2381 -7393 O ATOM 8497 CB GLN I 41 62.251 67.538 49.498 1.00305.49 C ANISOU 8497 CB GLN I 41 35373 41081 39617 -1322 -2205 -9674 C ATOM 8498 CG GLN I 41 60.988 68.351 49.297 1.00304.77 C ANISOU 8498 CG GLN I 41 34962 40541 40294 -1283 -2004 -9496 C ATOM 8499 CD GLN I 41 61.189 69.771 49.700 1.00307.66 C ANISOU 8499 CD GLN I 41 34713 40371 41812 -1239 -1759 -10272 C ATOM 8500 OE1 GLN I 41 61.557 70.021 50.834 1.00307.93 O ANISOU 8500 OE1 GLN I 41 34520 40730 41747 -1174 -1714 -11251 O ATOM 8501 NE2 GLN I 41 60.965 70.710 48.784 1.00307.74 N ANISOU 8501 NE2 GLN I 41 34424 39570 42930 -1281 -1596 -9848 N ATOM 8502 N PHE I 42 62.854 65.038 47.701 1.00292.47 N ANISOU 8502 N PHE I 42 34941 39814 36367 -1516 -2590 -7958 N ATOM 8503 CA PHE I 42 62.507 63.904 46.855 1.00284.89 C ANISOU 8503 CA PHE I 42 34528 39002 34715 -1614 -2725 -7105 C ATOM 8504 C PHE I 42 61.400 63.075 47.460 1.00278.15 C ANISOU 8504 C PHE I 42 33846 38675 33160 -1569 -2804 -6977 C ATOM 8505 O PHE I 42 61.313 62.966 48.682 1.00270.07 O ANISOU 8505 O PHE I 42 32653 38138 31823 -1439 -2791 -7573 O ATOM 8506 CB PHE I 42 63.735 63.010 46.625 1.00289.53 C ANISOU 8506 CB PHE I 42 35492 39801 34712 -1651 -2822 -7003 C ATOM 8507 CG PHE I 42 64.721 63.560 45.606 1.00294.66 C ANISOU 8507 CG PHE I 42 36118 39896 35943 -1729 -2753 -6779 C ATOM 8508 CD1 PHE I 42 65.230 64.866 45.724 1.00299.73 C ANISOU 8508 CD1 PHE I 42 36246 40079 37557 -1696 -2623 -7245 C ATOM 8509 CD2 PHE I 42 65.156 62.770 44.527 1.00292.73 C ANISOU 8509 CD2 PHE I 42 36349 39579 35293 -1834 -2796 -6113 C ATOM 8510 CE1 PHE I 42 66.144 65.352 44.783 1.00299.97 C ANISOU 8510 CE1 PHE I 42 36227 39605 38143 -1757 -2547 -6974 C ATOM 8511 CE2 PHE I 42 66.052 63.256 43.586 1.00295.13 C ANISOU 8511 CE2 PHE I 42 36625 39417 36092 -1889 -2706 -5868 C ATOM 8512 CZ PHE I 42 66.551 64.551 43.715 1.00298.16 C ANISOU 8512 CZ PHE I 42 36477 39357 37450 -1844 -2585 -6267 C ATOM 8513 N SER I 43 60.561 62.499 46.598 1.00279.59 N ANISOU 8513 N SER I 43 34347 38786 33095 -1684 -2887 -6192 N ATOM 8514 CA SER I 43 59.591 61.502 47.031 1.00287.20 C ANISOU 8514 CA SER I 43 35542 40242 33337 -1671 -2990 -5942 C ATOM 8515 C SER I 43 60.311 60.189 47.432 1.00289.44 C ANISOU 8515 C SER I 43 36217 41054 32702 -1652 -3104 -5967 C ATOM 8516 O SER I 43 61.393 59.879 46.913 1.00289.91 O ANISOU 8516 O SER I 43 36509 40999 32643 -1710 -3126 -5886 O ATOM 8517 CB SER I 43 58.546 61.252 45.935 1.00289.64 C ANISOU 8517 CB SER I 43 36068 40311 33670 -1840 -3078 -5094 C ATOM 8518 OG SER I 43 59.115 60.551 44.846 1.00290.71 O ANISOU 8518 OG SER I 43 36665 40333 33457 -2010 -3185 -4577 O ATOM 8519 N LYS I 44 59.720 59.450 48.380 1.00289.75 N ANISOU 8519 N LYS I 44 36284 41663 32144 -1554 -3149 -6059 N ATOM 8520 CA LYS I 44 60.298 58.196 48.904 1.00285.44 C ANISOU 8520 CA LYS I 44 36023 41657 30774 -1506 -3233 -6044 C ATOM 8521 C LYS I 44 60.407 57.129 47.801 1.00282.31 C ANISOU 8521 C LYS I 44 36166 41095 30001 -1683 -3333 -5334 C ATOM 8522 O LYS I 44 61.392 56.383 47.754 1.00280.03 O ANISOU 8522 O LYS I 44 36124 40939 29336 -1681 -3347 -5310 O ATOM 8523 CB LYS I 44 59.505 57.689 50.135 1.00282.17 C ANISOU 8523 CB LYS I 44 35461 41892 29855 -1354 -3238 -6206 C ATOM 8524 CG LYS I 44 60.084 56.450 50.831 1.00277.55 C ANISOU 8524 CG LYS I 44 35062 41923 28471 -1271 -3305 -6174 C ATOM 8525 CD LYS I 44 61.389 56.708 51.576 1.00279.43 C ANISOU 8525 CD LYS I 44 35087 42455 28626 -1161 -3282 -6792 C ATOM 8526 CE LYS I 44 61.173 56.964 53.065 1.00284.52 C ANISOU 8526 CE LYS I 44 35319 43791 28994 -968 -3242 -7399 C ATOM 8527 NZ LYS I 44 62.155 56.169 53.828 1.00287.16 N ANISOU 8527 NZ LYS I 44 35652 44750 28705 -876 -3308 -7518 N ATOM 8528 N GLN I 45 59.412 57.089 46.905 1.00275.83 N ANISOU 8528 N GLN I 45 35508 39982 29311 -1841 -3393 -4775 N ATOM 8529 CA GLN I 45 59.444 56.200 45.737 1.00259.59 C ANISOU 8529 CA GLN I 45 33957 37732 26940 -2053 -3487 -4156 C ATOM 8530 C GLN I 45 60.626 56.514 44.801 1.00248.73 C ANISOU 8530 C GLN I 45 32739 35963 25801 -2132 -3425 -4132 C ATOM 8531 O GLN I 45 61.198 55.589 44.252 1.00240.46 O ANISOU 8531 O GLN I 45 32107 34916 24339 -2223 -3439 -3882 O ATOM 8532 CB GLN I 45 58.117 56.203 44.950 1.00259.94 C ANISOU 8532 CB GLN I 45 34090 37583 27090 -2238 -3596 -3580 C ATOM 8533 CG GLN I 45 56.853 56.030 45.779 1.00266.52 C ANISOU 8533 CG GLN I 45 34717 38737 27811 -2161 -3638 -3535 C ATOM 8534 CD GLN I 45 56.211 57.356 46.138 1.00273.94 C ANISOU 8534 CD GLN I 45 35142 39509 29431 -2054 -3537 -3772 C ATOM 8535 OE1 GLN I 45 56.832 58.214 46.769 1.00282.31 O ANISOU 8535 OE1 GLN I 45 35867 40541 30854 -1888 -3393 -4368 O ATOM 8536 NE2 GLN I 45 54.955 57.530 45.739 1.00275.02 N ANISOU 8536 NE2 GLN I 45 35193 39521 29781 -2157 -3606 -3311 N ATOM 8537 N THR I 46 60.978 57.798 44.629 1.00244.18 N ANISOU 8537 N THR I 46 31816 35038 25923 -2092 -3333 -4384 N ATOM 8538 CA THR I 46 62.185 58.208 43.902 1.00235.18 C ANISOU 8538 CA THR I 46 30729 33546 25083 -2126 -3246 -4408 C ATOM 8539 C THR I 46 63.394 57.592 44.533 1.00228.73 C ANISOU 8539 C THR I 46 30005 33002 23898 -2011 -3206 -4763 C ATOM 8540 O THR I 46 64.212 56.982 43.871 1.00223.66 O ANISOU 8540 O THR I 46 29703 32261 23015 -2074 -3171 -4533 O ATOM 8541 CB THR I 46 62.401 59.716 43.976 1.00238.40 C ANISOU 8541 CB THR I 46 30623 33580 26378 -2054 -3135 -4749 C ATOM 8542 OG1 THR I 46 61.461 60.362 43.120 1.00240.92 O ANISOU 8542 OG1 THR I 46 30839 33545 27154 -2173 -3143 -4278 O ATOM 8543 CG2 THR I 46 63.820 60.074 43.553 1.00234.77 C ANISOU 8543 CG2 THR I 46 30146 32844 26211 -2040 -3035 -4891 C ATOM 8544 N ILE I 47 63.486 57.766 45.836 1.00226.61 N ANISOU 8544 N ILE I 47 29408 33107 23584 -1840 -3204 -5322 N ATOM 8545 CA ILE I 47 64.500 57.125 46.614 1.00220.25 C ANISOU 8545 CA ILE I 47 28626 32693 22364 -1724 -3200 -5627 C ATOM 8546 C ILE I 47 64.439 55.599 46.372 1.00215.14 C ANISOU 8546 C ILE I 47 28466 32282 20995 -1777 -3243 -5146 C ATOM 8547 O ILE I 47 65.413 55.018 45.876 1.00213.34 O ANISOU 8547 O ILE I 47 28508 31948 20604 -1805 -3185 -4979 O ATOM 8548 CB ILE I 47 64.340 57.511 48.102 1.00221.87 C ANISOU 8548 CB ILE I 47 28388 33391 22521 -1551 -3217 -6271 C ATOM 8549 CG1 ILE I 47 64.110 59.024 48.269 1.00222.61 C ANISOU 8549 CG1 ILE I 47 28007 33166 23406 -1526 -3147 -6750 C ATOM 8550 CG2 ILE I 47 65.529 57.040 48.920 1.00221.96 C ANISOU 8550 CG2 ILE I 47 28324 33839 22173 -1438 -3233 -6609 C ATOM 8551 CD1 ILE I 47 65.225 59.927 47.771 1.00221.51 C ANISOU 8551 CD1 ILE I 47 27687 32553 23923 -1559 -3073 -6981 C ATOM 8552 N ALA I 48 63.293 54.971 46.677 1.00211.39 N ANISOU 8552 N ALA I 48 28087 32074 20154 -1793 -3321 -4909 N ATOM 8553 CA ALA I 48 63.073 53.522 46.459 1.00207.09 C ANISOU 8553 CA ALA I 48 27970 31702 19012 -1861 -3358 -4448 C ATOM 8554 C ALA I 48 63.378 53.106 45.014 1.00207.90 C ANISOU 8554 C ALA I 48 28541 31344 19106 -2066 -3324 -4003 C ATOM 8555 O ALA I 48 63.942 52.035 44.760 1.00206.30 O ANISOU 8555 O ALA I 48 28679 31168 18535 -2095 -3269 -3797 O ATOM 8556 CB ALA I 48 61.648 53.120 46.845 1.00202.94 C ANISOU 8556 CB ALA I 48 27427 31424 18255 -1881 -3454 -4220 C ATOM 8557 N ALA I 49 63.023 53.976 44.073 1.00212.80 N ANISOU 8557 N ALA I 49 29153 31553 20147 -2201 -3338 -3855 N ATOM 8558 CA ALA I 49 63.257 53.729 42.654 1.00216.92 C ANISOU 8558 CA ALA I 49 30085 31696 20639 -2405 -3306 -3442 C ATOM 8559 C ALA I 49 64.738 53.661 42.303 1.00217.29 C ANISOU 8559 C ALA I 49 30251 31572 20736 -2351 -3145 -3553 C ATOM 8560 O ALA I 49 65.137 52.737 41.600 1.00216.65 O ANISOU 8560 O ALA I 49 30606 31401 20308 -2450 -3073 -3290 O ATOM 8561 CB ALA I 49 62.541 54.758 41.781 1.00218.43 C ANISOU 8561 CB ALA I 49 30154 31556 21283 -2547 -3360 -3201 C ATOM 8562 N ILE I 50 65.540 54.623 42.786 1.00215.94 N ANISOU 8562 N ILE I 50 29685 31343 21017 -2200 -3078 -3953 N ATOM 8563 CA ILE I 50 66.973 54.689 42.429 1.00213.56 C ANISOU 8563 CA ILE I 50 29434 30847 20862 -2146 -2924 -4034 C ATOM 8564 C ILE I 50 67.705 53.463 42.949 1.00220.62 C ANISOU 8564 C ILE I 50 30536 32029 21261 -2053 -2861 -4057 C ATOM 8565 O ILE I 50 68.694 53.024 42.366 1.00222.86 O ANISOU 8565 O ILE I 50 31059 32134 21483 -2057 -2708 -3918 O ATOM 8566 CB ILE I 50 67.691 55.959 42.944 1.00207.66 C ANISOU 8566 CB ILE I 50 28166 29985 20747 -2016 -2887 -4496 C ATOM 8567 CG1 ILE I 50 66.940 57.218 42.509 1.00203.57 C ANISOU 8567 CG1 ILE I 50 27365 29140 20842 -2084 -2916 -4464 C ATOM 8568 CG2 ILE I 50 69.118 56.010 42.410 1.00203.44 C ANISOU 8568 CG2 ILE I 50 27695 29201 20399 -1984 -2729 -4472 C ATOM 8569 CD1 ILE I 50 67.326 58.460 43.276 1.00202.83 C ANISOU 8569 CD1 ILE I 50 26692 28959 21412 -1960 -2895 -5026 C ATOM 8570 N SER I 51 67.190 52.905 44.036 1.00225.71 N ANISOU 8570 N SER I 51 31066 33121 21571 -1962 -2958 -4189 N ATOM 8571 CA SER I 51 67.767 51.722 44.646 1.00225.61 C ANISOU 8571 CA SER I 51 31173 33430 21119 -1858 -2902 -4143 C ATOM 8572 C SER I 51 67.560 50.472 43.791 1.00225.90 C ANISOU 8572 C SER I 51 31754 33295 20782 -1998 -2819 -3680 C ATOM 8573 O SER I 51 68.523 49.803 43.403 1.00226.33 O ANISOU 8573 O SER I 51 32041 33209 20742 -1978 -2646 -3554 O ATOM 8574 CB SER I 51 67.195 51.562 46.049 1.00224.59 C ANISOU 8574 CB SER I 51 30715 33871 20748 -1716 -3025 -4370 C ATOM 8575 OG SER I 51 67.469 52.737 46.799 1.00224.97 O ANISOU 8575 OG SER I 51 30273 34066 21139 -1606 -3080 -4889 O ATOM 8576 N GLU I 52 66.309 50.181 43.465 1.00225.83 N ANISOU 8576 N GLU I 52 31935 33269 20599 -2150 -2931 -3443 N ATOM 8577 CA GLU I 52 66.006 49.067 42.582 1.00226.20 C ANISOU 8577 CA GLU I 52 32496 33125 20325 -2335 -2876 -3066 C ATOM 8578 C GLU I 52 66.660 49.211 41.210 1.00230.68 C ANISOU 8578 C GLU I 52 33407 33251 20988 -2478 -2728 -2927 C ATOM 8579 O GLU I 52 67.021 48.203 40.600 1.00235.03 O ANISOU 8579 O GLU I 52 34369 33646 21283 -2564 -2577 -2747 O ATOM 8580 CB GLU I 52 64.510 48.943 42.390 1.00222.08 C ANISOU 8580 CB GLU I 52 32063 32644 19670 -2510 -3064 -2850 C ATOM 8581 CG GLU I 52 63.749 48.558 43.645 1.00220.68 C ANISOU 8581 CG GLU I 52 31616 32908 19324 -2383 -3176 -2889 C ATOM 8582 CD GLU I 52 62.304 49.021 43.600 1.00221.44 C ANISOU 8582 CD GLU I 52 31600 33045 19489 -2502 -3371 -2763 C ATOM 8583 OE1 GLU I 52 61.836 49.366 42.494 1.00221.01 O ANISOU 8583 OE1 GLU I 52 31755 32680 19539 -2728 -3438 -2558 O ATOM 8584 OE2 GLU I 52 61.636 49.045 44.660 1.00224.25 O ANISOU 8584 OE2 GLU I 52 31643 33770 19790 -2369 -3451 -2841 O ATOM 8585 N LEU I 53 66.787 50.454 40.727 1.00233.53 N ANISOU 8585 N LEU I 53 33582 33412 21735 -2501 -2750 -3003 N ATOM 8586 CA LEU I 53 67.425 50.776 39.427 1.00234.85 C ANISOU 8586 CA LEU I 53 33998 33206 22025 -2614 -2601 -2836 C ATOM 8587 C LEU I 53 68.922 50.409 39.366 1.00241.92 C ANISOU 8587 C LEU I 53 34977 33985 22954 -2474 -2342 -2918 C ATOM 8588 O LEU I 53 69.407 49.866 38.355 1.00240.15 O ANISOU 8588 O LEU I 53 35162 33529 22554 -2573 -2149 -2722 O ATOM 8589 CB LEU I 53 67.228 52.269 39.084 1.00230.37 C ANISOU 8589 CB LEU I 53 33093 32464 21972 -2631 -2674 -2858 C ATOM 8590 CG LEU I 53 68.124 52.988 38.065 1.00228.24 C ANISOU 8590 CG LEU I 53 32841 31855 22023 -2650 -2503 -2736 C ATOM 8591 CD1 LEU I 53 67.503 52.914 36.679 1.00229.76 C ANISOU 8591 CD1 LEU I 53 33396 31903 21998 -2908 -2521 -2309 C ATOM 8592 CD2 LEU I 53 68.379 54.433 38.482 1.00228.34 C ANISOU 8592 CD2 LEU I 53 32287 31745 22723 -2520 -2532 -2962 C ATOM 8593 N THR I 54 69.642 50.727 40.445 1.00252.59 N ANISOU 8593 N THR I 54 35924 35519 24530 -2249 -2335 -3215 N ATOM 8594 CA THR I 54 71.079 50.444 40.542 1.00259.63 C ANISOU 8594 CA THR I 54 36794 36340 25512 -2098 -2115 -3278 C ATOM 8595 C THR I 54 71.277 48.939 40.582 1.00270.85 C ANISOU 8595 C THR I 54 38573 37826 26511 -2090 -1965 -3095 C ATOM 8596 O THR I 54 72.217 48.423 39.988 1.00269.08 O ANISOU 8596 O THR I 54 38592 37372 26272 -2065 -1704 -2970 O ATOM 8597 CB THR I 54 71.724 51.103 41.786 1.00255.13 C ANISOU 8597 CB THR I 54 35663 36035 25239 -1888 -2197 -3652 C ATOM 8598 OG1 THR I 54 71.301 52.475 41.888 1.00250.53 O ANISOU 8598 OG1 THR I 54 34714 35384 25091 -1908 -2346 -3885 O ATOM 8599 CG2 THR I 54 73.259 51.032 41.716 1.00252.05 C ANISOU 8599 CG2 THR I 54 35198 35516 25051 -1758 -1986 -3671 C ATOM 8600 N PHE I 55 70.370 48.262 41.285 1.00284.17 N ANISOU 8600 N PHE I 55 40262 39803 27904 -2102 -2110 -3066 N ATOM 8601 CA PHE I 55 70.293 46.806 41.323 1.00290.70 C ANISOU 8601 CA PHE I 55 41406 40656 28388 -2123 -1985 -2854 C ATOM 8602 C PHE I 55 70.134 46.173 39.915 1.00281.29 C ANISOU 8602 C PHE I 55 40800 39065 27010 -2354 -1818 -2640 C ATOM 8603 O PHE I 55 70.891 45.258 39.560 1.00282.18 O ANISOU 8603 O PHE I 55 41184 38983 27046 -2327 -1538 -2541 O ATOM 8604 CB PHE I 55 69.171 46.365 42.290 1.00299.31 C ANISOU 8604 CB PHE I 55 42341 42128 29256 -2111 -2198 -2827 C ATOM 8605 CG PHE I 55 69.223 44.903 42.655 1.00304.75 C ANISOU 8605 CG PHE I 55 43191 42894 29704 -2067 -2064 -2603 C ATOM 8606 CD1 PHE I 55 70.184 44.426 43.550 1.00302.90 C ANISOU 8606 CD1 PHE I 55 42690 42896 29502 -1828 -1936 -2583 C ATOM 8607 CD2 PHE I 55 68.313 43.996 42.101 1.00310.10 C ANISOU 8607 CD2 PHE I 55 44254 43405 30165 -2273 -2067 -2390 C ATOM 8608 CE1 PHE I 55 70.241 43.077 43.884 1.00305.19 C ANISOU 8608 CE1 PHE I 55 43076 43228 29653 -1773 -1784 -2309 C ATOM 8609 CE2 PHE I 55 68.370 42.646 42.428 1.00312.37 C ANISOU 8609 CE2 PHE I 55 44656 43696 30334 -2233 -1916 -2176 C ATOM 8610 CZ PHE I 55 69.332 42.187 43.322 1.00309.89 C ANISOU 8610 CZ PHE I 55 44055 43593 30096 -1971 -1760 -2113 C ATOM 8611 N ARG I 56 69.168 46.667 39.125 1.00264.51 N ANISOU 8611 N ARG I 56 38846 36838 24817 -2582 -1978 -2573 N ATOM 8612 CA ARG I 56 68.976 46.256 37.710 1.00247.44 C ANISOU 8612 CA ARG I 56 37214 34377 22425 -2841 -1863 -2407 C ATOM 8613 C ARG I 56 70.286 46.497 36.962 1.00235.85 C ANISOU 8613 C ARG I 56 35868 32641 21101 -2766 -1557 -2414 C ATOM 8614 O ARG I 56 70.756 45.641 36.193 1.00228.62 O ANISOU 8614 O ARG I 56 35378 31502 19984 -2843 -1284 -2349 O ATOM 8615 CB ARG I 56 67.840 47.072 37.049 1.00254.09 C ANISOU 8615 CB ARG I 56 38073 35233 23236 -3071 -2126 -2299 C ATOM 8616 CG ARG I 56 67.016 46.339 35.979 1.00262.21 C ANISOU 8616 CG ARG I 56 39605 36162 23860 -3405 -2169 -2123 C ATOM 8617 CD ARG I 56 66.631 47.215 34.790 1.00271.22 C ANISOU 8617 CD ARG I 56 40846 37234 24968 -3621 -2267 -1948 C ATOM 8618 NE ARG I 56 65.254 47.748 34.835 1.00273.32 N ANISOU 8618 NE ARG I 56 40935 37671 25243 -3787 -2619 -1790 N ATOM 8619 CZ ARG I 56 64.936 49.040 34.958 1.00275.43 C ANISOU 8619 CZ ARG I 56 40787 37984 25877 -3726 -2772 -1712 C ATOM 8620 NH1 ARG I 56 65.886 49.963 35.047 1.00282.89 N ANISOU 8620 NH1 ARG I 56 41449 38812 27224 -3519 -2624 -1803 N ATOM 8621 NH2 ARG I 56 63.660 49.412 34.990 1.00270.16 N ANISOU 8621 NH2 ARG I 56 39964 37452 25233 -3875 -3062 -1533 N ATOM 8622 N GLN I 57 70.872 47.661 37.243 1.00228.19 N ANISOU 8622 N GLN I 57 34495 31689 20517 -2609 -1588 -2512 N ATOM 8623 CA GLN I 57 72.072 48.146 36.596 1.00225.35 C ANISOU 8623 CA GLN I 57 34136 31087 20398 -2522 -1333 -2487 C ATOM 8624 C GLN I 57 73.235 47.209 36.825 1.00225.99 C ANISOU 8624 C GLN I 57 34324 31076 20466 -2354 -1015 -2497 C ATOM 8625 O GLN I 57 74.075 47.014 35.948 1.00227.08 O ANISOU 8625 O GLN I 57 34719 30951 20607 -2351 -703 -2401 O ATOM 8626 CB GLN I 57 72.401 49.533 37.139 1.00223.15 C ANISOU 8626 CB GLN I 57 33303 30857 20626 -2377 -1467 -2633 C ATOM 8627 CG GLN I 57 73.141 50.417 36.166 1.00225.90 C ANISOU 8627 CG GLN I 57 33622 30925 21284 -2378 -1299 -2511 C ATOM 8628 CD GLN I 57 72.553 50.410 34.767 1.00228.41 C ANISOU 8628 CD GLN I 57 34354 31111 21319 -2623 -1256 -2229 C ATOM 8629 OE1 GLN I 57 71.335 50.350 34.579 1.00229.24 O ANISOU 8629 OE1 GLN I 57 34584 31340 21177 -2817 -1484 -2146 O ATOM 8630 NE2 GLN I 57 73.427 50.470 33.770 1.00231.81 N ANISOU 8630 NE2 GLN I 57 34984 31324 21768 -2618 -961 -2062 N ATOM 8631 N CYS I 58 73.255 46.612 38.008 1.00227.37 N ANISOU 8631 N CYS I 58 34280 31485 20622 -2209 -1080 -2578 N ATOM 8632 CA CYS I 58 74.331 45.718 38.417 1.00230.49 C ANISOU 8632 CA CYS I 58 34668 31839 21067 -2021 -800 -2529 C ATOM 8633 C CYS I 58 74.364 44.384 37.649 1.00235.21 C ANISOU 8633 C CYS I 58 35810 32163 21394 -2129 -491 -2383 C ATOM 8634 O CYS I 58 75.436 43.775 37.505 1.00236.15 O ANISOU 8634 O CYS I 58 36011 32083 21629 -1994 -138 -2304 O ATOM 8635 CB CYS I 58 74.326 45.526 39.948 1.00229.58 C ANISOU 8635 CB CYS I 58 34093 32136 21000 -1832 -979 -2605 C ATOM 8636 SG CYS I 58 74.745 46.997 40.937 1.00228.66 S ANISOU 8636 SG CYS I 58 33300 32327 21253 -1669 -1242 -2889 S ATOM 8637 N GLU I 59 73.207 43.946 37.146 1.00238.99 N ANISOU 8637 N GLU I 59 36639 32614 21549 -2377 -611 -2361 N ATOM 8638 CA GLU I 59 73.172 42.794 36.266 1.00245.37 C ANISOU 8638 CA GLU I 59 37992 33128 22110 -2536 -327 -2309 C ATOM 8639 C GLU I 59 73.918 43.152 35.005 1.00244.12 C ANISOU 8639 C GLU I 59 38127 32692 21935 -2592 -41 -2307 C ATOM 8640 O GLU I 59 74.789 42.405 34.564 1.00246.82 O ANISOU 8640 O GLU I 59 38717 32761 22298 -2526 371 -2291 O ATOM 8641 CB GLU I 59 71.748 42.332 35.956 1.00254.85 C ANISOU 8641 CB GLU I 59 39480 34377 22974 -2831 -561 -2310 C ATOM 8642 CG GLU I 59 71.709 41.117 35.017 1.00277.21 C ANISOU 8642 CG GLU I 59 42884 36883 25558 -3035 -265 -2341 C ATOM 8643 CD GLU I 59 70.646 40.072 35.390 1.00296.08 C ANISOU 8643 CD GLU I 59 45398 39293 27804 -3197 -404 -2322 C ATOM 8644 OE1 GLU I 59 69.868 40.309 36.347 1.00304.90 O ANISOU 8644 OE1 GLU I 59 46166 40712 28968 -3151 -740 -2244 O ATOM 8645 OE2 GLU I 59 70.586 38.994 34.737 1.00309.54 O ANISOU 8645 OE2 GLU I 59 47537 40701 29372 -3373 -160 -2396 O ATOM 8646 N ASN I 60 73.583 44.311 34.451 1.00239.57 N ANISOU 8646 N ASN I 60 37484 32188 21353 -2698 -239 -2294 N ATOM 8647 CA ASN I 60 74.284 44.829 33.294 1.00236.88 C ANISOU 8647 CA ASN I 60 37335 31654 21015 -2728 10 -2228 C ATOM 8648 C ASN I 60 75.761 45.122 33.559 1.00234.47 C ANISOU 8648 C ASN I 60 36758 31210 21120 -2433 303 -2195 C ATOM 8649 O ASN I 60 76.599 44.856 32.690 1.00235.80 O ANISOU 8649 O ASN I 60 37200 31137 21255 -2406 698 -2133 O ATOM 8650 CB ASN I 60 73.560 46.043 32.740 1.00235.59 C ANISOU 8650 CB ASN I 60 37063 31619 20828 -2888 -282 -2137 C ATOM 8651 CG ASN I 60 72.123 45.730 32.377 1.00234.25 C ANISOU 8651 CG ASN I 60 37163 31593 20246 -3200 -568 -2119 C ATOM 8652 OD1 ASN I 60 71.834 44.715 31.734 1.00232.93 O ANISOU 8652 OD1 ASN I 60 37480 31342 19680 -3401 -435 -2165 O ATOM 8653 ND2 ASN I 60 71.207 46.593 32.805 1.00233.32 N ANISOU 8653 ND2 ASN I 60 36714 31681 20256 -3251 -958 -2067 N ATOM 8654 N PHE I 61 76.084 45.640 34.751 1.00227.08 N ANISOU 8654 N PHE I 61 35280 30444 20553 -2220 119 -2244 N ATOM 8655 CA PHE I 61 77.492 45.812 35.169 1.00220.88 C ANISOU 8655 CA PHE I 61 34179 29568 20176 -1947 355 -2211 C ATOM 8656 C PHE I 61 78.258 44.490 35.227 1.00225.43 C ANISOU 8656 C PHE I 61 34974 29964 20715 -1828 754 -2136 C ATOM 8657 O PHE I 61 79.304 44.367 34.599 1.00225.26 O ANISOU 8657 O PHE I 61 35069 29679 20839 -1727 1146 -2037 O ATOM 8658 CB PHE I 61 77.617 46.532 36.513 1.00211.20 C ANISOU 8658 CB PHE I 61 32327 28632 19286 -1780 41 -2333 C ATOM 8659 CG PHE I 61 77.152 47.956 36.490 1.00205.85 C ANISOU 8659 CG PHE I 61 31343 28038 18832 -1844 -263 -2431 C ATOM 8660 CD1 PHE I 61 77.202 48.707 35.329 1.00206.38 C ANISOU 8660 CD1 PHE I 61 31551 27882 18981 -1948 -168 -2305 C ATOM 8661 CD2 PHE I 61 76.684 48.557 37.650 1.00201.03 C ANISOU 8661 CD2 PHE I 61 30266 27736 18378 -1788 -621 -2639 C ATOM 8662 CE1 PHE I 61 76.775 50.024 35.326 1.00205.19 C ANISOU 8662 CE1 PHE I 61 31062 27764 19137 -1995 -424 -2348 C ATOM 8663 CE2 PHE I 61 76.253 49.871 37.657 1.00199.54 C ANISOU 8663 CE2 PHE I 61 29766 27566 18482 -1840 -863 -2757 C ATOM 8664 CZ PHE I 61 76.308 50.609 36.493 1.00202.34 C ANISOU 8664 CZ PHE I 61 30240 27643 18995 -1939 -761 -2592 C ATOM 8665 N ALA I 62 77.730 43.518 35.973 1.00230.88 N ANISOU 8665 N ALA I 62 35689 30778 21254 -1830 677 -2152 N ATOM 8666 CA ALA I 62 78.289 42.160 36.056 1.00238.91 C ANISOU 8666 CA ALA I 62 36898 31589 22288 -1732 1062 -2048 C ATOM 8667 C ALA I 62 78.498 41.471 34.700 1.00245.58 C ANISOU 8667 C ALA I 62 38347 32023 22937 -1867 1504 -2062 C ATOM 8668 O ALA I 62 79.626 41.109 34.377 1.00253.75 O ANISOU 8668 O ALA I 62 39435 32791 24186 -1706 1945 -1969 O ATOM 8669 CB ALA I 62 77.426 41.301 36.950 1.00238.66 C ANISOU 8669 CB ALA I 62 36807 31753 22117 -1762 871 -2029 C ATOM 8670 N LYS I 63 77.421 41.294 33.925 1.00242.66 N ANISOU 8670 N LYS I 63 38411 31628 22158 -2165 1388 -2185 N ATOM 8671 CA LYS I 63 77.470 40.794 32.524 1.00240.09 C ANISOU 8671 CA LYS I 63 38688 31005 21529 -2359 1749 -2278 C ATOM 8672 C LYS I 63 78.560 41.446 31.663 1.00245.18 C ANISOU 8672 C LYS I 63 39379 31497 22281 -2249 2082 -2205 C ATOM 8673 O LYS I 63 79.360 40.742 31.059 1.00249.12 O ANISOU 8673 O LYS I 63 40163 31688 22801 -2182 2593 -2218 O ATOM 8674 CB LYS I 63 76.141 41.045 31.797 1.00229.74 C ANISOU 8674 CB LYS I 63 37701 29844 19742 -2719 1424 -2393 C ATOM 8675 CG LYS I 63 75.144 39.890 31.707 1.00220.08 C ANISOU 8675 CG LYS I 63 36845 28548 18226 -2972 1376 -2538 C ATOM 8676 CD LYS I 63 74.149 40.162 30.603 1.00215.17 C ANISOU 8676 CD LYS I 63 36618 28040 17096 -3349 1169 -2643 C ATOM 8677 CE LYS I 63 72.921 39.277 30.728 1.00211.92 C ANISOU 8677 CE LYS I 63 36428 27644 16445 -3630 940 -2766 C ATOM 8678 NZ LYS I 63 72.108 39.657 31.913 1.00206.34 N ANISOU 8678 NZ LYS I 63 35267 27219 15914 -3566 467 -2628 N ATOM 8679 N ASP I 64 78.558 42.781 31.586 1.00244.20 N ANISOU 8679 N ASP I 64 38962 31565 22255 -2232 1815 -2119 N ATOM 8680 CA ASP I 64 79.450 43.515 30.686 1.00244.78 C ANISOU 8680 CA ASP I 64 39055 31519 22432 -2155 2093 -1995 C ATOM 8681 C ASP I 64 80.878 43.370 31.090 1.00253.73 C ANISOU 8681 C ASP I 64 39916 32450 24038 -1835 2461 -1873 C ATOM 8682 O ASP I 64 81.740 43.160 30.239 1.00260.38 O ANISOU 8682 O ASP I 64 40991 33050 24891 -1761 2940 -1799 O ATOM 8683 CB ASP I 64 79.108 44.993 30.642 1.00231.60 C ANISOU 8683 CB ASP I 64 37038 30063 20895 -2193 1715 -1892 C ATOM 8684 CG ASP I 64 77.905 45.265 29.816 1.00223.84 C ANISOU 8684 CG ASP I 64 36361 29248 19440 -2512 1466 -1902 C ATOM 8685 OD1 ASP I 64 77.244 44.296 29.414 1.00221.30 O ANISOU 8685 OD1 ASP I 64 36503 28917 18665 -2726 1513 -2041 O ATOM 8686 OD2 ASP I 64 77.605 46.435 29.563 1.00218.74 O ANISOU 8686 OD2 ASP I 64 35470 28737 18902 -2561 1222 -1760 O ATOM 8687 N LEU I 65 81.120 43.499 32.392 1.00257.76 N ANISOU 8687 N LEU I 65 39916 33097 24924 -1649 2233 -1842 N ATOM 8688 CA LEU I 65 82.463 43.350 32.937 1.00260.68 C ANISOU 8688 CA LEU I 65 39939 33336 25769 -1349 2515 -1689 C ATOM 8689 C LEU I 65 83.000 41.912 32.697 1.00268.34 C ANISOU 8689 C LEU I 65 41247 33991 26718 -1268 3049 -1645 C ATOM 8690 O LEU I 65 84.215 41.715 32.467 1.00272.36 O ANISOU 8690 O LEU I 65 41688 34252 27544 -1058 3496 -1480 O ATOM 8691 CB LEU I 65 82.521 43.796 34.418 1.00251.02 C ANISOU 8691 CB LEU I 65 38079 32426 24868 -1204 2103 -1688 C ATOM 8692 CG LEU I 65 82.300 45.283 34.762 1.00241.76 C ANISOU 8692 CG LEU I 65 36467 31489 23901 -1227 1663 -1768 C ATOM 8693 CD1 LEU I 65 81.925 45.459 36.230 1.00235.32 C ANISOU 8693 CD1 LEU I 65 35163 31060 23186 -1165 1223 -1893 C ATOM 8694 CD2 LEU I 65 83.493 46.153 34.394 1.00241.09 C ANISOU 8694 CD2 LEU I 65 36098 31231 24271 -1077 1856 -1629 C ATOM 8695 N GLU I 66 82.087 40.929 32.704 1.00270.59 N ANISOU 8695 N GLU I 66 41883 34251 26677 -1439 3023 -1787 N ATOM 8696 CA GLU I 66 82.427 39.536 32.378 1.00270.96 C ANISOU 8696 CA GLU I 66 42291 33932 26727 -1407 3544 -1802 C ATOM 8697 C GLU I 66 83.066 39.451 31.008 1.00273.14 C ANISOU 8697 C GLU I 66 43010 33891 26876 -1433 4077 -1855 C ATOM 8698 O GLU I 66 84.184 38.960 30.842 1.00277.80 O ANISOU 8698 O GLU I 66 43589 34175 27785 -1215 4605 -1726 O ATOM 8699 CB GLU I 66 81.194 38.626 32.383 1.00268.88 C ANISOU 8699 CB GLU I 66 42382 33661 26116 -1660 3403 -1999 C ATOM 8700 CG GLU I 66 81.501 37.246 31.798 1.00270.79 C ANISOU 8700 CG GLU I 66 43067 33441 26378 -1679 3993 -2097 C ATOM 8701 CD GLU I 66 80.282 36.392 31.541 1.00270.65 C ANISOU 8701 CD GLU I 66 43468 33352 26014 -1989 3885 -2351 C ATOM 8702 OE1 GLU I 66 79.160 36.937 31.606 1.00267.80 O ANISOU 8702 OE1 GLU I 66 43123 33315 25312 -2218 3358 -2442 O ATOM 8703 OE2 GLU I 66 80.462 35.176 31.284 1.00275.69 O ANISOU 8703 OE2 GLU I 66 44391 33584 26774 -2003 4341 -2455 O ATOM 8704 N MET I 67 82.336 39.964 30.036 1.00271.19 N ANISOU 8704 N MET I 67 43126 33759 26155 -1698 3932 -2016 N ATOM 8705 CA MET I 67 82.686 39.819 28.655 1.00274.02 C ANISOU 8705 CA MET I 67 43979 33920 26216 -1788 4398 -2112 C ATOM 8706 C MET I 67 83.925 40.660 28.300 1.00271.23 C ANISOU 8706 C MET I 67 43371 33503 26181 -1540 4680 -1855 C ATOM 8707 O MET I 67 84.616 40.345 27.342 1.00276.05 O ANISOU 8707 O MET I 67 44303 33882 26701 -1491 5235 -1865 O ATOM 8708 CB MET I 67 81.431 40.069 27.811 1.00279.72 C ANISOU 8708 CB MET I 67 45116 34877 26287 -2171 4091 -2320 C ATOM 8709 CG MET I 67 80.254 39.216 28.339 1.00284.17 C ANISOU 8709 CG MET I 67 45835 35478 26657 -2392 3788 -2533 C ATOM 8710 SD MET I 67 78.559 39.343 27.763 1.00293.09 S ANISOU 8710 SD MET I 67 47324 36916 27118 -2862 3278 -2745 S ATOM 8711 CE MET I 67 77.997 40.961 28.254 1.00288.93 C ANISOU 8711 CE MET I 67 46278 36826 26673 -2854 2624 -2490 C ATOM 8712 N PHE I 68 84.204 41.694 29.114 1.00262.35 N ANISOU 8712 N PHE I 68 41650 32574 25454 -1385 4311 -1643 N ATOM 8713 CA PHE I 68 85.480 42.467 29.089 1.00258.99 C ANISOU 8713 CA PHE I 68 40827 32057 25517 -1115 4530 -1363 C ATOM 8714 C PHE I 68 86.704 41.663 29.596 1.00262.57 C ANISOU 8714 C PHE I 68 41084 32215 26464 -813 4994 -1202 C ATOM 8715 O PHE I 68 87.764 41.673 28.961 1.00262.83 O ANISOU 8715 O PHE I 68 41151 32004 26708 -640 5505 -1032 O ATOM 8716 CB PHE I 68 85.430 43.770 29.943 1.00252.19 C ANISOU 8716 CB PHE I 68 39331 31468 25021 -1054 3977 -1246 C ATOM 8717 CG PHE I 68 84.357 44.776 29.564 1.00249.90 C ANISOU 8717 CG PHE I 68 39070 31441 24437 -1296 3517 -1314 C ATOM 8718 CD1 PHE I 68 83.931 44.936 28.257 1.00250.69 C ANISOU 8718 CD1 PHE I 68 39623 31558 24067 -1492 3664 -1309 C ATOM 8719 CD2 PHE I 68 83.818 45.617 30.542 1.00248.09 C ANISOU 8719 CD2 PHE I 68 38361 31466 24433 -1316 2946 -1361 C ATOM 8720 CE1 PHE I 68 82.956 45.876 27.947 1.00249.84 C ANISOU 8720 CE1 PHE I 68 39471 31708 23747 -1703 3234 -1288 C ATOM 8721 CE2 PHE I 68 82.845 46.554 30.239 1.00247.35 C ANISOU 8721 CE2 PHE I 68 38239 31574 24167 -1516 2552 -1388 C ATOM 8722 CZ PHE I 68 82.416 46.687 28.935 1.00247.99 C ANISOU 8722 CZ PHE I 68 38750 31660 23815 -1707 2692 -1315 C ATOM 8723 N ALA I 69 86.577 41.022 30.761 1.00267.47 N ANISOU 8723 N ALA I 69 41445 32884 27295 -735 4815 -1198 N ATOM 8724 CA ALA I 69 87.691 40.286 31.373 1.00279.42 C ANISOU 8724 CA ALA I 69 42671 34172 29322 -444 5195 -962 C ATOM 8725 C ALA I 69 87.976 38.965 30.653 1.00293.51 C ANISOU 8725 C ALA I 69 44960 35518 31042 -420 5875 -1028 C ATOM 8726 O ALA I 69 89.141 38.582 30.515 1.00304.59 O ANISOU 8726 O ALA I 69 46255 36617 32858 -171 6411 -804 O ATOM 8727 CB ALA I 69 87.420 40.038 32.839 1.00274.25 C ANISOU 8727 CB ALA I 69 41546 33783 28871 -375 4775 -887 C ATOM 8728 N ARG I 70 86.895 38.281 30.233 1.00299.85 N ANISOU 8728 N ARG I 70 46282 36282 31366 -684 5844 -1346 N ATOM 8729 CA ARG I 70 86.884 37.147 29.250 1.00305.33 C ANISOU 8729 CA ARG I 70 47602 36566 31844 -776 6457 -1586 C ATOM 8730 C ARG I 70 87.620 37.469 27.939 1.00319.35 C ANISOU 8730 C ARG I 70 49702 38166 33470 -739 6983 -1613 C ATOM 8731 O ARG I 70 88.293 36.597 27.346 1.00325.45 O ANISOU 8731 O ARG I 70 50768 38525 34363 -632 7680 -1676 O ATOM 8732 CB ARG I 70 85.424 36.701 28.919 1.00291.04 C ANISOU 8732 CB ARG I 70 46276 34856 29451 -1154 6169 -1976 C ATOM 8733 CG ARG I 70 85.048 36.682 27.423 1.00278.79 C ANISOU 8733 CG ARG I 70 45392 33251 27283 -1423 6424 -2317 C ATOM 8734 CD ARG I 70 83.740 35.965 27.114 1.00270.79 C ANISOU 8734 CD ARG I 70 44856 32258 25774 -1799 6230 -2716 C ATOM 8735 NE ARG I 70 83.692 34.616 27.694 1.00267.79 N ANISOU 8735 NE ARG I 70 44509 31498 25741 -1754 6490 -2805 N ATOM 8736 CZ ARG I 70 84.503 33.596 27.396 1.00268.60 C ANISOU 8736 CZ ARG I 70 44793 31090 26174 -1602 7209 -2877 C ATOM 8737 NH1 ARG I 70 85.493 33.712 26.516 1.00269.48 N ANISOU 8737 NH1 ARG I 70 45093 31005 26290 -1462 7789 -2889 N ATOM 8738 NH2 ARG I 70 84.329 32.430 28.006 1.00268.05 N ANISOU 8738 NH2 ARG I 70 44681 30682 26482 -1575 7379 -2907 N ATOM 8739 N HIS I 71 87.456 38.724 27.506 1.00330.29 N ANISOU 8739 N HIS I 71 51013 39870 34611 -823 6658 -1553 N ATOM 8740 CA HIS I 71 87.952 39.253 26.223 1.00347.27 C ANISOU 8740 CA HIS I 71 53441 41994 36512 -825 7040 -1529 C ATOM 8741 C HIS I 71 89.483 39.553 26.227 1.00351.40 C ANISOU 8741 C HIS I 71 53590 42289 37635 -456 7509 -1149 C ATOM 8742 O HIS I 71 90.144 39.545 25.162 1.00351.48 O ANISOU 8742 O HIS I 71 53876 42139 37529 -381 8080 -1115 O ATOM 8743 CB HIS I 71 87.080 40.474 25.856 1.00354.62 C ANISOU 8743 CB HIS I 71 54357 43363 37019 -1062 6465 -1533 C ATOM 8744 CG HIS I 71 87.714 41.418 24.892 1.00362.62 C ANISOU 8744 CG HIS I 71 55350 44451 37977 -988 6697 -1303 C ATOM 8745 ND1 HIS I 71 87.822 41.148 23.546 1.00368.44 N ANISOU 8745 ND1 HIS I 71 56627 45158 38203 -1085 7191 -1424 N ATOM 8746 CD2 HIS I 71 88.269 42.636 25.083 1.00362.65 C ANISOU 8746 CD2 HIS I 71 54835 44568 38387 -829 6507 -951 C ATOM 8747 CE1 HIS I 71 88.417 42.162 22.947 1.00368.60 C ANISOU 8747 CE1 HIS I 71 56451 45295 38305 -971 7302 -1097 C ATOM 8748 NE2 HIS I 71 88.695 43.080 23.856 1.00365.85 N ANISOU 8748 NE2 HIS I 71 55454 45001 38549 -818 6892 -803 N ATOM 8749 N ALA I 72 90.023 39.766 27.435 1.00353.25 N ANISOU 8749 N ALA I 72 53192 42536 38488 -234 7271 -867 N ATOM 8750 CA ALA I 72 91.443 40.075 27.668 1.00359.24 C ANISOU 8750 CA ALA I 72 53475 43115 39903 104 7598 -465 C ATOM 8751 C ALA I 72 92.314 38.874 28.157 1.00366.59 C ANISOU 8751 C ALA I 72 54288 43657 41341 363 8131 -304 C ATOM 8752 O ALA I 72 93.440 39.082 28.616 1.00373.86 O ANISOU 8752 O ALA I 72 54701 44474 42872 643 8298 79 O ATOM 8753 CB ALA I 72 91.559 41.266 28.628 1.00351.60 C ANISOU 8753 CB ALA I 72 51819 42463 39309 162 6963 -245 C ATOM 8754 N LYS I 73 91.798 37.638 28.047 1.00365.77 N ANISOU 8754 N LYS I 73 54618 43325 41033 264 8399 -574 N ATOM 8755 CA LYS I 73 92.500 36.377 28.444 1.00357.98 C ANISOU 8755 CA LYS I 73 53550 41904 40559 493 8959 -424 C ATOM 8756 C LYS I 73 93.029 36.368 29.905 1.00353.34 C ANISOU 8756 C LYS I 73 52203 41442 40606 722 8657 10 C ATOM 8757 O LYS I 73 94.141 35.888 30.187 1.00347.99 O ANISOU 8757 O LYS I 73 51199 40481 40539 1017 9120 381 O ATOM 8758 CB LYS I 73 93.597 35.998 27.414 1.00350.35 C ANISOU 8758 CB LYS I 73 52832 40492 39793 698 9853 -348 C ATOM 8759 CG LYS I 73 93.135 35.929 25.947 1.00334.65 C ANISOU 8759 CG LYS I 73 51600 38442 37109 473 10206 -794 C ATOM 8760 CD LYS I 73 94.239 35.523 24.967 1.00323.34 C ANISOU 8760 CD LYS I 73 50402 36595 35857 697 11138 -737 C ATOM 8761 CE LYS I 73 95.143 36.687 24.574 1.00315.26 C ANISOU 8761 CE LYS I 73 49063 35726 34994 887 11205 -343 C ATOM 8762 NZ LYS I 73 94.423 37.789 23.876 1.00304.29 N ANISOU 8762 NZ LYS I 73 47883 34794 32937 633 10763 -482 N ATOM 8763 N ARG I 74 92.206 36.910 30.813 1.00349.43 N ANISOU 8763 N ARG I 74 51423 41408 39935 576 7881 -35 N ATOM 8764 CA ARG I 74 92.504 37.052 32.268 1.00347.08 C ANISOU 8764 CA ARG I 74 50397 41410 40068 732 7445 307 C ATOM 8765 C ARG I 74 91.213 36.849 33.144 1.00349.82 C ANISOU 8765 C ARG I 74 50714 42120 40078 527 6821 114 C ATOM 8766 O ARG I 74 90.078 36.863 32.595 1.00356.69 O ANISOU 8766 O ARG I 74 52089 43039 40395 246 6634 -279 O ATOM 8767 CB ARG I 74 93.180 38.424 32.583 1.00334.49 C ANISOU 8767 CB ARG I 74 48254 40118 38716 825 7081 518 C ATOM 8768 CG ARG I 74 94.582 38.708 32.023 1.00324.77 C ANISOU 8768 CG ARG I 74 46837 38593 37967 1074 7611 844 C ATOM 8769 CD ARG I 74 95.019 40.152 32.326 1.00318.92 C ANISOU 8769 CD ARG I 74 45570 38160 37444 1093 7148 974 C ATOM 8770 NE ARG I 74 94.427 41.180 31.434 1.00319.51 N ANISOU 8770 NE ARG I 74 45956 38329 37114 890 6952 708 N ATOM 8771 CZ ARG I 74 93.401 41.992 31.738 1.00318.43 C ANISOU 8771 CZ ARG I 74 45785 38562 36639 658 6289 436 C ATOM 8772 NH1 ARG I 74 92.816 41.916 32.922 1.00316.03 N ANISOU 8772 NH1 ARG I 74 45180 38599 36297 593 5747 340 N ATOM 8773 NH2 ARG I 74 92.942 42.885 30.860 1.00320.73 N ANISOU 8773 NH2 ARG I 74 46324 38902 36636 498 6182 287 N ATOM 8774 N THR I 75 91.394 36.644 34.473 1.00344.01 N ANISOU 8774 N THR I 75 49381 41664 39660 666 6518 417 N ATOM 8775 CA THR I 75 90.285 36.590 35.507 1.00322.82 C ANISOU 8775 CA THR I 75 46520 39436 36698 522 5885 319 C ATOM 8776 C THR I 75 90.328 37.617 36.687 1.00307.80 C ANISOU 8776 C THR I 75 43947 38161 34839 557 5193 426 C ATOM 8777 O THR I 75 89.352 37.695 37.435 1.00304.72 O ANISOU 8777 O THR I 75 43455 38175 34149 428 4682 290 O ATOM 8778 CB THR I 75 89.997 35.167 36.115 1.00320.70 C ANISOU 8778 CB THR I 75 46227 39024 36601 587 6094 508 C ATOM 8779 OG1 THR I 75 91.072 34.759 36.971 1.00325.12 O ANISOU 8779 OG1 THR I 75 46169 39622 37738 887 6274 1044 O ATOM 8780 CG2 THR I 75 89.714 34.099 35.036 1.00316.50 C ANISOU 8780 CG2 THR I 75 46378 37873 36003 490 6715 274 C ATOM 8781 N THR I 76 91.418 38.385 36.841 1.00290.77 N ANISOU 8781 N THR I 76 41342 36085 33052 718 5186 638 N ATOM 8782 CA THR I 76 91.461 39.544 37.777 1.00270.41 C ANISOU 8782 CA THR I 76 38178 34068 30497 698 4530 601 C ATOM 8783 C THR I 76 91.321 40.910 37.082 1.00267.75 C ANISOU 8783 C THR I 76 37951 33737 30044 554 4303 301 C ATOM 8784 O THR I 76 92.309 41.429 36.560 1.00269.03 O ANISOU 8784 O THR I 76 37983 33675 30559 664 4558 452 O ATOM 8785 CB THR I 76 92.759 39.571 38.581 1.00263.14 C ANISOU 8785 CB THR I 76 36559 33302 30118 944 4569 1038 C ATOM 8786 OG1 THR I 76 93.864 39.672 37.678 1.00260.68 O ANISOU 8786 OG1 THR I 76 36319 32520 30207 1087 5109 1237 O ATOM 8787 CG2 THR I 76 92.861 38.320 39.379 1.00258.76 C ANISOU 8787 CG2 THR I 76 35788 32823 29703 1091 4730 1410 C ATOM 8788 N ILE I 77 90.098 41.475 37.103 1.00262.59 N ANISOU 8788 N ILE I 77 37495 33333 28945 320 3838 -71 N ATOM 8789 CA ILE I 77 89.688 42.704 36.347 1.00258.76 C ANISOU 8789 CA ILE I 77 37178 32826 28313 150 3628 -346 C ATOM 8790 C ILE I 77 90.408 43.976 36.848 1.00266.09 C ANISOU 8790 C ILE I 77 37481 33961 29657 213 3305 -328 C ATOM 8791 O ILE I 77 90.616 44.135 38.049 1.00275.40 O ANISOU 8791 O ILE I 77 38113 35533 30993 274 2941 -311 O ATOM 8792 CB ILE I 77 88.133 42.919 36.383 1.00248.87 C ANISOU 8792 CB ILE I 77 36221 31811 26527 -109 3190 -699 C ATOM 8793 CG1 ILE I 77 87.369 41.676 35.916 1.00245.57 C ANISOU 8793 CG1 ILE I 77 36392 31189 25723 -211 3460 -751 C ATOM 8794 CG2 ILE I 77 87.704 44.109 35.535 1.00244.60 C ANISOU 8794 CG2 ILE I 77 35841 31219 25877 -275 3025 -896 C ATOM 8795 CD1 ILE I 77 85.888 41.737 36.182 1.00242.63 C ANISOU 8795 CD1 ILE I 77 36205 31092 24889 -444 3004 -1023 C ATOM 8796 N ASN I 78 90.786 44.869 35.927 1.00269.61 N ANISOU 8796 N ASN I 78 37992 34159 30286 191 3442 -329 N ATOM 8797 CA ASN I 78 91.501 46.124 36.263 1.00270.77 C ANISOU 8797 CA ASN I 78 37549 34401 30929 234 3180 -318 C ATOM 8798 C ASN I 78 90.775 47.391 35.772 1.00265.68 C ANISOU 8798 C ASN I 78 36948 33767 30229 46 2869 -578 C ATOM 8799 O ASN I 78 89.663 47.307 35.246 1.00264.55 O ANISOU 8799 O ASN I 78 37271 33628 29615 -123 2803 -752 O ATOM 8800 CB ASN I 78 92.978 46.082 35.783 1.00278.91 C ANISOU 8800 CB ASN I 78 38388 35091 32492 449 3672 68 C ATOM 8801 CG ASN I 78 93.119 45.984 34.261 1.00286.00 C ANISOU 8801 CG ASN I 78 39835 35543 33285 459 4234 198 C ATOM 8802 OD1 ASN I 78 92.343 46.582 33.521 1.00290.58 O ANISOU 8802 OD1 ASN I 78 40729 36097 33580 290 4134 20 O ATOM 8803 ND2 ASN I 78 94.115 45.222 33.793 1.00292.20 N ANISOU 8803 ND2 ASN I 78 40721 36004 34297 662 4842 527 N ATOM 8804 N THR I 79 91.419 48.547 35.933 1.00261.74 N ANISOU 8804 N THR I 79 35934 33254 30259 74 2689 -576 N ATOM 8805 CA THR I 79 90.819 49.855 35.627 1.00259.58 C ANISOU 8805 CA THR I 79 35550 32972 30105 -82 2376 -792 C ATOM 8806 C THR I 79 90.297 50.037 34.211 1.00263.45 C ANISOU 8806 C THR I 79 36574 33189 30334 -177 2656 -683 C ATOM 8807 O THR I 79 89.345 50.765 34.015 1.00262.92 O ANISOU 8807 O THR I 79 36561 33197 30137 -345 2364 -865 O ATOM 8808 CB THR I 79 91.808 51.008 35.846 1.00257.32 C ANISOU 8808 CB THR I 79 34616 32584 30568 -18 2263 -742 C ATOM 8809 OG1 THR I 79 93.102 50.601 35.390 1.00255.48 O ANISOU 8809 OG1 THR I 79 34325 32072 30673 178 2748 -333 O ATOM 8810 CG2 THR I 79 91.879 51.412 37.312 1.00257.14 C ANISOU 8810 CG2 THR I 79 33978 32957 30763 -47 1734 -1059 C ATOM 8811 N GLU I 80 90.924 49.397 33.228 1.00271.48 N ANISOU 8811 N GLU I 80 37959 33914 31274 -69 3228 -377 N ATOM 8812 CA GLU I 80 90.623 49.674 31.811 1.00278.72 C ANISOU 8812 CA GLU I 80 39320 34625 31952 -147 3528 -229 C ATOM 8813 C GLU I 80 89.292 49.095 31.315 1.00273.30 C ANISOU 8813 C GLU I 80 39265 34068 30508 -357 3469 -419 C ATOM 8814 O GLU I 80 88.564 49.768 30.585 1.00271.35 O ANISOU 8814 O GLU I 80 39181 33854 30063 -515 3353 -416 O ATOM 8815 CB GLU I 80 91.771 49.226 30.894 1.00293.35 C ANISOU 8815 CB GLU I 80 41347 36156 33953 42 4195 135 C ATOM 8816 CG GLU I 80 93.184 49.438 31.437 1.00307.05 C ANISOU 8816 CG GLU I 80 42496 37750 36417 270 4327 375 C ATOM 8817 CD GLU I 80 93.532 50.890 31.741 1.00312.64 C ANISOU 8817 CD GLU I 80 42554 38449 37786 257 3980 401 C ATOM 8818 OE1 GLU I 80 94.153 51.118 32.798 1.00315.88 O ANISOU 8818 OE1 GLU I 80 42391 38953 38676 326 3718 345 O ATOM 8819 OE2 GLU I 80 93.202 51.793 30.933 1.00316.16 O ANISOU 8819 OE2 GLU I 80 43032 38799 38294 171 3973 486 O ATOM 8820 N ASP I 81 89.001 47.845 31.697 1.00269.89 N ANISOU 8820 N ASP I 81 39150 33700 29694 -359 3556 -543 N ATOM 8821 CA ASP I 81 87.679 47.217 31.520 1.00264.27 C ANISOU 8821 CA ASP I 81 38950 33138 28322 -576 3402 -775 C ATOM 8822 C ASP I 81 86.589 48.123 32.153 1.00259.96 C ANISOU 8822 C ASP I 81 38139 32888 27745 -747 2763 -1001 C ATOM 8823 O ASP I 81 85.524 48.335 31.578 1.00260.20 O ANISOU 8823 O ASP I 81 38481 33007 27376 -956 2601 -1083 O ATOM 8824 CB ASP I 81 87.650 45.788 32.146 1.00261.84 C ANISOU 8824 CB ASP I 81 38836 32835 27814 -519 3545 -851 C ATOM 8825 CG ASP I 81 88.653 44.783 31.489 1.00262.50 C ANISOU 8825 CG ASP I 81 39215 32566 27956 -350 4243 -651 C ATOM 8826 OD1 ASP I 81 88.992 44.945 30.295 1.00261.71 O ANISOU 8826 OD1 ASP I 81 39423 32261 27753 -353 4642 -543 O ATOM 8827 OD2 ASP I 81 89.077 43.803 32.164 1.00260.62 O ANISOU 8827 OD2 ASP I 81 38894 32266 27864 -209 4414 -588 O ATOM 8828 N VAL I 82 86.884 48.671 33.332 1.00256.30 N ANISOU 8828 N VAL I 82 37077 32586 27717 -659 2415 -1102 N ATOM 8829 CA VAL I 82 85.974 49.557 34.073 1.00251.35 C ANISOU 8829 CA VAL I 82 36125 32227 27149 -786 1848 -1366 C ATOM 8830 C VAL I 82 85.746 50.945 33.440 1.00250.26 C ANISOU 8830 C VAL I 82 35796 31980 27309 -876 1712 -1321 C ATOM 8831 O VAL I 82 84.598 51.378 33.290 1.00246.11 O ANISOU 8831 O VAL I 82 35375 31574 26560 -1054 1428 -1438 O ATOM 8832 CB VAL I 82 86.451 49.749 35.524 1.00252.56 C ANISOU 8832 CB VAL I 82 35671 32621 27667 -669 1542 -1535 C ATOM 8833 CG1 VAL I 82 85.433 50.575 36.289 1.00252.24 C ANISOU 8833 CG1 VAL I 82 35344 32867 27625 -802 1004 -1875 C ATOM 8834 CG2 VAL I 82 86.663 48.405 36.216 1.00250.46 C ANISOU 8834 CG2 VAL I 82 35509 32504 27149 -566 1661 -1490 C ATOM 8835 N LYS I 83 86.832 51.648 33.098 1.00251.31 N ANISOU 8835 N LYS I 83 35603 31880 28003 -748 1915 -1114 N ATOM 8836 CA LYS I 83 86.757 52.937 32.384 1.00251.80 C ANISOU 8836 CA LYS I 83 35448 31775 28447 -807 1872 -966 C ATOM 8837 C LYS I 83 85.975 52.768 31.097 1.00261.30 C ANISOU 8837 C LYS I 83 37214 32959 29109 -954 2051 -762 C ATOM 8838 O LYS I 83 85.289 53.690 30.653 1.00259.68 O ANISOU 8838 O LYS I 83 36908 32759 28999 -1079 1864 -683 O ATOM 8839 CB LYS I 83 88.149 53.484 32.048 1.00245.51 C ANISOU 8839 CB LYS I 83 34286 30690 28304 -630 2174 -681 C ATOM 8840 CG LYS I 83 88.976 53.869 33.258 1.00240.93 C ANISOU 8840 CG LYS I 83 33059 30141 28343 -518 1949 -871 C ATOM 8841 CD LYS I 83 89.811 55.105 32.990 1.00240.14 C ANISOU 8841 CD LYS I 83 32411 29754 29075 -454 1993 -692 C ATOM 8842 CE LYS I 83 91.230 54.757 32.589 1.00242.87 C ANISOU 8842 CE LYS I 83 32680 29867 29732 -253 2451 -323 C ATOM 8843 NZ LYS I 83 92.032 56.000 32.439 1.00247.37 N ANISOU 8843 NZ LYS I 83 32640 30152 31194 -200 2450 -153 N ATOM 8844 N LEU I 84 86.098 51.578 30.502 1.00276.61 N ANISOU 8844 N LEU I 84 39721 34880 30498 -945 2424 -676 N ATOM 8845 CA LEU I 84 85.287 51.172 29.351 1.00291.61 C ANISOU 8845 CA LEU I 84 42228 36844 31725 -1126 2574 -576 C ATOM 8846 C LEU I 84 83.783 50.937 29.667 1.00291.87 C ANISOU 8846 C LEU I 84 42489 37140 31266 -1362 2150 -828 C ATOM 8847 O LEU I 84 82.964 51.042 28.754 1.00297.42 O ANISOU 8847 O LEU I 84 43525 37945 31534 -1557 2124 -718 O ATOM 8848 CB LEU I 84 85.905 49.965 28.634 1.00299.31 C ANISOU 8848 CB LEU I 84 43733 37693 32298 -1056 3130 -489 C ATOM 8849 CG LEU I 84 85.526 49.797 27.170 1.00305.60 C ANISOU 8849 CG LEU I 84 45076 38528 32508 -1206 3421 -321 C ATOM 8850 CD1 LEU I 84 86.339 50.735 26.288 1.00308.50 C ANISOU 8850 CD1 LEU I 84 45219 38772 33224 -1089 3709 86 C ATOM 8851 CD2 LEU I 84 85.750 48.346 26.803 1.00307.38 C ANISOU 8851 CD2 LEU I 84 45884 38667 32237 -1199 3860 -461 C ATOM 8852 N LEU I 85 83.416 50.634 30.923 1.00284.38 N ANISOU 8852 N LEU I 85 41342 36337 30371 -1350 1821 -1126 N ATOM 8853 CA LEU I 85 81.989 50.443 31.303 1.00272.90 C ANISOU 8853 CA LEU I 85 40047 35132 28509 -1555 1419 -1339 C ATOM 8854 C LEU I 85 81.162 51.753 31.424 1.00269.18 C ANISOU 8854 C LEU I 85 39205 34755 28314 -1665 1009 -1349 C ATOM 8855 O LEU I 85 79.977 51.777 31.081 1.00263.49 O ANISOU 8855 O LEU I 85 38712 34184 27218 -1871 793 -1344 O ATOM 8856 CB LEU I 85 81.828 49.526 32.539 1.00264.30 C ANISOU 8856 CB LEU I 85 38916 34202 27303 -1497 1264 -1602 C ATOM 8857 CG LEU I 85 80.423 48.927 32.770 1.00257.27 C ANISOU 8857 CG LEU I 85 38328 33535 25887 -1700 979 -1766 C ATOM 8858 CD1 LEU I 85 79.844 48.254 31.525 1.00256.07 C ANISOU 8858 CD1 LEU I 85 38824 33324 25147 -1910 1183 -1668 C ATOM 8859 CD2 LEU I 85 80.385 47.979 33.955 1.00250.77 C ANISOU 8859 CD2 LEU I 85 37429 32868 24985 -1610 890 -1936 C ATOM 8860 N ALA I 86 81.793 52.832 31.879 1.00268.19 N ANISOU 8860 N ALA I 86 38495 34518 28886 -1535 918 -1355 N ATOM 8861 CA ALA I 86 81.180 54.157 31.827 1.00269.19 C ANISOU 8861 CA ALA I 86 38233 34621 29423 -1617 635 -1319 C ATOM 8862 C ALA I 86 81.574 54.926 30.537 1.00275.43 C ANISOU 8862 C ALA I 86 39002 35202 30447 -1623 895 -875 C ATOM 8863 O ALA I 86 81.871 56.126 30.588 1.00280.03 O ANISOU 8863 O ALA I 86 39058 35603 31738 -1565 825 -780 O ATOM 8864 CB ALA I 86 81.563 54.946 33.067 1.00265.35 C ANISOU 8864 CB ALA I 86 37093 34118 29610 -1500 380 -1631 C ATOM 8865 N ARG I 87 81.570 54.234 29.385 1.00277.97 N ANISOU 8865 N ARG I 87 39877 35557 30181 -1696 1204 -607 N ATOM 8866 CA ARG I 87 82.101 54.769 28.082 1.00283.06 C ANISOU 8866 CA ARG I 87 40556 36074 30917 -1674 1539 -133 C ATOM 8867 C ARG I 87 81.167 55.724 27.339 1.00293.46 C ANISOU 8867 C ARG I 87 41757 37483 32259 -1841 1352 190 C ATOM 8868 O ARG I 87 81.590 56.501 26.457 1.00297.97 O ANISOU 8868 O ARG I 87 42138 37952 33125 -1797 1557 637 O ATOM 8869 CB ARG I 87 82.490 53.613 27.123 1.00274.10 C ANISOU 8869 CB ARG I 87 40075 34991 29076 -1690 1983 -16 C ATOM 8870 CG ARG I 87 81.368 53.024 26.252 1.00263.91 C ANISOU 8870 CG ARG I 87 39372 33979 26923 -1959 1933 28 C ATOM 8871 CD ARG I 87 81.659 51.608 25.779 1.00255.75 C ANISOU 8871 CD ARG I 87 38990 32971 25212 -1988 2307 -124 C ATOM 8872 NE ARG I 87 81.209 50.671 26.789 1.00245.04 N ANISOU 8872 NE ARG I 87 37780 31642 23680 -2023 2108 -536 N ATOM 8873 CZ ARG I 87 79.988 50.172 26.854 1.00239.74 C ANISOU 8873 CZ ARG I 87 37409 31180 22499 -2264 1814 -715 C ATOM 8874 NH1 ARG I 87 79.082 50.487 25.942 1.00241.03 N ANISOU 8874 NH1 ARG I 87 37781 31567 22232 -2510 1670 -531 N ATOM 8875 NH2 ARG I 87 79.676 49.347 27.830 1.00233.60 N ANISOU 8875 NH2 ARG I 87 36696 30410 21649 -2260 1664 -1036 N ATOM 8876 N ARG I 88 79.898 55.643 27.725 1.00300.42 N ANISOU 8876 N ARG I 88 42721 38566 32857 -2022 970 7 N ATOM 8877 CA ARG I 88 78.765 55.992 26.870 1.00311.73 C ANISOU 8877 CA ARG I 88 44296 40207 33939 -2249 806 321 C ATOM 8878 C ARG I 88 78.466 57.485 26.764 1.00332.90 C ANISOU 8878 C ARG I 88 46361 42760 37365 -2240 635 640 C ATOM 8879 O ARG I 88 78.440 58.017 25.640 1.00335.78 O ANISOU 8879 O ARG I 88 46701 43175 37703 -2294 780 1173 O ATOM 8880 CB ARG I 88 77.548 55.185 27.303 1.00293.33 C ANISOU 8880 CB ARG I 88 42318 38132 31001 -2449 491 24 C ATOM 8881 CG ARG I 88 77.904 53.727 27.429 1.00275.22 C ANISOU 8881 CG ARG I 88 40572 35891 28106 -2444 697 -272 C ATOM 8882 CD ARG I 88 77.175 53.071 28.562 1.00261.18 C ANISOU 8882 CD ARG I 88 38845 34220 26169 -2492 391 -686 C ATOM 8883 NE ARG I 88 76.930 51.682 28.219 1.00255.96 N ANISOU 8883 NE ARG I 88 38819 33674 24760 -2625 528 -826 N ATOM 8884 CZ ARG I 88 75.975 51.273 27.391 1.00257.41 C ANISOU 8884 CZ ARG I 88 39428 34067 24307 -2901 437 -726 C ATOM 8885 NH1 ARG I 88 75.154 52.146 26.811 1.00253.06 N ANISOU 8885 NH1 ARG I 88 38725 33675 23748 -3065 199 -418 N ATOM 8886 NH2 ARG I 88 75.840 49.979 27.144 1.00261.23 N ANISOU 8886 NH2 ARG I 88 40466 34598 24191 -3023 585 -927 N ATOM 8887 N SER I 89 78.217 58.141 27.912 1.00356.35 N ANISOU 8887 N SER I 89 48826 45580 40988 -2176 345 325 N ATOM 8888 CA SER I 89 78.259 59.621 28.008 1.00378.69 C ANISOU 8888 CA SER I 89 50954 48138 44792 -2106 261 527 C ATOM 8889 C SER I 89 79.696 60.065 28.239 1.00392.96 C ANISOU 8889 C SER I 89 52382 49615 47309 -1883 513 494 C ATOM 8890 O SER I 89 80.405 59.523 29.096 1.00399.62 O ANISOU 8890 O SER I 89 53239 50418 48178 -1767 537 64 O ATOM 8891 CB SER I 89 77.289 60.224 29.053 1.00376.63 C ANISOU 8891 CB SER I 89 50297 47846 44956 -2154 -131 182 C ATOM 8892 OG SER I 89 77.704 60.087 30.403 1.00367.33 O ANISOU 8892 OG SER I 89 48902 46598 44069 -2034 -252 -434 O ATOM 8893 N ASN I 90 80.126 61.034 27.447 1.00402.71 N ANISOU 8893 N ASN I 90 53255 50631 49123 -1826 701 1004 N ATOM 8894 CA ASN I 90 81.532 61.382 27.429 1.00399.65 C ANISOU 8894 CA ASN I 90 52553 49938 49357 -1626 991 1090 C ATOM 8895 C ASN I 90 81.967 62.273 28.651 1.00392.87 C ANISOU 8895 C ASN I 90 50990 48733 49548 -1522 798 645 C ATOM 8896 O ASN I 90 83.172 62.316 28.983 1.00401.09 O ANISOU 8896 O ASN I 90 51798 49563 51032 -1371 962 527 O ATOM 8897 CB ASN I 90 81.947 61.908 26.021 1.00400.81 C ANISOU 8897 CB ASN I 90 52637 50024 49627 -1590 1334 1860 C ATOM 8898 CG ASN I 90 81.445 61.021 24.866 1.00393.57 C ANISOU 8898 CG ASN I 90 52422 49532 47581 -1729 1490 2202 C ATOM 8899 OD1 ASN I 90 80.419 61.319 24.249 1.00389.54 O ANISOU 8899 OD1 ASN I 90 51964 49244 46798 -1897 1338 2544 O ATOM 8900 ND2 ASN I 90 82.187 59.949 24.554 1.00386.79 N ANISOU 8900 ND2 ASN I 90 52079 48787 46095 -1666 1804 2114 N ATOM 8901 N SER I 91 80.992 62.924 29.329 1.00370.69 N ANISOU 8901 N SER I 91 47857 45887 47099 -1613 458 368 N ATOM 8902 CA SER I 91 81.188 63.699 30.625 1.00344.41 C ANISOU 8902 CA SER I 91 43907 42304 44648 -1558 227 -225 C ATOM 8903 C SER I 91 81.712 62.780 31.745 1.00330.92 C ANISOU 8903 C SER I 91 42379 40800 42553 -1500 123 -851 C ATOM 8904 O SER I 91 82.572 63.143 32.579 1.00321.91 O ANISOU 8904 O SER I 91 40802 39491 42017 -1411 77 -1237 O ATOM 8905 CB SER I 91 79.894 64.449 31.066 1.00338.04 C ANISOU 8905 CB SER I 91 42803 41463 44172 -1670 -72 -405 C ATOM 8906 OG SER I 91 78.851 63.597 31.538 1.00323.65 O ANISOU 8906 OG SER I 91 41426 40039 41507 -1777 -309 -705 O ATOM 8907 N LEU I 92 81.186 61.568 31.694 1.00324.12 N ANISOU 8907 N LEU I 92 42154 40320 40676 -1563 93 -898 N ATOM 8908 CA LEU I 92 81.506 60.499 32.584 1.00322.47 C ANISOU 8908 CA LEU I 92 42207 40371 39945 -1517 25 -1340 C ATOM 8909 C LEU I 92 82.907 59.881 32.345 1.00323.75 C ANISOU 8909 C LEU I 92 42496 40460 40053 -1370 347 -1193 C ATOM 8910 O LEU I 92 83.623 59.673 33.303 1.00331.75 O ANISOU 8910 O LEU I 92 43286 41512 41251 -1279 276 -1560 O ATOM 8911 CB LEU I 92 80.421 59.456 32.405 1.00318.06 C ANISOU 8911 CB LEU I 92 42269 40169 38409 -1644 -68 -1325 C ATOM 8912 CG LEU I 92 79.642 58.934 33.581 1.00313.41 C ANISOU 8912 CG LEU I 92 41741 39883 37455 -1690 -384 -1836 C ATOM 8913 CD1 LEU I 92 79.034 57.675 33.021 1.00307.10 C ANISOU 8913 CD1 LEU I 92 41643 39345 35694 -1794 -316 -1651 C ATOM 8914 CD2 LEU I 92 80.590 58.634 34.725 1.00319.19 C ANISOU 8914 CD2 LEU I 92 42231 40691 38355 -1552 -423 -2269 C ATOM 8915 N LEU I 93 83.292 59.581 31.098 1.00314.32 N ANISOU 8915 N LEU I 93 41641 39193 38592 -1347 704 -658 N ATOM 8916 CA LEU I 93 84.610 58.975 30.787 1.00297.36 C ANISOU 8916 CA LEU I 93 39627 36952 36403 -1191 1074 -478 C ATOM 8917 C LEU I 93 85.768 59.941 31.112 1.00299.01 C ANISOU 8917 C LEU I 93 39157 36819 37632 -1056 1132 -467 C ATOM 8918 O LEU I 93 86.831 59.539 31.593 1.00299.33 O ANISOU 8918 O LEU I 93 39082 36820 37827 -928 1246 -582 O ATOM 8919 CB LEU I 93 84.649 58.497 29.321 1.00281.59 C ANISOU 8919 CB LEU I 93 38154 34987 33850 -1208 1464 65 C ATOM 8920 CG LEU I 93 85.818 57.675 28.753 1.00268.97 C ANISOU 8920 CG LEU I 93 36858 33325 32012 -1057 1939 298 C ATOM 8921 CD1 LEU I 93 86.301 56.614 29.730 1.00260.17 C ANISOU 8921 CD1 LEU I 93 35884 32305 30662 -971 1929 -94 C ATOM 8922 CD2 LEU I 93 85.454 57.052 27.411 1.00263.69 C ANISOU 8922 CD2 LEU I 93 36825 32819 30545 -1139 2250 667 C ATOM 8923 N LYS I 94 85.521 61.223 30.859 1.00296.22 N ANISOU 8923 N LYS I 94 38323 36209 38015 -1095 1045 -313 N ATOM 8924 CA LYS I 94 86.361 62.338 31.284 1.00290.14 C ANISOU 8924 CA LYS I 94 36814 35070 38357 -1019 1009 -396 C ATOM 8925 C LYS I 94 86.493 62.410 32.836 1.00292.27 C ANISOU 8925 C LYS I 94 36714 35430 38902 -1034 644 -1140 C ATOM 8926 O LYS I 94 87.619 62.505 33.373 1.00297.37 O ANISOU 8926 O LYS I 94 36999 35962 40024 -945 668 -1299 O ATOM 8927 CB LYS I 94 85.731 63.601 30.694 1.00280.98 C ANISOU 8927 CB LYS I 94 35271 33636 37850 -1089 970 -87 C ATOM 8928 CG LYS I 94 86.512 64.895 30.777 1.00273.46 C ANISOU 8928 CG LYS I 94 33538 32195 38167 -1025 1013 -7 C ATOM 8929 CD LYS I 94 86.001 65.834 29.705 1.00270.43 C ANISOU 8929 CD LYS I 94 32943 31575 38231 -1053 1153 625 C ATOM 8930 CE LYS I 94 85.640 67.205 30.258 1.00269.99 C ANISOU 8930 CE LYS I 94 32141 31118 39324 -1110 931 377 C ATOM 8931 NZ LYS I 94 84.271 67.230 30.854 1.00265.68 N ANISOU 8931 NZ LYS I 94 31701 30769 38474 -1247 599 -43 N ATOM 8932 N TYR I 95 85.355 62.360 33.542 1.00290.52 N ANISOU 8932 N TYR I 95 36570 35452 38361 -1151 310 -1575 N ATOM 8933 CA TYR I 95 85.299 62.280 35.032 1.00288.10 C ANISOU 8933 CA TYR I 95 36003 35379 38081 -1176 -41 -2302 C ATOM 8934 C TYR I 95 86.115 61.098 35.567 1.00282.12 C ANISOU 8934 C TYR I 95 35486 34921 36784 -1082 14 -2412 C ATOM 8935 O TYR I 95 86.911 61.244 36.505 1.00283.62 O ANISOU 8935 O TYR I 95 35255 35168 37339 -1042 -129 -2776 O ATOM 8936 CB TYR I 95 83.838 62.124 35.498 1.00289.11 C ANISOU 8936 CB TYR I 95 36346 35798 37705 -1295 -323 -2614 C ATOM 8937 CG TYR I 95 83.540 62.206 37.009 1.00290.24 C ANISOU 8937 CG TYR I 95 36189 36227 37861 -1330 -690 -3370 C ATOM 8938 CD1 TYR I 95 83.878 61.171 37.903 1.00286.60 C ANISOU 8938 CD1 TYR I 95 35899 36204 36790 -1282 -795 -3659 C ATOM 8939 CD2 TYR I 95 82.847 63.307 37.525 1.00294.59 C ANISOU 8939 CD2 TYR I 95 36281 36637 39013 -1410 -911 -3774 C ATOM 8940 CE1 TYR I 95 83.561 61.266 39.274 1.00286.17 C ANISOU 8940 CE1 TYR I 95 35555 36499 36675 -1316 -1131 -4322 C ATOM 8941 CE2 TYR I 95 82.535 63.410 38.879 1.00293.14 C ANISOU 8941 CE2 TYR I 95 35830 36756 38791 -1445 -1220 -4499 C ATOM 8942 CZ TYR I 95 82.883 62.405 39.753 1.00288.61 C ANISOU 8942 CZ TYR I 95 35426 36681 37551 -1402 -1340 -4771 C ATOM 8943 OH TYR I 95 82.535 62.586 41.078 1.00286.83 O ANISOU 8943 OH TYR I 95 34901 36814 37264 -1439 -1645 -5475 O ATOM 8944 N ILE I 96 85.905 59.940 34.939 1.00271.63 N ANISOU 8944 N ILE I 96 34814 33779 34614 -1057 229 -2081 N ATOM 8945 CA ILE I 96 86.508 58.668 35.328 1.00258.68 C ANISOU 8945 CA ILE I 96 33476 32399 32409 -964 339 -2102 C ATOM 8946 C ILE I 96 88.034 58.707 35.252 1.00265.08 C ANISOU 8946 C ILE I 96 33991 33000 33726 -817 581 -1897 C ATOM 8947 O ILE I 96 88.704 58.298 36.207 1.00263.94 O ANISOU 8947 O ILE I 96 33623 33057 33605 -754 467 -2142 O ATOM 8948 CB ILE I 96 85.933 57.495 34.487 1.00247.17 C ANISOU 8948 CB ILE I 96 32786 31079 30049 -986 579 -1780 C ATOM 8949 CG1 ILE I 96 84.452 57.267 34.797 1.00240.11 C ANISOU 8949 CG1 ILE I 96 32159 30462 28608 -1135 286 -2023 C ATOM 8950 CG2 ILE I 96 86.667 56.205 34.769 1.00241.02 C ANISOU 8950 CG2 ILE I 96 32282 30458 28836 -867 781 -1732 C ATOM 8951 CD1 ILE I 96 84.123 57.270 36.274 1.00236.70 C ANISOU 8951 CD1 ILE I 96 31414 30345 28174 -1149 -101 -2578 C ATOM 8952 N THR I 97 88.566 59.216 34.133 1.00271.38 N ANISOU 8952 N THR I 97 34751 33424 34935 -764 908 -1416 N ATOM 8953 CA THR I 97 90.015 59.350 33.953 1.00275.61 C ANISOU 8953 CA THR I 97 34968 33710 36038 -617 1172 -1150 C ATOM 8954 C THR I 97 90.649 60.170 35.078 1.00279.35 C ANISOU 8954 C THR I 97 34694 34137 37310 -633 848 -1576 C ATOM 8955 O THR I 97 91.598 59.702 35.661 1.00278.68 O ANISOU 8955 O THR I 97 34429 34160 37295 -547 862 -1627 O ATOM 8956 CB THR I 97 90.437 59.874 32.560 1.00276.10 C ANISOU 8956 CB THR I 97 35055 33395 36453 -551 1582 -530 C ATOM 8957 OG1 THR I 97 89.909 61.185 32.347 1.00275.52 O ANISOU 8957 OG1 THR I 97 34577 33081 37023 -647 1413 -526 O ATOM 8958 CG2 THR I 97 89.928 58.958 31.478 1.00273.74 C ANISOU 8958 CG2 THR I 97 35511 33222 35276 -548 1912 -164 C ATOM 8959 N ASP I 98 90.101 61.345 35.416 1.00283.36 N ANISOU 8959 N ASP I 98 34762 34504 38396 -754 553 -1904 N ATOM 8960 CA ASP I 98 90.575 62.169 36.562 1.00284.37 C ANISOU 8960 CA ASP I 98 34174 34611 39260 -816 204 -2459 C ATOM 8961 C ASP I 98 90.718 61.353 37.823 1.00275.21 C ANISOU 8961 C ASP I 98 33014 33973 37580 -821 -69 -2916 C ATOM 8962 O ASP I 98 91.734 61.400 38.521 1.00271.06 O ANISOU 8962 O ASP I 98 32051 33525 37412 -796 -179 -3084 O ATOM 8963 CB ASP I 98 89.584 63.294 36.876 1.00296.96 C ANISOU 8963 CB ASP I 98 35449 36074 41306 -963 -84 -2883 C ATOM 8964 CG ASP I 98 89.800 64.513 36.022 1.00311.65 C ANISOU 8964 CG ASP I 98 36911 37351 44150 -967 91 -2545 C ATOM 8965 OD1 ASP I 98 90.436 64.371 34.958 1.00321.03 O ANISOU 8965 OD1 ASP I 98 38242 38302 45432 -855 471 -1880 O ATOM 8966 OD2 ASP I 98 89.283 65.590 36.365 1.00319.00 O ANISOU 8966 OD2 ASP I 98 37399 38059 45746 -1074 -116 -2908 O ATOM 8967 N LYS I 99 89.649 60.622 38.102 1.00269.24 N ANISOU 8967 N LYS I 99 32724 33593 35980 -862 -190 -3084 N ATOM 8968 CA LYS I 99 89.524 59.819 39.293 1.00267.54 C ANISOU 8968 CA LYS I 99 32541 33936 35175 -868 -457 -3476 C ATOM 8969 C LYS I 99 90.378 58.542 39.256 1.00265.88 C ANISOU 8969 C LYS I 99 32597 33911 34512 -722 -214 -3092 C ATOM 8970 O LYS I 99 90.828 58.044 40.302 1.00270.35 O ANISOU 8970 O LYS I 99 32938 34890 34889 -695 -412 -3312 O ATOM 8971 CB LYS I 99 88.043 59.534 39.545 1.00263.92 C ANISOU 8971 CB LYS I 99 32453 33768 34054 -956 -643 -3727 C ATOM 8972 CG LYS I 99 87.360 60.546 40.481 1.00264.78 C ANISOU 8972 CG LYS I 99 32105 33994 34502 -1087 -1041 -4405 C ATOM 8973 CD LYS I 99 87.289 61.994 39.963 1.00263.67 C ANISOU 8973 CD LYS I 99 31560 33305 35318 -1160 -1023 -4463 C ATOM 8974 CE LYS I 99 86.683 63.018 40.918 1.00263.62 C ANISOU 8974 CE LYS I 99 31061 33351 35749 -1285 -1368 -5200 C ATOM 8975 NZ LYS I 99 87.332 63.198 42.240 1.00264.13 N ANISOU 8975 NZ LYS I 99 30618 33765 35971 -1331 -1675 -5848 N ATOM 8976 N SER I 100 90.616 58.016 38.057 1.00261.84 N ANISOU 8976 N SER I 100 32539 33110 33837 -624 230 -2510 N ATOM 8977 CA SER I 100 91.587 56.930 37.873 1.00262.09 C ANISOU 8977 CA SER I 100 32765 33175 33641 -462 559 -2104 C ATOM 8978 C SER I 100 93.041 57.413 38.079 1.00271.73 C ANISOU 8978 C SER I 100 33387 34211 35645 -381 612 -1979 C ATOM 8979 O SER I 100 93.924 56.638 38.460 1.00267.80 O ANISOU 8979 O SER I 100 32805 33870 35074 -263 723 -1790 O ATOM 8980 CB SER I 100 91.441 56.329 36.482 1.00258.20 C ANISOU 8980 CB SER I 100 32909 32404 32788 -392 1052 -1583 C ATOM 8981 OG SER I 100 92.037 57.192 35.534 1.00260.24 O ANISOU 8981 OG SER I 100 32977 32216 33685 -353 1305 -1250 O ATOM 8982 N GLU I 101 93.295 58.695 37.828 1.00289.12 N ANISOU 8982 N GLU I 101 35136 36063 38650 -444 538 -2051 N ATOM 8983 CA GLU I 101 94.637 59.253 38.023 1.00312.39 C ANISOU 8983 CA GLU I 101 37462 38802 42429 -395 555 -1951 C ATOM 8984 C GLU I 101 94.959 59.514 39.509 1.00318.04 C ANISOU 8984 C GLU I 101 37584 39922 43334 -498 52 -2532 C ATOM 8985 O GLU I 101 96.088 59.257 39.962 1.00318.15 O ANISOU 8985 O GLU I 101 37231 40042 43609 -435 43 -2405 O ATOM 8986 CB GLU I 101 94.840 60.477 37.121 1.00332.40 C ANISOU 8986 CB GLU I 101 39717 40768 45811 -416 712 -1738 C ATOM 8987 CG GLU I 101 94.988 60.116 35.629 1.00351.21 C ANISOU 8987 CG GLU I 101 42588 42820 48036 -272 1283 -1024 C ATOM 8988 CD GLU I 101 94.729 61.296 34.658 1.00365.52 C ANISOU 8988 CD GLU I 101 44233 44170 50477 -310 1416 -774 C ATOM 8989 OE1 GLU I 101 94.673 62.467 35.110 1.00375.27 O ANISOU 8989 OE1 GLU I 101 44877 45211 52495 -428 1116 -1108 O ATOM 8990 OE2 GLU I 101 94.585 61.065 33.425 1.00368.82 O ANISOU 8990 OE2 GLU I 101 45087 44422 50626 -225 1836 -232 O ATOM 8991 N GLU I 102 93.954 59.977 40.263 1.00324.69 N ANISOU 8991 N GLU I 102 38337 41029 43999 -657 -355 -3154 N ATOM 8992 CA GLU I 102 93.980 59.960 41.747 1.00335.61 C ANISOU 8992 CA GLU I 102 39312 42991 45213 -760 -837 -3764 C ATOM 8993 C GLU I 102 94.314 58.531 42.320 1.00332.25 C ANISOU 8993 C GLU I 102 39105 43109 44026 -641 -806 -3526 C ATOM 8994 O GLU I 102 95.047 58.414 43.328 1.00338.09 O ANISOU 8994 O GLU I 102 39367 44265 44824 -666 -1077 -3711 O ATOM 8995 CB GLU I 102 92.658 60.540 42.319 1.00344.56 C ANISOU 8995 CB GLU I 102 40455 44326 46135 -917 -1180 -4421 C ATOM 8996 CG GLU I 102 92.527 60.627 43.849 1.00351.79 C ANISOU 8996 CG GLU I 102 40961 45894 46809 -1038 -1675 -5137 C ATOM 8997 CD GLU I 102 91.128 61.036 44.328 1.00349.16 C ANISOU 8997 CD GLU I 102 40736 45765 46160 -1154 -1923 -5721 C ATOM 8998 OE1 GLU I 102 90.635 60.428 45.301 1.00344.49 O ANISOU 8998 OE1 GLU I 102 40211 45833 44846 -1168 -2166 -6026 O ATOM 8999 OE2 GLU I 102 90.489 61.972 43.783 1.00347.11 O ANISOU 8999 OE2 GLU I 102 40462 45037 46384 -1224 -1873 -5865 O ATOM 9000 N ILE I 103 93.769 57.476 41.677 1.00317.97 N ANISOU 9000 N ILE I 103 37979 41293 41541 -526 -483 -3113 N ATOM 9001 CA ILE I 103 94.066 56.043 41.969 1.00299.94 C ANISOU 9001 CA ILE I 103 35963 39365 38634 -385 -325 -2757 C ATOM 9002 C ILE I 103 95.539 55.728 41.798 1.00302.23 C ANISOU 9002 C ILE I 103 35966 39497 39367 -243 -70 -2275 C ATOM 9003 O ILE I 103 96.094 55.016 42.634 1.00306.28 O ANISOU 9003 O ILE I 103 36244 40448 39679 -182 -179 -2178 O ATOM 9004 CB ILE I 103 93.179 55.068 41.145 1.00283.28 C ANISOU 9004 CB ILE I 103 34650 37141 35839 -314 17 -2443 C ATOM 9005 CG1 ILE I 103 91.812 54.967 41.819 1.00270.35 C ANISOU 9005 CG1 ILE I 103 33201 35923 33596 -432 -324 -2894 C ATOM 9006 CG2 ILE I 103 93.822 53.697 40.967 1.00281.21 C ANISOU 9006 CG2 ILE I 103 34659 36923 35265 -129 396 -1909 C ATOM 9007 CD1 ILE I 103 90.867 54.057 41.115 1.00255.03 C ANISOU 9007 CD1 ILE I 103 31988 33904 31006 -407 -64 -2653 C ATOM 9008 N ALA I 104 96.144 56.277 40.738 1.00300.44 N ANISOU 9008 N ALA I 104 35724 38675 39754 -189 266 -1942 N ATOM 9009 CA ALA I 104 97.589 56.224 40.503 1.00305.33 C ANISOU 9009 CA ALA I 104 35984 39061 40966 -60 516 -1486 C ATOM 9010 C ALA I 104 98.372 56.938 41.620 1.00316.20 C ANISOU 9010 C ALA I 104 36533 40718 42890 -177 45 -1834 C ATOM 9011 O ALA I 104 99.500 56.543 41.942 1.00321.88 O ANISOU 9011 O ALA I 104 36891 41546 43862 -86 102 -1507 O ATOM 9012 CB ALA I 104 97.922 56.824 39.146 1.00301.92 C ANISOU 9012 CB ALA I 104 35677 37959 41078 6 945 -1100 C ATOM 9013 N GLN I 105 97.775 57.980 42.208 1.00326.25 N ANISOU 9013 N GLN I 105 37493 42110 44357 -385 -410 -2504 N ATOM 9014 CA GLN I 105 98.346 58.659 43.390 1.00341.17 C ANISOU 9014 CA GLN I 105 38617 44360 46649 -549 -924 -3007 C ATOM 9015 C GLN I 105 98.149 57.899 44.723 1.00349.25 C ANISOU 9015 C GLN I 105 39520 46240 46936 -589 -1306 -3286 C ATOM 9016 O GLN I 105 99.034 57.940 45.592 1.00358.06 O ANISOU 9016 O GLN I 105 40044 47754 48248 -648 -1598 -3373 O ATOM 9017 CB GLN I 105 97.823 60.079 43.502 1.00343.38 C ANISOU 9017 CB GLN I 105 38581 44400 47486 -758 -1222 -3661 C ATOM 9018 CG GLN I 105 97.964 60.888 42.227 1.00343.89 C ANISOU 9018 CG GLN I 105 38693 43654 48313 -719 -864 -3339 C ATOM 9019 CD GLN I 105 97.409 62.285 42.413 1.00348.85 C ANISOU 9019 CD GLN I 105 38952 44025 49570 -924 -1153 -3980 C ATOM 9020 OE1 GLN I 105 97.485 62.860 43.500 1.00356.95 O ANISOU 9020 OE1 GLN I 105 39452 45363 50808 -1109 -1614 -4669 O ATOM 9021 NE2 GLN I 105 96.795 62.821 41.365 1.00347.77 N ANISOU 9021 NE2 GLN I 105 39087 43341 49707 -896 -877 -3770 N ATOM 9022 N ALA I 106 97.007 57.209 44.868 1.00348.98 N ANISOU 9022 N ALA I 106 40017 46511 46067 -561 -1305 -3384 N ATOM 9023 CA ALA I 106 96.805 56.187 45.921 1.00352.77 C ANISOU 9023 CA ALA I 106 40502 47773 45762 -526 -1518 -3396 C ATOM 9024 C ALA I 106 97.747 54.966 45.750 1.00367.04 C ANISOU 9024 C ALA I 106 42369 49629 47461 -310 -1172 -2612 C ATOM 9025 O ALA I 106 98.106 54.313 46.751 1.00372.74 O ANISOU 9025 O ALA I 106 42778 51007 47838 -286 -1395 -2522 O ATOM 9026 CB ALA I 106 95.349 55.744 45.975 1.00337.08 C ANISOU 9026 CB ALA I 106 39078 45992 43003 -533 -1537 -3606 C ATOM 9027 N ASN I 107 98.124 54.671 44.489 1.00377.21 N ANISOU 9027 N ASN I 107 44039 50241 49041 -151 -615 -2042 N ATOM 9028 CA ASN I 107 99.239 53.738 44.116 1.00378.52 C ANISOU 9028 CA ASN I 107 44191 50244 49383 67 -184 -1285 C ATOM 9029 C ASN I 107 100.637 54.125 44.697 1.00388.54 C ANISOU 9029 C ASN I 107 44660 51666 51299 47 -384 -1144 C ATOM 9030 O ASN I 107 101.358 53.253 45.215 1.00397.90 O ANISOU 9030 O ASN I 107 45603 53200 52379 166 -339 -701 O ATOM 9031 CB ASN I 107 99.361 53.548 42.579 1.00361.56 C ANISOU 9031 CB ASN I 107 42591 47320 47464 222 468 -803 C ATOM 9032 CG ASN I 107 98.133 52.906 41.935 1.00346.03 C ANISOU 9032 CG ASN I 107 41433 45228 44815 253 723 -815 C ATOM 9033 OD1 ASN I 107 97.134 52.590 42.592 1.00343.64 O ANISOU 9033 OD1 ASN I 107 41305 45362 43898 169 434 -1151 O ATOM 9034 ND2 ASN I 107 98.207 52.722 40.625 1.00332.92 N ANISOU 9034 ND2 ASN I 107 40254 42984 43255 365 1269 -444 N ATOM 9035 N LEU I 108 101.008 55.415 44.597 1.00383.79 N ANISOU 9035 N LEU I 108 43627 50790 51405 -106 -598 -1487 N ATOM 9036 CA LEU I 108 102.249 55.977 45.206 1.00374.80 C ANISOU 9036 CA LEU I 108 41665 49802 50939 -193 -888 -1488 C ATOM 9037 C LEU I 108 102.346 55.712 46.716 1.00381.82 C ANISOU 9037 C LEU I 108 42054 51630 51391 -321 -1458 -1801 C ATOM 9038 O LEU I 108 103.446 55.471 47.249 1.00384.11 O ANISOU 9038 O LEU I 108 41779 52222 51942 -306 -1582 -1476 O ATOM 9039 CB LEU I 108 102.365 57.484 44.950 1.00361.37 C ANISOU 9039 CB LEU I 108 39593 47663 50046 -386 -1089 -1964 C ATOM 9040 CG LEU I 108 102.315 57.976 43.507 1.00350.60 C ANISOU 9040 CG LEU I 108 38582 45424 49206 -287 -587 -1657 C ATOM 9041 CD1 LEU I 108 102.343 59.489 43.494 1.00346.29 C ANISOU 9041 CD1 LEU I 108 37559 44532 49482 -501 -870 -2181 C ATOM 9042 CD2 LEU I 108 103.455 57.392 42.690 1.00348.54 C ANISOU 9042 CD2 LEU I 108 38334 44758 49338 -45 -38 -795 C ATOM 9043 N GLU I 109 101.183 55.747 47.384 1.00386.74 N ANISOU 9043 N GLU I 109 42873 52737 51330 -442 -1792 -2396 N ATOM 9044 CA GLU I 109 101.033 55.366 48.805 1.00393.84 C ANISOU 9044 CA GLU I 109 43411 54634 51594 -542 -2296 -2687 C ATOM 9045 C GLU I 109 101.530 53.955 49.130 1.00393.58 C ANISOU 9045 C GLU I 109 43376 55025 51138 -331 -2106 -1917 C ATOM 9046 O GLU I 109 102.092 53.764 50.208 1.00399.15 O ANISOU 9046 O GLU I 109 43493 56489 51676 -401 -2495 -1900 O ATOM 9047 CB GLU I 109 99.586 55.548 49.328 1.00395.16 C ANISOU 9047 CB GLU I 109 43889 55194 51059 -661 -2576 -3379 C ATOM 9048 CG GLU I 109 98.921 56.900 49.031 1.00403.98 C ANISOU 9048 CG GLU I 109 45032 55879 52581 -854 -2731 -4141 C ATOM 9049 CD GLU I 109 99.516 58.090 49.797 1.00419.66 C ANISOU 9049 CD GLU I 109 46247 58080 55124 -1119 -3234 -4825 C ATOM 9050 OE1 GLU I 109 100.317 57.870 50.734 1.00434.65 O ANISOU 9050 OE1 GLU I 109 47584 60643 56919 -1189 -3566 -4812 O ATOM 9051 OE2 GLU I 109 99.189 59.255 49.462 1.00423.71 O ANISOU 9051 OE2 GLU I 109 46687 58093 56209 -1267 -3299 -5374 O ATOM 9052 N ARG I 110 101.319 52.982 48.223 1.00388.98 N ANISOU 9052 N ARG I 110 43421 53977 50396 -85 -1516 -1296 N ATOM 9053 CA ARG I 110 101.899 51.611 48.359 1.00388.31 C ANISOU 9053 CA ARG I 110 43330 54102 50106 149 -1208 -473 C ATOM 9054 C ARG I 110 103.442 51.579 48.370 1.00402.77 C ANISOU 9054 C ARG I 110 44550 55850 52631 223 -1118 92 C ATOM 9055 O ARG I 110 104.027 50.834 49.174 1.00414.93 O ANISOU 9055 O ARG I 110 45660 57988 54006 293 -1240 538 O ATOM 9056 CB ARG I 110 101.349 50.599 47.327 1.00371.51 C ANISOU 9056 CB ARG I 110 42014 51412 47731 378 -555 -8 C ATOM 9057 CG ARG I 110 101.697 49.144 47.655 1.00357.41 C ANISOU 9057 CG ARG I 110 40218 49905 45673 602 -277 727 C ATOM 9058 CD ARG I 110 102.134 48.353 46.429 1.00340.56 C ANISOU 9058 CD ARG I 110 38556 46968 43872 855 499 1382 C ATOM 9059 NE ARG I 110 103.062 47.249 46.760 1.00325.84 N ANISOU 9059 NE ARG I 110 36364 45263 42175 1073 773 2181 N ATOM 9060 CZ ARG I 110 103.328 46.187 45.990 1.00312.18 C ANISOU 9060 CZ ARG I 110 35021 43001 40592 1326 1466 2794 C ATOM 9061 NH1 ARG I 110 102.735 46.027 44.812 1.00303.28 N ANISOU 9061 NH1 ARG I 110 34665 41181 39386 1383 1958 2688 N ATOM 9062 NH2 ARG I 110 104.194 45.260 46.403 1.00306.07 N ANISOU 9062 NH2 ARG I 110 33843 42398 40050 1519 1682 3524 N ATOM 9063 N LYS I 111 104.085 52.367 47.496 1.00402.95 N ANISOU 9063 N LYS I 111 44504 55160 53436 214 -903 129 N ATOM 9064 CA LYS I 111 105.565 52.480 47.474 1.00399.64 C ANISOU 9064 CA LYS I 111 43456 54614 53773 266 -834 644 C ATOM 9065 C LYS I 111 106.186 53.113 48.739 1.00407.75 C ANISOU 9065 C LYS I 111 43589 56399 54938 17 -1553 298 C ATOM 9066 O LYS I 111 107.305 52.749 49.125 1.00413.66 O ANISOU 9066 O LYS I 111 43763 57403 56006 74 -1589 853 O ATOM 9067 CB LYS I 111 106.088 53.149 46.184 1.00384.08 C ANISOU 9067 CB LYS I 111 41626 51685 52620 335 -386 826 C ATOM 9068 CG LYS I 111 106.276 52.206 45.000 1.00369.43 C ANISOU 9068 CG LYS I 111 40363 49176 50826 654 432 1560 C ATOM 9069 CD LYS I 111 107.418 51.212 45.202 1.00363.63 C ANISOU 9069 CD LYS I 111 39271 48552 50338 875 723 2403 C ATOM 9070 CE LYS I 111 107.399 50.109 44.148 1.00353.80 C ANISOU 9070 CE LYS I 111 38691 46727 49007 1190 1556 3019 C ATOM 9071 NZ LYS I 111 108.257 48.937 44.488 1.00349.24 N ANISOU 9071 NZ LYS I 111 37827 46319 48548 1421 1854 3814 N ATOM 9072 N ALA I 112 105.463 54.028 49.392 1.00406.36 N ANISOU 9072 N ALA I 112 43281 56604 54512 -262 -2114 -612 N ATOM 9073 CA ALA I 112 105.866 54.543 50.711 1.00402.75 C ANISOU 9073 CA ALA I 112 42033 57016 53977 -530 -2835 -1077 C ATOM 9074 C ALA I 112 105.723 53.503 51.847 1.00396.26 C ANISOU 9074 C ALA I 112 41020 57241 52298 -486 -3096 -821 C ATOM 9075 O ALA I 112 106.574 53.456 52.747 1.00393.95 O ANISOU 9075 O ALA I 112 39994 57648 52040 -592 -3498 -668 O ATOM 9076 CB ALA I 112 105.102 55.823 51.042 1.00406.38 C ANISOU 9076 CB ALA I 112 42432 57531 54443 -834 -3296 -2179 C ATOM 9077 N GLN I 113 104.658 52.683 51.785 1.00385.74 N ANISOU 9077 N GLN I 113 40316 56018 50228 -335 -2869 -739 N ATOM 9078 CA GLN I 113 104.294 51.670 52.818 1.00380.31 C ANISOU 9078 CA GLN I 113 39522 56297 48680 -271 -3071 -488 C ATOM 9079 C GLN I 113 105.402 50.654 53.066 1.00384.56 C ANISOU 9079 C GLN I 113 39621 57111 49384 -78 -2897 525 C ATOM 9080 O GLN I 113 105.963 50.566 54.157 1.00392.92 O ANISOU 9080 O GLN I 113 39970 59088 50232 -188 -3370 630 O ATOM 9081 CB GLN I 113 103.025 50.878 52.426 1.00365.79 C ANISOU 9081 CB GLN I 113 38497 54271 46213 -99 -2709 -420 C ATOM 9082 CG GLN I 113 101.680 51.563 52.641 1.00354.68 C ANISOU 9082 CG GLN I 113 37447 53008 44306 -277 -2994 -1347 C ATOM 9083 CD GLN I 113 100.521 50.744 52.089 1.00342.06 C ANISOU 9083 CD GLN I 113 36654 51103 42208 -101 -2584 -1172 C ATOM 9084 OE1 GLN I 113 100.570 49.519 52.085 1.00337.23 O ANISOU 9084 OE1 GLN I 113 36199 50591 41341 116 -2270 -455 O ATOM 9085 NE2 GLN I 113 99.468 51.424 51.640 1.00333.90 N ANISOU 9085 NE2 GLN I 113 36099 49695 41072 -205 -2592 -1819 N ATOM 9086 N LYS I 114 105.686 49.856 52.049 1.00380.40 N ANISOU 9086 N LYS I 114 39515 55805 49212 212 -2198 1280 N ATOM 9087 CA LYS I 114 106.784 48.923 52.112 1.00383.58 C ANISOU 9087 CA LYS I 114 39521 56275 49943 428 -1917 2287 C ATOM 9088 C LYS I 114 108.070 49.715 51.760 1.00388.14 C ANISOU 9088 C LYS I 114 39564 56457 51452 351 -1947 2415 C ATOM 9089 O LYS I 114 108.169 50.324 50.700 1.00390.90 O ANISOU 9089 O LYS I 114 40245 55906 52372 371 -1613 2257 O ATOM 9090 CB LYS I 114 106.494 47.753 51.165 1.00375.95 C ANISOU 9090 CB LYS I 114 39252 54604 48987 763 -1119 2948 C ATOM 9091 CG LYS I 114 107.467 46.593 51.244 1.00378.27 C ANISOU 9091 CG LYS I 114 39198 54932 49592 1034 -729 4038 C ATOM 9092 CD LYS I 114 107.030 45.476 50.306 1.00371.32 C ANISOU 9092 CD LYS I 114 39068 53314 48700 1336 68 4518 C ATOM 9093 CE LYS I 114 108.179 44.548 49.950 1.00374.61 C ANISOU 9093 CE LYS I 114 39220 53353 49762 1631 656 5557 C ATOM 9094 NZ LYS I 114 107.899 43.855 48.664 1.00369.31 N ANISOU 9094 NZ LYS I 114 39358 51669 49293 1879 1511 5790 N ATOM 9095 N LYS I 115 109.033 49.778 52.678 1.00388.61 N ANISOU 9095 N LYS I 115 38756 57236 51661 240 -2392 2678 N ATOM 9096 CA LYS I 115 110.241 50.607 52.451 1.00382.69 C ANISOU 9096 CA LYS I 115 37416 56175 51813 121 -2510 2746 C ATOM 9097 C LYS I 115 111.354 49.816 51.749 1.00381.70 C ANISOU 9097 C LYS I 115 37166 55470 52392 437 -1869 3865 C ATOM 9098 O LYS I 115 111.463 48.604 51.943 1.00383.62 O ANISOU 9098 O LYS I 115 37418 55941 52396 682 -1564 4640 O ATOM 9099 CB LYS I 115 110.731 51.310 53.746 1.00382.75 C ANISOU 9099 CB LYS I 115 36515 57214 51698 -231 -3382 2305 C ATOM 9100 CG LYS I 115 111.050 50.408 54.934 1.00376.73 C ANISOU 9100 CG LYS I 115 35172 57606 50362 -209 -3714 2871 C ATOM 9101 CD LYS I 115 112.498 49.955 54.955 1.00371.68 C ANISOU 9101 CD LYS I 115 33833 56984 50401 -89 -3586 3890 C ATOM 9102 CE LYS I 115 112.643 48.797 55.923 1.00365.02 C ANISOU 9102 CE LYS I 115 32571 57145 48973 34 -3717 4669 C ATOM 9103 NZ LYS I 115 113.770 48.987 56.879 1.00364.40 N ANISOU 9103 NZ LYS I 115 31422 57968 49065 -169 -4312 5000 N ATOM 9104 N LYS I 116 112.163 50.505 50.937 1.00375.93 N ANISOU 9104 N LYS I 116 36298 53973 52565 437 -1640 3958 N ATOM 9105 CA LYS I 116 113.281 49.890 50.184 1.00372.75 C ANISOU 9105 CA LYS I 116 35756 52938 52931 740 -986 4983 C ATOM 9106 C LYS I 116 114.714 50.170 50.719 1.00387.75 C ANISOU 9106 C LYS I 116 36630 55172 55522 641 -1312 5475 C ATOM 9107 O LYS I 116 114.883 50.925 51.678 1.00394.51 O ANISOU 9107 O LYS I 116 36854 56766 56276 296 -2098 4953 O ATOM 9108 CB LYS I 116 113.166 50.223 48.682 1.00358.84 C ANISOU 9108 CB LYS I 116 34674 49985 51684 907 -294 4950 C ATOM 9109 CG LYS I 116 111.994 49.556 47.972 1.00344.69 C ANISOU 9109 CG LYS I 116 33887 47780 49297 1097 230 4825 C ATOM 9110 CD LYS I 116 112.082 48.037 47.995 1.00338.29 C ANISOU 9110 CD LYS I 116 33257 47030 48245 1416 746 5652 C ATOM 9111 CE LYS I 116 113.011 47.488 46.923 1.00336.30 C ANISOU 9111 CE LYS I 116 33115 45921 48739 1749 1598 6484 C ATOM 9112 NZ LYS I 116 112.965 46.005 46.935 1.00332.04 N ANISOU 9112 NZ LYS I 116 32799 45374 47985 2052 2136 7194 N ATOM 9113 N LYS I 117 115.719 49.592 50.039 1.00398.40 N ANISOU 9113 N LYS I 117 37842 55935 57597 938 -682 6442 N ATOM 9114 CA LYS I 117 117.115 49.332 50.526 1.00416.47 C ANISOU 9114 CA LYS I 117 39181 58553 60502 971 -798 7298 C ATOM 9115 C LYS I 117 117.911 50.212 51.563 1.00430.61 C ANISOU 9115 C LYS I 117 39926 61132 62553 582 -1696 7059 C ATOM 9116 O LYS I 117 118.134 49.778 52.697 1.00448.68 O ANISOU 9116 O LYS I 117 41609 64448 64418 474 -2201 7316 O ATOM 9117 CB LYS I 117 118.012 48.942 49.324 1.00414.68 C ANISOU 9117 CB LYS I 117 39078 57286 61193 1333 101 8169 C ATOM 9118 CG LYS I 117 117.659 47.587 48.739 1.00408.28 C ANISOU 9118 CG LYS I 117 38924 56059 60143 1745 942 8798 C ATOM 9119 CD LYS I 117 117.623 47.622 47.229 1.00402.44 C ANISOU 9119 CD LYS I 117 38920 54139 59848 2002 1814 8869 C ATOM 9120 CE LYS I 117 116.996 46.341 46.726 1.00397.82 C ANISOU 9120 CE LYS I 117 39094 53214 58846 2332 2553 9206 C ATOM 9121 NZ LYS I 117 116.654 46.411 45.283 1.00394.02 N ANISOU 9121 NZ LYS I 117 39474 51714 58518 2522 3325 9041 N ATOM 9122 N SER I 118 118.391 51.396 51.182 1.00428.43 N ANISOU 9122 N SER I 118 39386 60399 62999 374 -1883 6636 N ATOM 9123 CA SER I 118 119.375 52.105 52.027 1.00428.24 C ANISOU 9123 CA SER I 118 38306 60983 63421 37 -2620 6585 C ATOM 9124 C SER I 118 118.767 53.211 52.872 1.00425.81 C ANISOU 9124 C SER I 118 37793 61323 62672 -445 -3514 5331 C ATOM 9125 O SER I 118 119.490 53.921 53.567 1.00426.40 O ANISOU 9125 O SER I 118 37027 61894 63090 -786 -4175 5092 O ATOM 9126 CB SER I 118 120.562 52.632 51.207 1.00428.03 C ANISOU 9126 CB SER I 118 37880 60108 64641 106 -2288 7088 C ATOM 9127 OG SER I 118 120.121 53.337 50.058 1.00423.95 O ANISOU 9127 OG SER I 118 38013 58555 64512 171 -1844 6634 O TER 9128 SER I 118 ATOM 9129 N SER J 14 73.043 66.652 1.120 1.00383.52 N ANISOU 9129 N SER J 14 59784 39943 45989 844 4347 1928 N ATOM 9130 CA SER J 14 74.137 65.943 1.823 1.00376.00 C ANISOU 9130 CA SER J 14 58322 39251 45289 57 4142 1538 C ATOM 9131 C SER J 14 74.008 64.409 1.763 1.00367.70 C ANISOU 9131 C SER J 14 56427 38856 44426 95 3382 1495 C ATOM 9132 O SER J 14 72.896 63.840 1.675 1.00366.51 O ANISOU 9132 O SER J 14 55965 39003 44288 618 2965 1697 O ATOM 9133 CB SER J 14 74.212 66.432 3.270 1.00373.46 C ANISOU 9133 CB SER J 14 58040 38765 45091 -366 4371 1322 C ATOM 9134 OG SER J 14 75.381 65.957 3.889 1.00363.00 O ANISOU 9134 OG SER J 14 56323 37670 43930 -1117 4292 935 O ATOM 9135 N TYR J 15 75.169 63.764 1.804 1.00359.12 N ANISOU 9135 N TYR J 15 54993 37995 43460 -470 3242 1214 N ATOM 9136 CA TYR J 15 75.302 62.310 1.751 1.00352.72 C ANISOU 9136 CA TYR J 15 53451 37747 42819 -524 2607 1134 C ATOM 9137 C TYR J 15 74.406 61.562 2.774 1.00336.52 C ANISOU 9137 C TYR J 15 50890 36017 40952 -387 2162 1146 C ATOM 9138 O TYR J 15 73.685 60.627 2.401 1.00335.17 O ANISOU 9138 O TYR J 15 50330 36191 40827 -27 1693 1276 O ATOM 9139 CB TYR J 15 76.787 61.955 1.932 1.00366.68 C ANISOU 9139 CB TYR J 15 54995 39666 44657 -1203 2644 793 C ATOM 9140 CG TYR J 15 77.246 60.632 1.340 1.00379.25 C ANISOU 9140 CG TYR J 15 56045 41723 46327 -1227 2145 740 C ATOM 9141 CD1 TYR J 15 77.733 60.557 0.031 1.00380.56 C ANISOU 9141 CD1 TYR J 15 56359 41871 46364 -1139 2187 804 C ATOM 9142 CD2 TYR J 15 77.240 59.458 2.103 1.00383.62 C ANISOU 9142 CD2 TYR J 15 55969 42716 47072 -1344 1663 621 C ATOM 9143 CE1 TYR J 15 78.165 59.345 -0.505 1.00380.32 C ANISOU 9143 CE1 TYR J 15 55850 42252 46400 -1162 1748 748 C ATOM 9144 CE2 TYR J 15 77.678 58.247 1.577 1.00381.50 C ANISOU 9144 CE2 TYR J 15 55258 42831 46860 -1356 1253 574 C ATOM 9145 CZ TYR J 15 78.149 58.194 0.280 1.00378.78 C ANISOU 9145 CZ TYR J 15 55058 42466 46393 -1274 1293 630 C ATOM 9146 OH TYR J 15 78.565 56.990 -0.239 1.00371.25 O ANISOU 9146 OH TYR J 15 53684 41880 45492 -1275 898 582 O ATOM 9147 N GLN J 16 74.431 61.987 4.038 1.00318.28 N ANISOU 9147 N GLN J 16 48599 33595 38735 -684 2333 998 N ATOM 9148 CA GLN J 16 73.737 61.281 5.141 1.00302.96 C ANISOU 9148 CA GLN J 16 46176 31954 36981 -647 1945 969 C ATOM 9149 C GLN J 16 72.207 61.316 5.008 1.00306.64 C ANISOU 9149 C GLN J 16 46663 32448 37398 -3 1772 1259 C ATOM 9150 O GLN J 16 71.517 60.344 5.370 1.00305.61 O ANISOU 9150 O GLN J 16 46036 32687 37394 149 1310 1283 O ATOM 9151 CB GLN J 16 74.175 61.827 6.513 1.00291.44 C ANISOU 9151 CB GLN J 16 44761 30368 35605 -1125 2212 732 C ATOM 9152 CG GLN J 16 75.676 61.912 6.746 1.00283.57 C ANISOU 9152 CG GLN J 16 43722 29413 34606 -1786 2431 397 C ATOM 9153 CD GLN J 16 76.059 62.888 7.854 1.00283.24 C ANISOU 9153 CD GLN J 16 43929 29134 34553 -2232 2884 166 C ATOM 9154 OE1 GLN J 16 75.186 63.456 8.525 1.00284.79 O ANISOU 9154 OE1 GLN J 16 44321 29115 34769 -2041 3013 269 O ATOM 9155 NE2 GLN J 16 77.371 63.095 8.046 1.00281.54 N ANISOU 9155 NE2 GLN J 16 43695 28988 34288 -2842 3139 -168 N ATOM 9156 N GLN J 17 71.687 62.428 4.474 1.00315.62 N ANISOU 9156 N GLN J 17 48383 33212 38325 382 2162 1472 N ATOM 9157 CA GLN J 17 70.240 62.618 4.238 1.00324.12 C ANISOU 9157 CA GLN J 17 49528 34347 39275 1072 2056 1760 C ATOM 9158 C GLN J 17 69.661 61.643 3.224 1.00326.73 C ANISOU 9158 C GLN J 17 49474 35118 39551 1483 1589 1894 C ATOM 9159 O GLN J 17 68.531 61.144 3.379 1.00328.05 O ANISOU 9159 O GLN J 17 49305 35618 39718 1855 1252 1993 O ATOM 9160 CB GLN J 17 69.968 64.017 3.681 1.00335.27 C ANISOU 9160 CB GLN J 17 51710 35265 40411 1454 2621 1980 C ATOM 9161 CG GLN J 17 70.139 65.185 4.632 1.00349.21 C ANISOU 9161 CG GLN J 17 53981 36535 42166 1214 3162 1907 C ATOM 9162 CD GLN J 17 69.975 66.514 3.921 1.00363.65 C ANISOU 9162 CD GLN J 17 56652 37823 43695 1604 3775 2136 C ATOM 9163 OE1 GLN J 17 70.763 66.868 3.048 1.00375.43 O ANISOU 9163 OE1 GLN J 17 58516 39064 45065 1483 4080 2133 O ATOM 9164 NE2 GLN J 17 68.935 67.247 4.285 1.00366.58 N ANISOU 9164 NE2 GLN J 17 57343 38011 43928 2100 3974 2345 N ATOM 9165 N ARG J 18 70.431 61.432 2.164 1.00332.67 N ANISOU 9165 N ARG J 18 50293 35870 40233 1406 1607 1883 N ATOM 9166 CA ARG J 18 70.053 60.593 1.044 1.00341.84 C ANISOU 9166 CA ARG J 18 51155 37414 41314 1753 1232 1988 C ATOM 9167 C ARG J 18 69.842 59.137 1.508 1.00346.56 C ANISOU 9167 C ARG J 18 51033 38502 42141 1562 668 1832 C ATOM 9168 O ARG J 18 68.899 58.449 1.072 1.00345.01 O ANISOU 9168 O ARG J 18 50501 38692 41893 1927 316 1915 O ATOM 9169 CB ARG J 18 71.173 60.689 0.022 1.00338.42 C ANISOU 9169 CB ARG J 18 50954 36828 40801 1558 1412 1950 C ATOM 9170 CG ARG J 18 70.778 60.586 -1.427 1.00334.62 C ANISOU 9170 CG ARG J 18 50548 36504 40087 2076 1324 2157 C ATOM 9171 CD ARG J 18 72.024 60.846 -2.257 1.00328.12 C ANISOU 9171 CD ARG J 18 50029 35439 39200 1794 1590 2097 C ATOM 9172 NE ARG J 18 73.164 60.097 -1.730 1.00312.98 N ANISOU 9172 NE ARG J 18 47761 33629 37528 1120 1435 1798 N ATOM 9173 CZ ARG J 18 73.513 58.887 -2.150 1.00302.41 C ANISOU 9173 CZ ARG J 18 45931 32674 36295 990 1012 1691 C ATOM 9174 NH1 ARG J 18 74.552 58.278 -1.604 1.00295.23 N ANISOU 9174 NH1 ARG J 18 44739 31863 35570 436 910 1436 N ATOM 9175 NH2 ARG J 18 72.826 58.274 -3.108 1.00298.43 N ANISOU 9175 NH2 ARG J 18 45215 32482 35691 1424 702 1830 N ATOM 9176 N LEU J 19 70.700 58.689 2.429 1.00354.92 N ANISOU 9176 N LEU J 19 51868 39555 43428 992 613 1596 N ATOM 9177 CA LEU J 19 70.633 57.318 2.969 1.00361.48 C ANISOU 9177 CA LEU J 19 52090 40781 44472 784 146 1448 C ATOM 9178 C LEU J 19 69.529 57.092 4.022 1.00373.97 C ANISOU 9178 C LEU J 19 53420 42518 46153 911 -35 1463 C ATOM 9179 O LEU J 19 69.048 55.959 4.197 1.00386.64 O ANISOU 9179 O LEU J 19 54561 44472 47869 916 -423 1406 O ATOM 9180 CB LEU J 19 72.006 56.869 3.489 1.00350.89 C ANISOU 9180 CB LEU J 19 50596 39438 43288 199 152 1205 C ATOM 9181 CG LEU J 19 73.204 57.052 2.546 1.00341.55 C ANISOU 9181 CG LEU J 19 49619 38141 42012 -1 335 1144 C ATOM 9182 CD1 LEU J 19 74.453 56.504 3.206 1.00338.10 C ANISOU 9182 CD1 LEU J 19 48928 37828 41706 -541 291 883 C ATOM 9183 CD2 LEU J 19 72.984 56.403 1.184 1.00333.67 C ANISOU 9183 CD2 LEU J 19 48508 37349 40919 307 94 1257 C ATOM 9184 N LYS J 20 69.132 58.168 4.710 1.00371.77 N ANISOU 9184 N LYS J 20 53467 41963 45825 1003 270 1532 N ATOM 9185 CA LYS J 20 67.954 58.143 5.594 1.00352.10 C ANISOU 9185 CA LYS J 20 50798 39604 43377 1213 139 1582 C ATOM 9186 C LYS J 20 66.653 57.813 4.833 1.00341.55 C ANISOU 9186 C LYS J 20 49279 38611 41882 1774 -112 1745 C ATOM 9187 O LYS J 20 65.773 57.159 5.395 1.00344.24 O ANISOU 9187 O LYS J 20 49233 39259 42300 1843 -397 1708 O ATOM 9188 CB LYS J 20 67.815 59.443 6.403 1.00342.34 C ANISOU 9188 CB LYS J 20 50001 37978 42093 1226 558 1630 C ATOM 9189 CG LYS J 20 68.845 59.582 7.516 1.00324.25 C ANISOU 9189 CG LYS J 20 47717 35500 39980 626 727 1402 C ATOM 9190 CD LYS J 20 68.616 60.843 8.331 1.00314.11 C ANISOU 9190 CD LYS J 20 46862 33839 38644 627 1151 1427 C ATOM 9191 CE LYS J 20 69.778 61.124 9.282 1.00309.87 C ANISOU 9191 CE LYS J 20 46375 33131 38230 -5 1391 1163 C ATOM 9192 NZ LYS J 20 70.933 61.891 8.718 1.00310.26 N ANISOU 9192 NZ LYS J 20 46861 32854 38168 -305 1826 1066 N ATOM 9193 N ALA J 21 66.554 58.239 3.563 1.00323.92 N ANISOU 9193 N ALA J 21 47305 36360 39410 2157 -1 1905 N ATOM 9194 CA ALA J 21 65.413 57.901 2.671 1.00299.58 C ANISOU 9194 CA ALA J 21 44008 33699 36117 2703 -244 2034 C ATOM 9195 C ALA J 21 65.344 56.422 2.280 1.00282.74 C ANISOU 9195 C ALA J 21 41308 32024 34096 2538 -697 1881 C ATOM 9196 O ALA J 21 64.264 55.824 2.253 1.00272.87 O ANISOU 9196 O ALA J 21 39679 31207 32791 2762 -976 1861 O ATOM 9197 CB ALA J 21 65.416 58.772 1.418 1.00303.27 C ANISOU 9197 CB ALA J 21 44926 34031 36271 3173 23 2251 C ATOM 9198 N ALA J 22 66.496 55.841 1.972 1.00273.04 N ANISOU 9198 N ALA J 22 40030 30707 33004 2138 -746 1758 N ATOM 9199 CA ALA J 22 66.563 54.418 1.729 1.00268.93 C ANISOU 9199 CA ALA J 22 39030 30538 32612 1924 -1125 1599 C ATOM 9200 C ALA J 22 66.288 53.631 3.017 1.00268.25 C ANISOU 9200 C ALA J 22 38592 30563 32768 1612 -1320 1445 C ATOM 9201 O ALA J 22 65.728 52.549 2.955 1.00273.32 O ANISOU 9201 O ALA J 22 38837 31550 33462 1579 -1616 1342 O ATOM 9202 CB ALA J 22 67.905 54.044 1.130 1.00264.37 C ANISOU 9202 CB ALA J 22 38519 29825 32103 1606 -1101 1517 C ATOM 9203 N VAL J 23 66.671 54.180 4.174 1.00262.71 N ANISOU 9203 N VAL J 23 38050 29570 32197 1376 -1130 1420 N ATOM 9204 CA VAL J 23 66.367 53.577 5.488 1.00251.86 C ANISOU 9204 CA VAL J 23 36385 28280 31028 1125 -1276 1300 C ATOM 9205 C VAL J 23 64.854 53.519 5.711 1.00258.93 C ANISOU 9205 C VAL J 23 37075 29462 31844 1453 -1419 1350 C ATOM 9206 O VAL J 23 64.325 52.489 6.134 1.00250.38 O ANISOU 9206 O VAL J 23 35611 28649 30870 1326 -1672 1231 O ATOM 9207 CB VAL J 23 67.073 54.322 6.664 1.00242.44 C ANISOU 9207 CB VAL J 23 35418 26745 29951 832 -1014 1258 C ATOM 9208 CG1 VAL J 23 66.504 53.936 8.025 1.00233.69 C ANISOU 9208 CG1 VAL J 23 34057 25730 29004 694 -1132 1182 C ATOM 9209 CG2 VAL J 23 68.565 54.049 6.658 1.00233.65 C ANISOU 9209 CG2 VAL J 23 34342 25501 28931 421 -946 1130 C ATOM 9210 N HIS J 24 64.172 54.625 5.416 1.00272.92 N ANISOU 9210 N HIS J 24 39114 31181 33401 1883 -1231 1520 N ATOM 9211 CA HIS J 24 62.713 54.728 5.571 1.00284.42 C ANISOU 9211 CA HIS J 24 40384 32964 34716 2269 -1341 1576 C ATOM 9212 C HIS J 24 62.039 53.675 4.719 1.00285.53 C ANISOU 9212 C HIS J 24 40105 33617 34764 2387 -1660 1489 C ATOM 9213 O HIS J 24 61.084 53.038 5.159 1.00280.17 O ANISOU 9213 O HIS J 24 39054 33291 34105 2384 -1865 1383 O ATOM 9214 CB HIS J 24 62.220 56.139 5.190 1.00290.52 C ANISOU 9214 CB HIS J 24 41580 33594 35211 2800 -1047 1805 C ATOM 9215 CG HIS J 24 60.772 56.423 5.516 1.00294.64 C ANISOU 9215 CG HIS J 24 41945 34444 35560 3233 -1113 1874 C ATOM 9216 ND1 HIS J 24 60.233 56.289 6.783 1.00300.38 N ANISOU 9216 ND1 HIS J 24 42481 35209 36438 3074 -1176 1794 N ATOM 9217 CD2 HIS J 24 59.770 56.907 4.738 1.00292.50 C ANISOU 9217 CD2 HIS J 24 41692 34498 34944 3856 -1106 2022 C ATOM 9218 CE1 HIS J 24 58.958 56.644 6.761 1.00299.51 C ANISOU 9218 CE1 HIS J 24 42260 35442 36095 3555 -1215 1876 C ATOM 9219 NE2 HIS J 24 58.650 57.012 5.529 1.00295.23 N ANISOU 9219 NE2 HIS J 24 41829 35104 35239 4049 -1179 2013 N ATOM 9220 N TYR J 25 62.556 53.484 3.510 1.00294.55 N ANISOU 9220 N TYR J 25 41307 34806 35802 2456 -1684 1510 N ATOM 9221 CA TYR J 25 62.066 52.451 2.605 1.00308.54 C ANISOU 9221 CA TYR J 25 42693 37057 37482 2512 -1966 1394 C ATOM 9222 C TYR J 25 62.026 51.066 3.269 1.00295.25 C ANISOU 9222 C TYR J 25 40607 35527 36047 2048 -2205 1158 C ATOM 9223 O TYR J 25 60.981 50.404 3.261 1.00294.67 O ANISOU 9223 O TYR J 25 40162 35890 35907 2096 -2396 1031 O ATOM 9224 CB TYR J 25 62.943 52.421 1.351 1.00332.17 C ANISOU 9224 CB TYR J 25 45854 39967 40386 2543 -1929 1438 C ATOM 9225 CG TYR J 25 62.665 51.300 0.349 1.00351.95 C ANISOU 9225 CG TYR J 25 47988 42923 42815 2527 -2199 1292 C ATOM 9226 CD1 TYR J 25 61.744 51.481 -0.696 1.00361.63 C ANISOU 9226 CD1 TYR J 25 49079 44613 43708 3004 -2277 1339 C ATOM 9227 CD2 TYR J 25 63.351 50.073 0.412 1.00356.47 C ANISOU 9227 CD2 TYR J 25 48357 43468 43616 2055 -2356 1103 C ATOM 9228 CE1 TYR J 25 61.485 50.482 -1.635 1.00365.58 C ANISOU 9228 CE1 TYR J 25 49227 45558 44116 2965 -2506 1173 C ATOM 9229 CE2 TYR J 25 63.097 49.058 -0.531 1.00360.91 C ANISOU 9229 CE2 TYR J 25 48613 44414 44099 2021 -2566 952 C ATOM 9230 CZ TYR J 25 62.166 49.270 -1.549 1.00363.47 C ANISOU 9230 CZ TYR J 25 48787 45210 44104 2448 -2641 973 C ATOM 9231 OH TYR J 25 61.902 48.287 -2.480 1.00364.79 O ANISOU 9231 OH TYR J 25 48634 45792 44176 2386 -2835 791 O ATOM 9232 N THR J 26 63.156 50.644 3.843 1.00279.54 N ANISOU 9232 N THR J 26 38701 33195 34313 1613 -2169 1092 N ATOM 9233 CA THR J 26 63.319 49.296 4.418 1.00264.93 C ANISOU 9233 CA THR J 26 36557 31417 32684 1198 -2347 897 C ATOM 9234 C THR J 26 62.594 49.148 5.759 1.00262.74 C ANISOU 9234 C THR J 26 36122 31173 32532 1080 -2372 838 C ATOM 9235 O THR J 26 62.040 48.087 6.090 1.00268.63 O ANISOU 9235 O THR J 26 36568 32139 33358 886 -2526 678 O ATOM 9236 CB THR J 26 64.812 48.985 4.598 1.00256.93 C ANISOU 9236 CB THR J 26 35703 30066 31850 856 -2279 871 C ATOM 9237 OG1 THR J 26 65.429 48.929 3.309 1.00254.71 O ANISOU 9237 OG1 THR J 26 35517 29802 31457 935 -2285 897 O ATOM 9238 CG2 THR J 26 64.998 47.670 5.281 1.00254.75 C ANISOU 9238 CG2 THR J 26 35194 29825 31772 502 -2415 710 C ATOM 9239 N VAL J 27 62.604 50.226 6.527 1.00255.92 N ANISOU 9239 N VAL J 27 35487 30072 31678 1182 -2193 961 N ATOM 9240 CA VAL J 27 61.761 50.310 7.693 1.00253.91 C ANISOU 9240 CA VAL J 27 35101 29881 31490 1164 -2204 934 C ATOM 9241 C VAL J 27 60.291 50.102 7.279 1.00276.13 C ANISOU 9241 C VAL J 27 37617 33188 34112 1445 -2353 883 C ATOM 9242 O VAL J 27 59.568 49.343 7.923 1.00288.35 O ANISOU 9242 O VAL J 27 38867 34955 35736 1274 -2477 739 O ATOM 9243 CB VAL J 27 61.986 51.641 8.423 1.00239.24 C ANISOU 9243 CB VAL J 27 33577 27690 29631 1275 -1954 1078 C ATOM 9244 CG1 VAL J 27 60.830 51.938 9.357 1.00234.15 C ANISOU 9244 CG1 VAL J 27 32804 27190 28970 1412 -1965 1084 C ATOM 9245 CG2 VAL J 27 63.307 51.598 9.177 1.00227.38 C ANISOU 9245 CG2 VAL J 27 32231 25823 28337 882 -1839 1037 C ATOM 9246 N GLY J 28 59.873 50.738 6.183 1.00293.33 N ANISOU 9246 N GLY J 28 39863 35572 36016 1871 -2331 987 N ATOM 9247 CA GLY J 28 58.561 50.480 5.572 1.00305.40 C ANISOU 9247 CA GLY J 28 41052 37689 37295 2163 -2489 908 C ATOM 9248 C GLY J 28 58.316 49.018 5.214 1.00306.19 C ANISOU 9248 C GLY J 28 40757 38129 37451 1839 -2706 649 C ATOM 9249 O GLY J 28 57.190 48.526 5.380 1.00305.91 O ANISOU 9249 O GLY J 28 40360 38549 37322 1837 -2828 484 O ATOM 9250 N CYS J 29 59.369 48.339 4.732 1.00303.11 N ANISOU 9250 N CYS J 29 40448 37520 37199 1555 -2728 600 N ATOM 9251 CA CYS J 29 59.349 46.901 4.360 1.00296.47 C ANISOU 9251 CA CYS J 29 39324 36889 36431 1207 -2880 357 C ATOM 9252 C CYS J 29 58.791 46.003 5.457 1.00295.69 C ANISOU 9252 C CYS J 29 38996 36849 36503 851 -2926 170 C ATOM 9253 O CYS J 29 57.747 45.363 5.295 1.00288.88 O ANISOU 9253 O CYS J 29 37794 36437 35530 786 -3024 -38 O ATOM 9254 CB CYS J 29 60.760 46.393 4.017 1.00290.53 C ANISOU 9254 CB CYS J 29 38777 35761 35848 945 -2850 370 C ATOM 9255 SG CYS J 29 61.218 46.354 2.263 1.00280.19 S ANISOU 9255 SG CYS J 29 37507 34614 34336 1138 -2901 388 S ATOM 9256 N LEU J 30 59.508 45.971 6.573 1.00298.21 N ANISOU 9256 N LEU J 30 39502 36730 37074 613 -2837 233 N ATOM 9257 CA LEU J 30 59.219 45.047 7.668 1.00301.18 C ANISOU 9257 CA LEU J 30 39736 37060 37636 255 -2846 84 C ATOM 9258 C LEU J 30 57.954 45.372 8.470 1.00316.38 C ANISOU 9258 C LEU J 30 41461 39247 39501 341 -2857 37 C ATOM 9259 O LEU J 30 57.304 44.454 8.991 1.00323.49 O ANISOU 9259 O LEU J 30 42142 40306 40464 64 -2886 -158 O ATOM 9260 CB LEU J 30 60.417 44.971 8.605 1.00287.11 C ANISOU 9260 CB LEU J 30 38206 34783 36097 37 -2746 180 C ATOM 9261 CG LEU J 30 61.767 44.815 7.930 1.00276.51 C ANISOU 9261 CG LEU J 30 37071 33190 34798 -18 -2720 243 C ATOM 9262 CD1 LEU J 30 62.795 45.176 8.970 1.00269.89 C ANISOU 9262 CD1 LEU J 30 36448 31974 34124 -132 -2606 352 C ATOM 9263 CD2 LEU J 30 61.944 43.389 7.430 1.00271.26 C ANISOU 9263 CD2 LEU J 30 36298 32591 34177 -275 -2783 68 C ATOM 9264 N CYS J 31 57.611 46.666 8.569 1.00328.47 N ANISOU 9264 N CYS J 31 43091 40809 40902 721 -2807 213 N ATOM 9265 CA CYS J 31 56.368 47.127 9.246 1.00333.68 C ANISOU 9265 CA CYS J 31 43563 41763 41458 892 -2817 190 C ATOM 9266 C CYS J 31 55.109 46.497 8.630 1.00339.18 C ANISOU 9266 C CYS J 31 43834 43106 41932 917 -2950 -46 C ATOM 9267 O CYS J 31 54.103 46.270 9.326 1.00343.70 O ANISOU 9267 O CYS J 31 44150 43962 42476 835 -2978 -184 O ATOM 9268 CB CYS J 31 56.226 48.663 9.223 1.00332.80 C ANISOU 9268 CB CYS J 31 43679 41585 41184 1376 -2712 434 C ATOM 9269 SG CYS J 31 57.471 49.627 10.125 1.00320.91 S ANISOU 9269 SG CYS J 31 42649 39387 39892 1324 -2499 660 S ATOM 9270 N GLU J 32 55.181 46.234 7.327 1.00338.17 N ANISOU 9270 N GLU J 32 43621 43236 41631 1019 -3023 -109 N ATOM 9271 CA GLU J 32 54.091 45.627 6.595 1.00342.39 C ANISOU 9271 CA GLU J 32 43730 44444 41918 1022 -3142 -371 C ATOM 9272 C GLU J 32 53.834 44.166 6.884 1.00350.63 C ANISOU 9272 C GLU J 32 44539 45583 43098 460 -3162 -694 C ATOM 9273 O GLU J 32 52.677 43.758 6.903 1.00362.35 O ANISOU 9273 O GLU J 32 45645 47614 44418 371 -3211 -949 O ATOM 9274 CB GLU J 32 54.286 45.843 5.120 1.00336.25 C ANISOU 9274 CB GLU J 32 42942 43918 40897 1319 -3202 -337 C ATOM 9275 CG GLU J 32 53.627 47.126 4.716 1.00335.26 C ANISOU 9275 CG GLU J 32 42814 44126 40440 1961 -3199 -149 C ATOM 9276 CD GLU J 32 52.166 46.925 4.467 1.00338.97 C ANISOU 9276 CD GLU J 32 42782 45424 40586 2112 -3313 -387 C ATOM 9277 OE1 GLU J 32 51.827 45.932 3.805 1.00339.86 O ANISOU 9277 OE1 GLU J 32 42559 45966 40605 1845 -3409 -687 O ATOM 9278 OE2 GLU J 32 51.380 47.772 4.909 1.00340.02 O ANISOU 9278 OE2 GLU J 32 42858 45794 40540 2497 -3292 -284 O ATOM 9279 N GLU J 33 54.897 43.386 7.092 1.00348.20 N ANISOU 9279 N GLU J 33 44465 44768 43064 92 -3100 -694 N ATOM 9280 CA GLU J 33 54.763 41.986 7.528 1.00343.02 C ANISOU 9280 CA GLU J 33 43706 44062 42563 -442 -3048 -963 C ATOM 9281 C GLU J 33 54.016 41.890 8.873 1.00340.57 C ANISOU 9281 C GLU J 33 43295 43756 42350 -617 -2988 -1032 C ATOM 9282 O GLU J 33 53.154 41.011 9.042 1.00332.93 O ANISOU 9282 O GLU J 33 42067 43092 41338 -946 -2958 -1333 O ATOM 9283 CB GLU J 33 56.121 41.257 7.528 1.00339.50 C ANISOU 9283 CB GLU J 33 43582 43049 42360 -701 -2973 -897 C ATOM 9284 CG GLU J 33 56.474 40.595 6.197 1.00338.75 C ANISOU 9284 CG GLU J 33 43452 43090 42168 -780 -3012 -1030 C ATOM 9285 CD GLU J 33 57.975 40.375 5.976 1.00335.75 C ANISOU 9285 CD GLU J 33 43422 42185 41961 -822 -2968 -861 C ATOM 9286 OE1 GLU J 33 58.791 40.677 6.880 1.00335.89 O ANISOU 9286 OE1 GLU J 33 43698 41752 42170 -814 -2903 -658 O ATOM 9287 OE2 GLU J 33 58.371 39.895 4.876 1.00333.99 O ANISOU 9287 OE2 GLU J 33 43201 42033 41666 -860 -2999 -942 O ATOM 9288 N VAL J 34 54.320 42.838 9.778 1.00338.48 N ANISOU 9288 N VAL J 34 43231 43179 42194 -400 -2957 -771 N ATOM 9289 CA VAL J 34 53.606 43.055 11.065 1.00330.08 C ANISOU 9289 CA VAL J 34 42085 42133 41197 -456 -2912 -780 C ATOM 9290 C VAL J 34 52.127 43.453 10.860 1.00341.22 C ANISOU 9290 C VAL J 34 43100 44228 42319 -250 -2991 -933 C ATOM 9291 O VAL J 34 51.259 43.062 11.644 1.00349.05 O ANISOU 9291 O VAL J 34 43878 45425 43318 -469 -2962 -1111 O ATOM 9292 CB VAL J 34 54.293 44.133 11.975 1.00311.75 C ANISOU 9292 CB VAL J 34 40071 39357 39023 -232 -2854 -467 C ATOM 9293 CG1 VAL J 34 53.689 44.150 13.377 1.00295.71 C ANISOU 9293 CG1 VAL J 34 37972 37283 37100 -364 -2799 -493 C ATOM 9294 CG2 VAL J 34 55.796 43.927 12.077 1.00302.94 C ANISOU 9294 CG2 VAL J 34 39302 37675 38124 -363 -2788 -317 C ATOM 9295 N ALA J 35 51.848 44.237 9.817 1.00342.34 N ANISOU 9295 N ALA J 35 43145 44745 42183 191 -3081 -862 N ATOM 9296 CA ALA J 35 50.478 44.676 9.510 1.00338.07 C ANISOU 9296 CA ALA J 35 42208 44946 41297 488 -3165 -994 C ATOM 9297 C ALA J 35 49.559 43.531 9.082 1.00342.84 C ANISOU 9297 C ALA J 35 42364 46150 41747 115 -3206 -1423 C ATOM 9298 O ALA J 35 48.358 43.626 9.262 1.00338.92 O ANISOU 9298 O ALA J 35 41488 46262 41022 181 -3247 -1612 O ATOM 9299 CB ALA J 35 50.491 45.768 8.451 1.00330.98 C ANISOU 9299 CB ALA J 35 41361 44289 40105 1106 -3225 -788 C ATOM 9300 N LEU J 36 50.117 42.460 8.509 1.00349.79 N ANISOU 9300 N LEU J 36 43288 46882 42734 -283 -3176 -1595 N ATOM 9301 CA LEU J 36 49.293 41.301 8.116 1.00356.75 C ANISOU 9301 CA LEU J 36 43784 48284 43480 -726 -3160 -2047 C ATOM 9302 C LEU J 36 49.192 40.260 9.208 1.00355.54 C ANISOU 9302 C LEU J 36 43690 47813 43583 -1322 -2998 -2239 C ATOM 9303 O LEU J 36 48.210 39.515 9.270 1.00356.39 O ANISOU 9303 O LEU J 36 43457 48390 43562 -1692 -2940 -2624 O ATOM 9304 CB LEU J 36 49.764 40.634 6.825 1.00360.00 C ANISOU 9304 CB LEU J 36 44179 48792 43813 -858 -3183 -2193 C ATOM 9305 CG LEU J 36 48.500 40.120 6.115 1.00366.63 C ANISOU 9305 CG LEU J 36 44458 50549 44293 -1014 -3227 -2644 C ATOM 9306 CD1 LEU J 36 47.900 41.188 5.213 1.00372.15 C ANISOU 9306 CD1 LEU J 36 44866 51957 44576 -364 -3401 -2561 C ATOM 9307 CD2 LEU J 36 48.786 38.886 5.305 1.00366.78 C ANISOU 9307 CD2 LEU J 36 44445 50584 44329 -1499 -3151 -2958 C ATOM 9308 N ASP J 37 50.219 40.226 10.057 1.00353.18 N ANISOU 9308 N ASP J 37 43828 46740 43622 -1407 -2908 -1976 N ATOM 9309 CA ASP J 37 50.242 39.439 11.296 1.00355.97 C ANISOU 9309 CA ASP J 37 44328 46695 44229 -1850 -2739 -2052 C ATOM 9310 C ASP J 37 49.063 39.741 12.263 1.00347.94 C ANISOU 9310 C ASP J 37 43040 46026 43134 -1874 -2727 -2162 C ATOM 9311 O ASP J 37 48.422 38.802 12.758 1.00350.83 O ANISOU 9311 O ASP J 37 43275 46499 43524 -2348 -2587 -2464 O ATOM 9312 CB ASP J 37 51.626 39.595 11.982 1.00366.95 C ANISOU 9312 CB ASP J 37 46208 47283 45932 -1788 -2680 -1699 C ATOM 9313 CG ASP J 37 51.690 38.978 13.388 1.00379.06 C ANISOU 9313 CG ASP J 37 47917 48404 47701 -2119 -2511 -1703 C ATOM 9314 OD1 ASP J 37 51.286 37.801 13.570 1.00386.51 O ANISOU 9314 OD1 ASP J 37 48825 49358 48673 -2581 -2351 -1984 O ATOM 9315 OD2 ASP J 37 52.182 39.672 14.305 1.00383.48 O ANISOU 9315 OD2 ASP J 37 48678 48617 48410 -1919 -2515 -1426 O ATOM 9316 N LYS J 38 48.771 41.027 12.511 1.00332.89 N ANISOU 9316 N LYS J 38 41070 44290 41123 -1376 -2847 -1931 N ATOM 9317 CA LYS J 38 47.691 41.437 13.447 1.00317.07 C ANISOU 9317 CA LYS J 38 38820 42614 39036 -1328 -2846 -1999 C ATOM 9318 C LYS J 38 46.404 41.869 12.726 1.00311.03 C ANISOU 9318 C LYS J 38 37543 42777 37854 -1065 -2971 -2217 C ATOM 9319 O LYS J 38 45.392 42.153 13.385 1.00306.12 O ANISOU 9319 O LYS J 38 36647 42557 37106 -1022 -2979 -2324 O ATOM 9320 CB LYS J 38 48.167 42.542 14.415 1.00312.63 C ANISOU 9320 CB LYS J 38 38546 41603 38635 -971 -2855 -1611 C ATOM 9321 CG LYS J 38 49.375 42.171 15.278 1.00304.71 C ANISOU 9321 CG LYS J 38 37986 39790 38000 -1206 -2736 -1414 C ATOM 9322 CD LYS J 38 49.019 41.723 16.686 1.00300.70 C ANISOU 9322 CD LYS J 38 37493 39092 37664 -1523 -2614 -1480 C ATOM 9323 CE LYS J 38 50.265 41.306 17.449 1.00294.49 C ANISOU 9323 CE LYS J 38 37130 37573 37189 -1701 -2497 -1285 C ATOM 9324 NZ LYS J 38 50.022 41.455 18.903 1.00293.74 N ANISOU 9324 NZ LYS J 38 37087 37286 37232 -1777 -2417 -1215 N ATOM 9325 N ALA J 39 46.466 41.874 11.387 1.00306.41 N ANISOU 9325 N ALA J 39 36822 42555 37044 -888 -3065 -2291 N ATOM 9326 CA ALA J 39 45.387 42.266 10.463 1.00307.28 C ANISOU 9326 CA ALA J 39 36437 43617 36697 -564 -3197 -2490 C ATOM 9327 C ALA J 39 44.909 43.702 10.711 1.00307.14 C ANISOU 9327 C ALA J 39 36373 43854 36469 133 -3293 -2208 C ATOM 9328 O ALA J 39 43.715 44.009 10.645 1.00316.18 O ANISOU 9328 O ALA J 39 37071 45795 37265 352 -3362 -2390 O ATOM 9329 CB ALA J 39 44.238 41.258 10.494 1.00309.22 C ANISOU 9329 CB ALA J 39 36190 44534 36765 -1082 -3140 -3021 C ATOM 9330 N MET J 40 45.860 44.587 10.997 1.00299.12 N ANISOU 9330 N MET J 40 35835 42166 35651 484 -3274 -1771 N ATOM 9331 CA MET J 40 45.512 45.934 11.423 1.00296.69 C ANISOU 9331 CA MET J 40 35603 41924 35202 1093 -3295 -1482 C ATOM 9332 C MET J 40 46.554 46.983 11.036 1.00282.72 C ANISOU 9332 C MET J 40 34323 39605 33491 1573 -3267 -1052 C ATOM 9333 O MET J 40 47.676 46.659 10.618 1.00269.35 O ANISOU 9333 O MET J 40 32935 37395 32010 1388 -3235 -957 O ATOM 9334 CB MET J 40 45.242 45.956 12.946 1.00308.01 C ANISOU 9334 CB MET J 40 37095 43067 36868 863 -3213 -1462 C ATOM 9335 CG MET J 40 44.044 46.799 13.402 1.00325.03 C ANISOU 9335 CG MET J 40 38965 45798 38730 1292 -3253 -1458 C ATOM 9336 SD MET J 40 42.608 45.903 14.023 1.00334.79 S ANISOU 9336 SD MET J 40 39601 47777 39825 834 -3263 -1941 S ATOM 9337 CE MET J 40 41.586 45.657 12.570 1.00333.82 C ANISOU 9337 CE MET J 40 38863 48823 39150 1029 -3398 -2300 C ATOM 9338 N GLN J 41 46.161 48.238 11.257 1.00278.86 N ANISOU 9338 N GLN J 41 33925 39219 32810 2172 -3249 -803 N ATOM 9339 CA GLN J 41 46.734 49.410 10.611 1.00276.21 C ANISOU 9339 CA GLN J 41 33968 38635 32342 2781 -3197 -442 C ATOM 9340 C GLN J 41 47.647 50.314 11.427 1.00269.60 C ANISOU 9340 C GLN J 41 33695 36960 31778 2889 -3034 -91 C ATOM 9341 O GLN J 41 47.420 50.592 12.606 1.00257.74 O ANISOU 9341 O GLN J 41 32254 35252 30423 2811 -2969 -46 O ATOM 9342 CB GLN J 41 45.612 50.237 9.956 1.00285.26 C ANISOU 9342 CB GLN J 41 34842 40582 32960 3498 -3254 -411 C ATOM 9343 CG GLN J 41 44.171 49.896 10.366 1.00294.42 C ANISOU 9343 CG GLN J 41 35414 42584 33867 3468 -3351 -721 C ATOM 9344 CD GLN J 41 43.468 48.876 9.456 1.00302.97 C ANISOU 9344 CD GLN J 41 35911 44524 34680 3227 -3496 -1145 C ATOM 9345 OE1 GLN J 41 43.777 48.747 8.266 1.00309.27 O ANISOU 9345 OE1 GLN J 41 36682 45516 35307 3374 -3550 -1159 O ATOM 9346 NE2 GLN J 41 42.496 48.170 10.014 1.00305.08 N ANISOU 9346 NE2 GLN J 41 35698 45328 34887 2847 -3541 -1512 N ATOM 9347 N PHE J 42 48.669 50.785 10.719 1.00276.26 N ANISOU 9347 N PHE J 42 34939 37369 32659 3071 -2959 136 N ATOM 9348 CA PHE J 42 49.792 51.541 11.253 1.00282.13 C ANISOU 9348 CA PHE J 42 36241 37294 33662 3077 -2779 422 C ATOM 9349 C PHE J 42 49.720 52.959 10.724 1.00288.52 C ANISOU 9349 C PHE J 42 37379 38066 34177 3789 -2635 724 C ATOM 9350 O PHE J 42 49.332 53.162 9.573 1.00300.72 O ANISOU 9350 O PHE J 42 38817 40067 35375 4221 -2687 749 O ATOM 9351 CB PHE J 42 51.099 50.929 10.730 1.00282.12 C ANISOU 9351 CB PHE J 42 36456 36831 33903 2701 -2772 423 C ATOM 9352 CG PHE J 42 51.489 49.618 11.385 1.00281.47 C ANISOU 9352 CG PHE J 42 36227 36559 34157 2013 -2836 199 C ATOM 9353 CD1 PHE J 42 50.526 48.671 11.759 1.00283.26 C ANISOU 9353 CD1 PHE J 42 36014 37243 34365 1719 -2943 -90 C ATOM 9354 CD2 PHE J 42 52.841 49.311 11.592 1.00277.86 C ANISOU 9354 CD2 PHE J 42 36085 35479 34008 1669 -2765 272 C ATOM 9355 CE1 PHE J 42 50.911 47.473 12.355 1.00281.47 C ANISOU 9355 CE1 PHE J 42 35734 36778 34432 1115 -2947 -273 C ATOM 9356 CE2 PHE J 42 53.222 48.116 12.187 1.00275.30 C ANISOU 9356 CE2 PHE J 42 35671 34974 33955 1116 -2796 99 C ATOM 9357 CZ PHE J 42 52.255 47.198 12.565 1.00276.88 C ANISOU 9357 CZ PHE J 42 35497 35562 34142 848 -2874 -161 C ATOM 9358 N SER J 43 50.119 53.938 11.532 1.00285.05 N ANISOU 9358 N SER J 43 37367 37079 33858 3917 -2430 951 N ATOM 9359 CA SER J 43 50.225 55.303 11.024 1.00287.41 C ANISOU 9359 CA SER J 43 38110 37191 33900 4556 -2213 1255 C ATOM 9360 C SER J 43 51.545 55.506 10.282 1.00294.01 C ANISOU 9360 C SER J 43 39378 37485 34848 4466 -2082 1393 C ATOM 9361 O SER J 43 52.545 54.873 10.606 1.00287.73 O ANISOU 9361 O SER J 43 38650 36273 34401 3895 -2099 1306 O ATOM 9362 CB SER J 43 50.006 56.352 12.124 1.00279.48 C ANISOU 9362 CB SER J 43 37412 35851 32924 4767 -2000 1426 C ATOM 9363 OG SER J 43 51.032 56.381 13.086 1.00265.66 O ANISOU 9363 OG SER J 43 35963 33401 31572 4266 -1868 1444 O ATOM 9364 N LYS J 44 51.526 56.362 9.259 1.00311.71 N ANISOU 9364 N LYS J 44 41898 39774 36762 5055 -1947 1605 N ATOM 9365 CA LYS J 44 52.720 56.659 8.452 1.00329.07 C ANISOU 9365 CA LYS J 44 44529 41487 39014 5024 -1791 1746 C ATOM 9366 C LYS J 44 53.758 57.459 9.260 1.00332.38 C ANISOU 9366 C LYS J 44 45517 41078 39695 4797 -1481 1890 C ATOM 9367 O LYS J 44 54.968 57.272 9.063 1.00333.77 O ANISOU 9367 O LYS J 44 45919 40806 40091 4410 -1409 1878 O ATOM 9368 CB LYS J 44 52.347 57.362 7.118 1.00335.87 C ANISOU 9368 CB LYS J 44 45547 42651 39415 5758 -1707 1941 C ATOM 9369 CG LYS J 44 53.507 57.942 6.298 1.00338.94 C ANISOU 9369 CG LYS J 44 46488 42489 39802 5830 -1466 2135 C ATOM 9370 CD LYS J 44 54.003 57.028 5.189 1.00337.92 C ANISOU 9370 CD LYS J 44 46128 42579 39684 5617 -1667 2009 C ATOM 9371 CE LYS J 44 53.169 57.211 3.933 1.00342.09 C ANISOU 9371 CE LYS J 44 46486 43769 39721 6300 -1745 2085 C ATOM 9372 NZ LYS J 44 53.864 56.654 2.744 1.00340.34 N ANISOU 9372 NZ LYS J 44 46230 43598 39483 6174 -1839 2037 N ATOM 9373 N GLN J 45 53.298 58.333 10.167 1.00335.01 N ANISOU 9373 N GLN J 45 46061 41238 39990 5017 -1293 2001 N ATOM 9374 CA GLN J 45 54.231 59.045 11.054 1.00336.80 C ANISOU 9374 CA GLN J 45 46776 40724 40466 4724 -991 2078 C ATOM 9375 C GLN J 45 54.945 58.055 11.994 1.00342.45 C ANISOU 9375 C GLN J 45 47244 41257 41612 3952 -1149 1852 C ATOM 9376 O GLN J 45 56.081 58.307 12.417 1.00349.28 O ANISOU 9376 O GLN J 45 48426 41580 42702 3572 -961 1850 O ATOM 9377 CB GLN J 45 53.578 60.181 11.875 1.00330.20 C ANISOU 9377 CB GLN J 45 46234 39727 39501 5104 -735 2230 C ATOM 9378 CG GLN J 45 52.434 60.957 11.242 1.00323.54 C ANISOU 9378 CG GLN J 45 45467 39277 38187 5955 -655 2428 C ATOM 9379 CD GLN J 45 51.098 60.368 11.626 1.00319.06 C ANISOU 9379 CD GLN J 45 44286 39445 37497 6113 -963 2291 C ATOM 9380 OE1 GLN J 45 50.680 59.364 11.063 1.00312.52 O ANISOU 9380 OE1 GLN J 45 42925 39207 36609 6025 -1288 2116 O ATOM 9381 NE2 GLN J 45 50.421 60.988 12.589 1.00321.17 N ANISOU 9381 NE2 GLN J 45 44623 39689 37715 6321 -846 2349 N ATOM 9382 N THR J 46 54.277 56.941 12.313 1.00341.83 N ANISOU 9382 N THR J 46 46608 41654 41617 3732 -1469 1653 N ATOM 9383 CA THR J 46 54.897 55.855 13.080 1.00333.28 C ANISOU 9383 CA THR J 46 45286 40447 40898 3063 -1622 1451 C ATOM 9384 C THR J 46 56.034 55.200 12.252 1.00325.49 C ANISOU 9384 C THR J 46 44346 39297 40027 2758 -1677 1397 C ATOM 9385 O THR J 46 57.134 54.984 12.767 1.00330.00 O ANISOU 9385 O THR J 46 45056 39471 40855 2321 -1609 1349 O ATOM 9386 CB THR J 46 53.843 54.838 13.606 1.00328.63 C ANISOU 9386 CB THR J 46 44144 40377 40343 2909 -1894 1250 C ATOM 9387 OG1 THR J 46 52.816 55.530 14.334 1.00324.15 O ANISOU 9387 OG1 THR J 46 43544 39975 39644 3224 -1832 1308 O ATOM 9388 CG2 THR J 46 54.477 53.812 14.531 1.00323.97 C ANISOU 9388 CG2 THR J 46 43397 39584 40110 2273 -1987 1080 C ATOM 9389 N ILE J 47 55.778 54.927 10.970 1.00313.21 N ANISOU 9389 N ILE J 47 42670 38076 38256 3014 -1791 1403 N ATOM 9390 CA ILE J 47 56.828 54.462 10.052 1.00299.91 C ANISOU 9390 CA ILE J 47 41077 36236 36637 2809 -1817 1381 C ATOM 9391 C ILE J 47 57.995 55.460 10.007 1.00298.62 C ANISOU 9391 C ILE J 47 41462 35476 36521 2790 -1508 1538 C ATOM 9392 O ILE J 47 59.161 55.052 10.054 1.00291.08 O ANISOU 9392 O ILE J 47 40590 34230 35774 2371 -1489 1468 O ATOM 9393 CB ILE J 47 56.307 54.230 8.609 1.00298.64 C ANISOU 9393 CB ILE J 47 40744 36544 36180 3175 -1951 1387 C ATOM 9394 CG1 ILE J 47 54.925 53.536 8.588 1.00295.18 C ANISOU 9394 CG1 ILE J 47 39771 36798 35585 3293 -2197 1220 C ATOM 9395 CG2 ILE J 47 57.368 53.527 7.759 1.00298.09 C ANISOU 9395 CG2 ILE J 47 40698 36342 36217 2883 -2017 1323 C ATOM 9396 CD1 ILE J 47 54.902 52.073 8.991 1.00287.80 C ANISOU 9396 CD1 ILE J 47 38425 36036 34888 2728 -2417 944 C ATOM 9397 N ALA J 48 57.669 56.756 9.918 1.00306.07 N ANISOU 9397 N ALA J 48 42786 36256 37251 3245 -1244 1737 N ATOM 9398 CA ALA J 48 58.659 57.846 9.973 1.00315.75 C ANISOU 9398 CA ALA J 48 44591 36882 38495 3215 -869 1868 C ATOM 9399 C ALA J 48 59.492 57.884 11.286 1.00320.07 C ANISOU 9399 C ALA J 48 45231 37026 39351 2667 -749 1755 C ATOM 9400 O ALA J 48 60.726 58.069 11.237 1.00329.75 O ANISOU 9400 O ALA J 48 46715 37879 40693 2334 -575 1719 O ATOM 9401 CB ALA J 48 58.016 59.208 9.661 1.00315.88 C ANISOU 9401 CB ALA J 48 45037 36791 38191 3850 -567 2108 C ATOM 9402 N ALA J 49 58.859 57.685 12.448 1.00324.13 N ANISOU 9402 N ALA J 49 45513 37656 39984 2560 -842 1681 N ATOM 9403 CA ALA J 49 59.607 57.699 13.729 1.00329.78 C ANISOU 9403 CA ALA J 49 46280 38056 40966 2069 -741 1567 C ATOM 9404 C ALA J 49 60.617 56.543 13.915 1.00338.71 C ANISOU 9404 C ALA J 49 47151 39202 42341 1531 -929 1389 C ATOM 9405 O ALA J 49 61.626 56.719 14.625 1.00338.98 O ANISOU 9405 O ALA J 49 47320 38949 42528 1151 -780 1306 O ATOM 9406 CB ALA J 49 58.669 57.820 14.928 1.00325.94 C ANISOU 9406 CB ALA J 49 45629 37684 40527 2118 -778 1546 C ATOM 9407 N ILE J 50 60.347 55.395 13.266 1.00349.88 N ANISOU 9407 N ILE J 50 48206 40969 43762 1516 -1231 1321 N ATOM 9408 CA ILE J 50 61.226 54.193 13.283 1.00349.65 C ANISOU 9408 CA ILE J 50 47950 40976 43925 1087 -1409 1173 C ATOM 9409 C ILE J 50 62.571 54.392 12.582 1.00350.01 C ANISOU 9409 C ILE J 50 48250 40765 43972 927 -1273 1177 C ATOM 9410 O ILE J 50 63.608 53.948 13.074 1.00350.76 O ANISOU 9410 O ILE J 50 48308 40742 44224 545 -1269 1069 O ATOM 9411 CB ILE J 50 60.570 52.946 12.648 1.00339.98 C ANISOU 9411 CB ILE J 50 46332 40163 42679 1114 -1715 1088 C ATOM 9412 CG1 ILE J 50 59.270 52.587 13.357 1.00341.53 C ANISOU 9412 CG1 ILE J 50 46222 40667 42876 1188 -1854 1030 C ATOM 9413 CG2 ILE J 50 61.526 51.761 12.708 1.00328.49 C ANISOU 9413 CG2 ILE J 50 44725 38675 41408 705 -1841 956 C ATOM 9414 CD1 ILE J 50 58.509 51.466 12.693 1.00335.52 C ANISOU 9414 CD1 ILE J 50 45087 40343 42052 1196 -2102 908 C ATOM 9415 N SER J 51 62.540 55.031 11.416 1.00351.31 N ANISOU 9415 N SER J 51 48659 40884 43937 1239 -1161 1299 N ATOM 9416 CA SER J 51 63.758 55.311 10.652 1.00347.84 C ANISOU 9416 CA SER J 51 48489 40201 43470 1108 -1002 1307 C ATOM 9417 C SER J 51 64.697 56.304 11.391 1.00338.53 C ANISOU 9417 C SER J 51 47669 38610 42345 851 -656 1280 C ATOM 9418 O SER J 51 65.917 56.123 11.387 1.00331.79 O ANISOU 9418 O SER J 51 46858 37633 41571 496 -589 1171 O ATOM 9419 CB SER J 51 63.386 55.770 9.232 1.00361.23 C ANISOU 9419 CB SER J 51 50373 41962 44915 1548 -952 1458 C ATOM 9420 OG SER J 51 62.374 54.923 8.678 1.00362.80 O ANISOU 9420 OG SER J 51 50195 42618 45033 1778 -1259 1444 O ATOM 9421 N GLU J 52 64.103 57.314 12.040 1.00330.97 N ANISOU 9421 N GLU J 52 46945 37479 41328 1023 -434 1358 N ATOM 9422 CA GLU J 52 64.802 58.273 12.906 1.00317.45 C ANISOU 9422 CA GLU J 52 45555 35398 39662 755 -82 1297 C ATOM 9423 C GLU J 52 65.562 57.611 14.034 1.00295.04 C ANISOU 9423 C GLU J 52 42435 32626 37039 255 -184 1093 C ATOM 9424 O GLU J 52 66.752 57.838 14.162 1.00292.54 O ANISOU 9424 O GLU J 52 42245 32155 36752 -101 -3 966 O ATOM 9425 CB GLU J 52 63.826 59.250 13.533 1.00330.97 C ANISOU 9425 CB GLU J 52 47489 36974 41289 1048 114 1407 C ATOM 9426 CG GLU J 52 63.549 60.476 12.698 1.00354.54 C ANISOU 9426 CG GLU J 52 51009 39676 44022 1471 465 1601 C ATOM 9427 CD GLU J 52 62.254 61.158 13.103 1.00370.26 C ANISOU 9427 CD GLU J 52 53117 41685 45878 1939 548 1754 C ATOM 9428 OE1 GLU J 52 61.915 61.098 14.309 1.00367.94 O ANISOU 9428 OE1 GLU J 52 52651 41429 45720 1777 500 1671 O ATOM 9429 OE2 GLU J 52 61.575 61.745 12.217 1.00387.37 O ANISOU 9429 OE2 GLU J 52 55541 43855 47784 2497 662 1961 O ATOM 9430 N LEU J 53 64.883 56.822 14.871 1.00272.77 N ANISOU 9430 N LEU J 53 39239 30057 34343 234 -451 1054 N ATOM 9431 CA LEU J 53 65.585 56.096 15.963 1.00254.64 C ANISOU 9431 CA LEU J 53 36666 27859 32225 -183 -558 881 C ATOM 9432 C LEU J 53 66.525 54.987 15.472 1.00251.26 C ANISOU 9432 C LEU J 53 36015 27598 31853 -399 -753 789 C ATOM 9433 O LEU J 53 67.555 54.754 16.106 1.00247.02 O ANISOU 9433 O LEU J 53 35393 27081 31380 -734 -712 646 O ATOM 9434 CB LEU J 53 64.655 55.544 17.071 1.00243.77 C ANISOU 9434 CB LEU J 53 34984 26674 30962 -162 -752 866 C ATOM 9435 CG LEU J 53 65.361 54.898 18.295 1.00234.52 C ANISOU 9435 CG LEU J 53 33571 25595 29939 -537 -819 710 C ATOM 9436 CD1 LEU J 53 65.971 55.942 19.226 1.00233.22 C ANISOU 9436 CD1 LEU J 53 33612 25230 29769 -768 -513 614 C ATOM 9437 CD2 LEU J 53 64.457 53.962 19.086 1.00231.06 C ANISOU 9437 CD2 LEU J 53 32799 25383 29610 -499 -1068 709 C ATOM 9438 N THR J 54 66.160 54.315 14.369 1.00252.64 N ANISOU 9438 N THR J 54 36085 27922 31982 -192 -956 861 N ATOM 9439 CA THR J 54 67.028 53.330 13.711 1.00252.06 C ANISOU 9439 CA THR J 54 35860 27974 31937 -348 -1112 792 C ATOM 9440 C THR J 54 68.364 54.005 13.464 1.00256.11 C ANISOU 9440 C THR J 54 36617 28301 32391 -575 -862 720 C ATOM 9441 O THR J 54 69.392 53.559 13.966 1.00261.56 O ANISOU 9441 O THR J 54 37173 29071 33135 -875 -873 582 O ATOM 9442 CB THR J 54 66.435 52.818 12.376 1.00250.60 C ANISOU 9442 CB THR J 54 35612 27936 31666 -73 -1291 878 C ATOM 9443 OG1 THR J 54 65.334 51.937 12.642 1.00246.91 O ANISOU 9443 OG1 THR J 54 34844 27715 31255 29 -1536 872 O ATOM 9444 CG2 THR J 54 67.489 52.085 11.542 1.00249.24 C ANISOU 9444 CG2 THR J 54 35390 27815 31492 -224 -1374 816 C ATOM 9445 N PHE J 55 68.314 55.110 12.721 1.00255.58 N ANISOU 9445 N PHE J 55 36915 28003 32188 -418 -613 808 N ATOM 9446 CA PHE J 55 69.488 55.928 12.437 1.00247.70 C ANISOU 9446 CA PHE J 55 36219 26784 31110 -653 -299 728 C ATOM 9447 C PHE J 55 70.157 56.505 13.718 1.00248.08 C ANISOU 9447 C PHE J 55 36309 26743 31205 -1025 -66 554 C ATOM 9448 O PHE J 55 71.381 56.439 13.826 1.00255.87 O ANISOU 9448 O PHE J 55 37255 27787 32174 -1371 27 379 O ATOM 9449 CB PHE J 55 69.140 57.011 11.399 1.00238.38 C ANISOU 9449 CB PHE J 55 35483 25332 29756 -358 -37 885 C ATOM 9450 CG PHE J 55 70.210 57.246 10.363 1.00224.07 C ANISOU 9450 CG PHE J 55 33888 23404 27843 -489 128 847 C ATOM 9451 CD1 PHE J 55 70.186 56.577 9.134 1.00216.42 C ANISOU 9451 CD1 PHE J 55 32823 22584 26820 -288 -82 930 C ATOM 9452 CD2 PHE J 55 71.229 58.164 10.602 1.00221.29 C ANISOU 9452 CD2 PHE J 55 33842 22800 27435 -833 520 709 C ATOM 9453 CE1 PHE J 55 71.171 56.819 8.180 1.00211.75 C ANISOU 9453 CE1 PHE J 55 32439 21883 26129 -407 80 898 C ATOM 9454 CE2 PHE J 55 72.209 58.412 9.645 1.00215.66 C ANISOU 9454 CE2 PHE J 55 33339 21985 26617 -979 701 659 C ATOM 9455 CZ PHE J 55 72.181 57.734 8.438 1.00212.37 C ANISOU 9455 CZ PHE J 55 32824 21709 26156 -753 471 765 C ATOM 9456 N ARG J 56 69.370 57.028 14.682 1.00237.14 N ANISOU 9456 N ARG J 56 34972 25270 29858 -958 16 583 N ATOM 9457 CA ARG J 56 69.859 57.477 16.024 1.00221.88 C ANISOU 9457 CA ARG J 56 33018 23311 27975 -1305 202 404 C ATOM 9458 C ARG J 56 70.541 56.374 16.781 1.00212.92 C ANISOU 9458 C ARG J 56 31448 22519 26933 -1561 -42 251 C ATOM 9459 O ARG J 56 71.563 56.597 17.429 1.00205.95 O ANISOU 9459 O ARG J 56 30513 21718 26021 -1920 114 44 O ATOM 9460 CB ARG J 56 68.723 57.971 16.923 1.00218.95 C ANISOU 9460 CB ARG J 56 32698 22844 27647 -1129 247 485 C ATOM 9461 CG ARG J 56 68.708 59.464 17.110 1.00219.00 C ANISOU 9461 CG ARG J 56 33185 22472 27553 -1167 706 475 C ATOM 9462 CD ARG J 56 67.629 59.920 18.059 1.00217.85 C ANISOU 9462 CD ARG J 56 33075 22251 27445 -990 747 546 C ATOM 9463 NE ARG J 56 66.349 60.060 17.386 1.00218.67 N ANISOU 9463 NE ARG J 56 33295 22311 27476 -456 658 797 N ATOM 9464 CZ ARG J 56 65.231 59.535 17.859 1.00218.00 C ANISOU 9464 CZ ARG J 56 32928 22444 27455 -210 383 885 C ATOM 9465 NH1 ARG J 56 65.293 58.874 18.998 1.00219.34 N ANISOU 9465 NH1 ARG J 56 32744 22819 27777 -459 201 760 N ATOM 9466 NH2 ARG J 56 64.071 59.682 17.224 1.00216.70 N ANISOU 9466 NH2 ARG J 56 32830 22324 27182 281 306 1086 N ATOM 9467 N GLN J 57 69.933 55.197 16.694 1.00208.50 N ANISOU 9467 N GLN J 57 30585 22173 26460 -1360 -402 347 N ATOM 9468 CA GLN J 57 70.361 54.023 17.411 1.00204.32 C ANISOU 9468 CA GLN J 57 29679 21943 26010 -1497 -640 257 C ATOM 9469 C GLN J 57 71.670 53.482 16.879 1.00204.66 C ANISOU 9469 C GLN J 57 29625 22148 25986 -1677 -671 145 C ATOM 9470 O GLN J 57 72.515 53.052 17.644 1.00200.22 O ANISOU 9470 O GLN J 57 28847 21821 25407 -1883 -694 1 O ATOM 9471 CB GLN J 57 69.302 52.943 17.291 1.00200.36 C ANISOU 9471 CB GLN J 57 28963 21563 25602 -1240 -954 388 C ATOM 9472 CG GLN J 57 69.275 52.021 18.489 1.00195.82 C ANISOU 9472 CG GLN J 57 28089 21194 25118 -1329 -1113 332 C ATOM 9473 CD GLN J 57 68.580 52.657 19.682 1.00193.66 C ANISOU 9473 CD GLN J 57 27824 20862 24895 -1345 -1017 327 C ATOM 9474 OE1 GLN J 57 68.754 53.841 19.939 1.00194.11 O ANISOU 9474 OE1 GLN J 57 28094 20755 24901 -1441 -761 278 O ATOM 9475 NE2 GLN J 57 67.787 51.874 20.413 1.00190.16 N ANISOU 9475 NE2 GLN J 57 27171 20534 24545 -1264 -1196 369 N ATOM 9476 N CYS J 58 71.821 53.501 15.558 1.00211.37 N ANISOU 9476 N CYS J 58 30625 22908 26777 -1570 -673 214 N ATOM 9477 CA CYS J 58 72.995 52.948 14.873 1.00216.15 C ANISOU 9477 CA CYS J 58 31144 23669 27311 -1699 -720 125 C ATOM 9478 C CYS J 58 74.257 53.736 15.167 1.00212.56 C ANISOU 9478 C CYS J 58 30772 23249 26741 -2054 -434 -87 C ATOM 9479 O CYS J 58 75.361 53.213 15.095 1.00211.43 O ANISOU 9479 O CYS J 58 30447 23363 26522 -2219 -477 -222 O ATOM 9480 CB CYS J 58 72.774 52.922 13.358 1.00227.84 C ANISOU 9480 CB CYS J 58 32796 25026 28746 -1494 -763 252 C ATOM 9481 SG CYS J 58 71.493 51.795 12.742 1.00239.94 S ANISOU 9481 SG CYS J 58 34162 26639 30363 -1136 -1112 430 S ATOM 9482 N GLU J 59 74.066 55.014 15.454 1.00209.40 N ANISOU 9482 N GLU J 59 30659 22595 26306 -2167 -119 -125 N ATOM 9483 CA GLU J 59 75.108 55.900 15.898 1.00209.80 C ANISOU 9483 CA GLU J 59 30811 22656 26244 -2567 217 -371 C ATOM 9484 C GLU J 59 75.760 55.290 17.122 1.00212.81 C ANISOU 9484 C GLU J 59 30794 23447 26615 -2775 106 -559 C ATOM 9485 O GLU J 59 76.965 55.053 17.145 1.00217.14 O ANISOU 9485 O GLU J 59 31158 24304 27040 -3017 139 -762 O ATOM 9486 CB GLU J 59 74.460 57.224 16.249 1.00206.80 C ANISOU 9486 CB GLU J 59 30809 21904 25860 -2594 553 -350 C ATOM 9487 CG GLU J 59 75.369 58.245 16.876 1.00209.07 C ANISOU 9487 CG GLU J 59 31238 22161 26036 -3057 963 -636 C ATOM 9488 CD GLU J 59 74.913 59.633 16.633 1.00214.13 C ANISOU 9488 CD GLU J 59 32423 22307 26627 -3064 1392 -591 C ATOM 9489 OE1 GLU J 59 73.693 59.849 16.569 1.00213.00 O ANISOU 9489 OE1 GLU J 59 32461 21915 26553 -2687 1343 -347 O ATOM 9490 OE2 GLU J 59 75.792 60.509 16.511 1.00220.95 O ANISOU 9490 OE2 GLU J 59 33542 23046 27363 -3449 1801 -812 O ATOM 9491 N ASN J 60 74.938 55.009 18.121 1.00216.44 N ANISOU 9491 N ASN J 60 31111 23943 27183 -2646 -31 -486 N ATOM 9492 CA ASN J 60 75.407 54.418 19.351 1.00224.00 C ANISOU 9492 CA ASN J 60 31705 25285 28119 -2770 -139 -628 C ATOM 9493 C ASN J 60 75.908 53.039 19.161 1.00221.65 C ANISOU 9493 C ASN J 60 31098 25319 27798 -2629 -438 -594 C ATOM 9494 O ASN J 60 76.921 52.709 19.727 1.00224.64 O ANISOU 9494 O ASN J 60 31219 26088 28045 -2785 -438 -775 O ATOM 9495 CB ASN J 60 74.303 54.409 20.365 1.00231.57 C ANISOU 9495 CB ASN J 60 32618 26161 29204 -2628 -217 -524 C ATOM 9496 CG ASN J 60 73.677 55.755 20.479 1.00240.26 C ANISOU 9496 CG ASN J 60 34069 26892 30325 -2693 80 -519 C ATOM 9497 OD1 ASN J 60 74.378 56.741 20.692 1.00244.55 O ANISOU 9497 OD1 ASN J 60 34767 27388 30762 -3021 413 -729 O ATOM 9498 ND2 ASN J 60 72.363 55.833 20.271 1.00245.69 N ANISOU 9498 ND2 ASN J 60 34906 27317 31125 -2381 -6 -291 N ATOM 9499 N PHE J 61 75.224 52.231 18.366 1.00216.13 N ANISOU 9499 N PHE J 61 30425 24494 27200 -2328 -674 -377 N ATOM 9500 CA PHE J 61 75.730 50.907 18.060 1.00212.90 C ANISOU 9500 CA PHE J 61 29789 24344 26758 -2190 -916 -342 C ATOM 9501 C PHE J 61 77.120 50.927 17.441 1.00215.48 C ANISOU 9501 C PHE J 61 30061 24898 26911 -2363 -834 -505 C ATOM 9502 O PHE J 61 78.014 50.238 17.931 1.00211.48 O ANISOU 9502 O PHE J 61 29286 24785 26280 -2384 -908 -613 O ATOM 9503 CB PHE J 61 74.772 50.170 17.151 1.00209.97 C ANISOU 9503 CB PHE J 61 29497 23771 26510 -1902 -1127 -124 C ATOM 9504 CG PHE J 61 73.509 49.769 17.825 1.00209.87 C ANISOU 9504 CG PHE J 61 29437 23664 26640 -1731 -1257 5 C ATOM 9505 CD1 PHE J 61 73.446 49.689 19.210 1.00210.84 C ANISOU 9505 CD1 PHE J 61 29403 23929 26777 -1788 -1245 -48 C ATOM 9506 CD2 PHE J 61 72.387 49.437 17.083 1.00209.67 C ANISOU 9506 CD2 PHE J 61 29496 23454 26713 -1519 -1390 163 C ATOM 9507 CE1 PHE J 61 72.279 49.297 19.842 1.00211.91 C ANISOU 9507 CE1 PHE J 61 29495 23981 27040 -1646 -1355 64 C ATOM 9508 CE2 PHE J 61 71.211 49.048 17.707 1.00209.81 C ANISOU 9508 CE2 PHE J 61 29444 23428 26845 -1394 -1498 251 C ATOM 9509 CZ PHE J 61 71.161 48.969 19.089 1.00211.16 C ANISOU 9509 CZ PHE J 61 29484 23702 27046 -1462 -1478 207 C ATOM 9510 N ALA J 62 77.294 51.724 16.380 1.00221.57 N ANISOU 9510 N ALA J 62 31091 25443 27651 -2464 -667 -520 N ATOM 9511 CA ALA J 62 78.595 51.883 15.695 1.00227.45 C ANISOU 9511 CA ALA J 62 31816 26378 28223 -2670 -549 -693 C ATOM 9512 C ALA J 62 79.721 52.435 16.605 1.00231.65 C ANISOU 9512 C ALA J 62 32170 27273 28574 -3036 -333 -1006 C ATOM 9513 O ALA J 62 80.827 51.887 16.651 1.00233.67 O ANISOU 9513 O ALA J 62 32156 27969 28659 -3108 -388 -1160 O ATOM 9514 CB ALA J 62 78.444 52.734 14.427 1.00227.43 C ANISOU 9514 CB ALA J 62 32182 26008 28222 -2705 -368 -635 C ATOM 9515 N LYS J 63 79.443 53.509 17.335 1.00231.82 N ANISOU 9515 N LYS J 63 32325 27146 28607 -3263 -80 -1115 N ATOM 9516 CA LYS J 63 80.460 54.067 18.217 1.00227.45 C ANISOU 9516 CA LYS J 63 31585 26968 27866 -3654 146 -1453 C ATOM 9517 C LYS J 63 80.756 53.134 19.394 1.00221.86 C ANISOU 9517 C LYS J 63 30436 26774 27084 -3541 -73 -1509 C ATOM 9518 O LYS J 63 81.899 53.007 19.805 1.00220.16 O ANISOU 9518 O LYS J 63 29918 27091 26640 -3729 -24 -1768 O ATOM 9519 CB LYS J 63 80.105 55.489 18.631 1.00230.11 C ANISOU 9519 CB LYS J 63 32229 26977 28226 -3952 521 -1574 C ATOM 9520 CG LYS J 63 80.224 56.456 17.466 1.00234.88 C ANISOU 9520 CG LYS J 63 33274 27164 28804 -4115 829 -1585 C ATOM 9521 CD LYS J 63 79.501 57.761 17.756 1.00240.20 C ANISOU 9521 CD LYS J 63 34374 27352 29539 -4248 1188 -1584 C ATOM 9522 CE LYS J 63 79.584 58.719 16.574 1.00246.02 C ANISOU 9522 CE LYS J 63 35621 27628 30226 -4351 1536 -1560 C ATOM 9523 NZ LYS J 63 78.441 58.557 15.631 1.00245.45 N ANISOU 9523 NZ LYS J 63 35829 27137 30293 -3859 1373 -1171 N ATOM 9524 N ASP J 64 79.741 52.428 19.884 1.00217.31 N ANISOU 9524 N ASP J 64 29820 26070 26675 -3208 -312 -1265 N ATOM 9525 CA ASP J 64 79.951 51.358 20.852 1.00214.71 C ANISOU 9525 CA ASP J 64 29132 26171 26276 -3005 -532 -1250 C ATOM 9526 C ASP J 64 80.796 50.271 20.259 1.00212.16 C ANISOU 9526 C ASP J 64 28620 26175 25814 -2815 -713 -1227 C ATOM 9527 O ASP J 64 81.769 49.865 20.866 1.00215.51 O ANISOU 9527 O ASP J 64 28724 27153 26007 -2822 -732 -1393 O ATOM 9528 CB ASP J 64 78.633 50.740 21.302 1.00215.85 C ANISOU 9528 CB ASP J 64 29332 26041 26637 -2687 -732 -974 C ATOM 9529 CG ASP J 64 77.920 51.572 22.354 1.00220.07 C ANISOU 9529 CG ASP J 64 29921 26437 27256 -2820 -595 -1017 C ATOM 9530 OD1 ASP J 64 78.493 52.578 22.832 1.00223.11 O ANISOU 9530 OD1 ASP J 64 30289 26958 27522 -3164 -338 -1274 O ATOM 9531 OD2 ASP J 64 76.770 51.222 22.699 1.00221.56 O ANISOU 9531 OD2 ASP J 64 30174 26384 27624 -2598 -729 -810 O ATOM 9532 N LEU J 65 80.419 49.782 19.085 1.00207.48 N ANISOU 9532 N LEU J 65 28216 25274 25341 -2618 -842 -1025 N ATOM 9533 CA LEU J 65 81.194 48.737 18.456 1.00207.21 C ANISOU 9533 CA LEU J 65 28039 25509 25179 -2425 -1001 -995 C ATOM 9534 C LEU J 65 82.633 49.192 18.260 1.00216.98 C ANISOU 9534 C LEU J 65 29102 27194 26146 -2700 -842 -1291 C ATOM 9535 O LEU J 65 83.541 48.376 18.393 1.00221.26 O ANISOU 9535 O LEU J 65 29371 28220 26475 -2552 -945 -1356 O ATOM 9536 CB LEU J 65 80.570 48.290 17.149 1.00198.27 C ANISOU 9536 CB LEU J 65 27152 23969 24212 -2235 -1129 -772 C ATOM 9537 CG LEU J 65 79.215 47.648 17.359 1.00190.99 C ANISOU 9537 CG LEU J 65 26333 22720 23512 -1969 -1297 -521 C ATOM 9538 CD1 LEU J 65 78.480 47.582 16.044 1.00188.60 C ANISOU 9538 CD1 LEU J 65 26277 22023 23359 -1867 -1368 -359 C ATOM 9539 CD2 LEU J 65 79.365 46.273 17.957 1.00188.51 C ANISOU 9539 CD2 LEU J 65 25834 22649 23139 -1684 -1469 -433 C ATOM 9540 N GLU J 66 82.829 50.489 17.980 1.00224.67 N ANISOU 9540 N GLU J 66 30239 28018 27104 -3094 -568 -1479 N ATOM 9541 CA GLU J 66 84.170 51.103 17.820 1.00231.14 C ANISOU 9541 CA GLU J 66 30909 29255 27657 -3467 -347 -1825 C ATOM 9542 C GLU J 66 85.017 50.874 19.063 1.00242.69 C ANISOU 9542 C GLU J 66 31931 31424 28856 -3535 -343 -2074 C ATOM 9543 O GLU J 66 86.109 50.318 18.975 1.00248.63 O ANISOU 9543 O GLU J 66 32376 32745 29344 -3486 -405 -2220 O ATOM 9544 CB GLU J 66 84.092 52.616 17.487 1.00222.65 C ANISOU 9544 CB GLU J 66 30157 27818 26619 -3914 23 -1992 C ATOM 9545 CG GLU J 66 85.444 53.324 17.323 1.00214.78 C ANISOU 9545 CG GLU J 66 29035 27227 25342 -4388 313 -2396 C ATOM 9546 CD GLU J 66 85.406 54.818 17.575 1.00211.15 C ANISOU 9546 CD GLU J 66 28846 26506 24874 -4890 750 -2638 C ATOM 9547 OE1 GLU J 66 84.306 55.421 17.624 1.00206.19 O ANISOU 9547 OE1 GLU J 66 28589 25285 24468 -4838 848 -2452 O ATOM 9548 OE2 GLU J 66 86.507 55.391 17.727 1.00211.42 O ANISOU 9548 OE2 GLU J 66 28720 26954 24654 -5346 1019 -3036 O ATOM 9549 N MET J 67 84.501 51.288 20.213 1.00249.12 N ANISOU 9549 N MET J 67 32700 32231 29720 -3616 -274 -2118 N ATOM 9550 CA MET J 67 85.194 51.101 21.475 1.00252.54 C ANISOU 9550 CA MET J 67 32705 33353 29893 -3653 -272 -2348 C ATOM 9551 C MET J 67 85.467 49.640 21.756 1.00251.55 C ANISOU 9551 C MET J 67 32304 33632 29640 -3143 -574 -2172 C ATOM 9552 O MET J 67 86.465 49.326 22.377 1.00253.81 O ANISOU 9552 O MET J 67 32193 34647 29597 -3109 -583 -2383 O ATOM 9553 CB MET J 67 84.395 51.696 22.620 1.00251.97 C ANISOU 9553 CB MET J 67 32676 33118 29942 -3763 -177 -2363 C ATOM 9554 CG MET J 67 84.682 53.176 22.815 1.00253.83 C ANISOU 9554 CG MET J 67 33018 33308 30117 -4349 209 -2711 C ATOM 9555 SD MET J 67 83.538 54.016 23.910 1.00250.96 S ANISOU 9555 SD MET J 67 32844 32550 29958 -4477 355 -2681 S ATOM 9556 CE MET J 67 82.103 54.273 22.866 1.00248.83 C ANISOU 9556 CE MET J 67 33157 31308 30076 -4269 326 -2277 C ATOM 9557 N PHE J 68 84.589 48.759 21.283 1.00247.67 N ANISOU 9557 N PHE J 68 32035 32682 29384 -2746 -794 -1801 N ATOM 9558 CA PHE J 68 84.696 47.323 21.545 1.00242.07 C ANISOU 9558 CA PHE J 68 31172 32222 28580 -2238 -1034 -1594 C ATOM 9559 C PHE J 68 85.807 46.717 20.713 1.00233.14 C ANISOU 9559 C PHE J 68 29900 31469 27212 -2109 -1094 -1657 C ATOM 9560 O PHE J 68 86.595 45.904 21.187 1.00224.14 O ANISOU 9560 O PHE J 68 28468 30916 25779 -1813 -1179 -1688 O ATOM 9561 CB PHE J 68 83.392 46.595 21.174 1.00250.08 C ANISOU 9561 CB PHE J 68 32506 32590 29921 -1930 -1203 -1218 C ATOM 9562 CG PHE J 68 82.154 47.035 21.949 1.00260.58 C ANISOU 9562 CG PHE J 68 33982 33528 31498 -1986 -1178 -1113 C ATOM 9563 CD1 PHE J 68 82.236 47.690 23.194 1.00267.44 C ANISOU 9563 CD1 PHE J 68 34664 34676 32273 -2168 -1059 -1293 C ATOM 9564 CD2 PHE J 68 80.874 46.740 21.444 1.00261.02 C ANISOU 9564 CD2 PHE J 68 34340 32972 31862 -1845 -1278 -843 C ATOM 9565 CE1 PHE J 68 81.075 48.071 23.889 1.00270.35 C ANISOU 9565 CE1 PHE J 68 35173 34679 32869 -2201 -1040 -1187 C ATOM 9566 CE2 PHE J 68 79.718 47.105 22.138 1.00262.81 C ANISOU 9566 CE2 PHE J 68 34680 32879 32295 -1873 -1264 -749 C ATOM 9567 CZ PHE J 68 79.817 47.767 23.364 1.00267.64 C ANISOU 9567 CZ PHE J 68 35128 33735 32827 -2042 -1146 -909 C ATOM 9568 N ALA J 69 85.825 47.114 19.449 1.00231.75 N ANISOU 9568 N ALA J 69 29951 30946 27154 -2298 -1044 -1656 N ATOM 9569 CA ALA J 69 86.771 46.598 18.485 1.00236.05 C ANISOU 9569 CA ALA J 69 30415 31755 27518 -2199 -1099 -1698 C ATOM 9570 C ALA J 69 88.122 47.199 18.754 1.00244.22 C ANISOU 9570 C ALA J 69 31094 33510 28188 -2508 -934 -2098 C ATOM 9571 O ALA J 69 89.134 46.522 18.684 1.00248.46 O ANISOU 9571 O ALA J 69 31345 34639 28417 -2300 -1009 -2183 O ATOM 9572 CB ALA J 69 86.325 46.939 17.075 1.00234.49 C ANISOU 9572 CB ALA J 69 30575 30964 27557 -2330 -1078 -1586 C ATOM 9573 N ARG J 70 88.126 48.492 19.044 1.00250.54 N ANISOU 9573 N ARG J 70 31921 34264 29008 -3015 -686 -2358 N ATOM 9574 CA ARG J 70 89.312 49.205 19.427 1.00258.91 C ANISOU 9574 CA ARG J 70 32641 36009 29724 -3419 -473 -2803 C ATOM 9575 C ARG J 70 89.952 48.592 20.645 1.00271.51 C ANISOU 9575 C ARG J 70 33752 38427 30980 -3174 -568 -2929 C ATOM 9576 O ARG J 70 91.191 48.512 20.732 1.00271.83 O ANISOU 9576 O ARG J 70 33389 39270 30620 -3242 -524 -3231 O ATOM 9577 CB ARG J 70 88.895 50.619 19.742 1.00252.80 C ANISOU 9577 CB ARG J 70 32064 34903 29084 -3963 -170 -3006 C ATOM 9578 CG ARG J 70 89.931 51.478 20.390 1.00251.14 C ANISOU 9578 CG ARG J 70 31517 35362 28540 -4472 106 -3513 C ATOM 9579 CD ARG J 70 89.989 52.774 19.601 1.00251.16 C ANISOU 9579 CD ARG J 70 31870 34921 28635 -5060 469 -3722 C ATOM 9580 NE ARG J 70 89.995 52.534 18.148 1.00247.52 N ANISOU 9580 NE ARG J 70 31698 34050 28298 -4948 410 -3524 N ATOM 9581 CZ ARG J 70 90.966 51.920 17.464 1.00247.26 C ANISOU 9581 CZ ARG J 70 31435 34474 28038 -4844 307 -3602 C ATOM 9582 NH1 ARG J 70 92.047 51.437 18.083 1.00249.83 N ANISOU 9582 NH1 ARG J 70 31217 35732 27972 -4796 240 -3869 N ATOM 9583 NH2 ARG J 70 90.833 51.757 16.157 1.00242.84 N ANISOU 9583 NH2 ARG J 70 31178 33465 27625 -4746 260 -3403 N ATOM 9584 N HIS J 71 89.075 48.168 21.568 1.00286.98 N ANISOU 9584 N HIS J 71 35756 40197 33085 -2874 -691 -2696 N ATOM 9585 CA HIS J 71 89.436 47.446 22.821 1.00308.28 C ANISOU 9585 CA HIS J 71 38063 43578 35491 -2511 -803 -2714 C ATOM 9586 C HIS J 71 89.976 46.029 22.597 1.00304.37 C ANISOU 9586 C HIS J 71 37426 43449 34770 -1891 -1023 -2508 C ATOM 9587 O HIS J 71 90.633 45.460 23.496 1.00320.80 O ANISOU 9587 O HIS J 71 39127 46282 36478 -1564 -1079 -2581 O ATOM 9588 CB HIS J 71 88.250 47.374 23.836 1.00322.55 C ANISOU 9588 CB HIS J 71 40017 44994 37542 -2356 -857 -2491 C ATOM 9589 CG HIS J 71 88.620 46.806 25.196 1.00335.37 C ANISOU 9589 CG HIS J 71 41251 47325 38849 -2026 -925 -2535 C ATOM 9590 ND1 HIS J 71 89.559 47.384 26.029 1.00341.61 N ANISOU 9590 ND1 HIS J 71 41578 48962 39254 -2278 -789 -2950 N ATOM 9591 CD2 HIS J 71 88.150 45.725 25.868 1.00335.97 C ANISOU 9591 CD2 HIS J 71 41346 47385 38919 -1462 -1094 -2221 C ATOM 9592 CE1 HIS J 71 89.667 46.673 27.140 1.00341.52 C ANISOU 9592 CE1 HIS J 71 41296 49462 39001 -1841 -895 -2874 C ATOM 9593 NE2 HIS J 71 88.821 45.661 27.068 1.00338.28 N ANISOU 9593 NE2 HIS J 71 41197 48514 38819 -1334 -1069 -2421 N ATOM 9594 N ALA J 72 89.692 45.476 21.412 1.00283.81 N ANISOU 9594 N ALA J 72 35138 40326 32370 -1712 -1129 -2253 N ATOM 9595 CA ALA J 72 89.994 44.078 21.077 1.00269.74 C ANISOU 9595 CA ALA J 72 33355 38686 30448 -1108 -1314 -1998 C ATOM 9596 C ALA J 72 91.401 43.850 20.502 1.00271.79 C ANISOU 9596 C ALA J 72 33303 39657 30304 -1049 -1310 -2217 C ATOM 9597 O ALA J 72 91.708 42.759 20.000 1.00263.73 O ANISOU 9597 O ALA J 72 32332 38702 29171 -571 -1439 -2013 O ATOM 9598 CB ALA J 72 88.924 43.527 20.148 1.00256.76 C ANISOU 9598 CB ALA J 72 32198 36144 29216 -943 -1423 -1628 C ATOM 9599 N LYS J 73 92.249 44.878 20.611 1.00283.05 N ANISOU 9599 N LYS J 73 34413 41631 31499 -1545 -1140 -2649 N ATOM 9600 CA LYS J 73 93.593 44.875 20.038 1.00295.99 C ANISOU 9600 CA LYS J 73 35724 43987 32751 -1616 -1100 -2934 C ATOM 9601 C LYS J 73 93.442 44.955 18.514 1.00305.94 C ANISOU 9601 C LYS J 73 37344 44624 34273 -1778 -1104 -2822 C ATOM 9602 O LYS J 73 94.289 44.442 17.785 1.00302.08 O ANISOU 9602 O LYS J 73 36726 44492 33555 -1599 -1161 -2861 O ATOM 9603 CB LYS J 73 94.392 43.604 20.461 1.00296.36 C ANISOU 9603 CB LYS J 73 35448 44799 32355 -916 -1260 -2838 C ATOM 9604 CG LYS J 73 94.565 43.376 21.968 1.00300.35 C ANISOU 9604 CG LYS J 73 35593 45982 32544 -628 -1272 -2904 C ATOM 9605 CD LYS J 73 95.158 41.993 22.311 1.00297.71 C ANISOU 9605 CD LYS J 73 35076 46237 31801 203 -1419 -2694 C ATOM 9606 CE LYS J 73 94.134 40.981 22.838 1.00290.74 C ANISOU 9606 CE LYS J 73 34565 44767 31134 780 -1524 -2212 C ATOM 9607 NZ LYS J 73 93.823 41.166 24.281 1.00289.11 N ANISOU 9607 NZ LYS J 73 34166 44860 30822 855 -1490 -2249 N ATOM 9608 N ARG J 74 92.364 45.591 18.036 1.00328.17 N ANISOU 9608 N ARG J 74 40601 46540 37546 -2083 -1042 -2680 N ATOM 9609 CA ARG J 74 91.960 45.461 16.613 1.00354.44 C ANISOU 9609 CA ARG J 74 44325 49186 41158 -2091 -1090 -2469 C ATOM 9610 C ARG J 74 91.427 46.750 15.938 1.00369.78 C ANISOU 9610 C ARG J 74 46599 50504 43394 -2665 -885 -2562 C ATOM 9611 O ARG J 74 91.160 47.737 16.630 1.00379.57 O ANISOU 9611 O ARG J 74 47841 51692 44686 -3048 -698 -2743 O ATOM 9612 CB ARG J 74 90.910 44.337 16.443 1.00346.85 C ANISOU 9612 CB ARG J 74 43687 47621 40479 -1569 -1308 -2008 C ATOM 9613 CG ARG J 74 91.424 42.900 16.385 1.00332.77 C ANISOU 9613 CG ARG J 74 41793 46180 38462 -954 -1482 -1826 C ATOM 9614 CD ARG J 74 90.285 41.956 16.016 1.00320.46 C ANISOU 9614 CD ARG J 74 40646 43878 37236 -592 -1623 -1415 C ATOM 9615 NE ARG J 74 89.356 41.743 17.126 1.00313.04 N ANISOU 9615 NE ARG J 74 39786 42713 36441 -436 -1645 -1250 N ATOM 9616 CZ ARG J 74 88.118 42.235 17.207 1.00309.69 C ANISOU 9616 CZ ARG J 74 39634 41638 36395 -653 -1629 -1133 C ATOM 9617 NH1 ARG J 74 87.631 42.983 16.240 1.00312.32 N ANISOU 9617 NH1 ARG J 74 40200 41474 36993 -1001 -1587 -1146 N ATOM 9618 NH2 ARG J 74 87.352 41.973 18.263 1.00304.25 N ANISOU 9618 NH2 ARG J 74 38985 40813 35801 -492 -1649 -996 N ATOM 9619 N THR J 75 91.264 46.691 14.593 1.00373.58 N ANISOU 9619 N THR J 75 47380 50512 44051 -2677 -912 -2421 N ATOM 9620 CA THR J 75 90.621 47.736 13.705 1.00361.41 C ANISOU 9620 CA THR J 75 46256 48262 42802 -3070 -738 -2400 C ATOM 9621 C THR J 75 89.202 47.403 13.003 1.00352.72 C ANISOU 9621 C THR J 75 45610 46290 42116 -2810 -886 -1983 C ATOM 9622 O THR J 75 88.427 48.336 12.750 1.00348.83 O ANISOU 9622 O THR J 75 45435 45252 41850 -3060 -736 -1943 O ATOM 9623 CB THR J 75 91.663 48.427 12.714 1.00361.11 C ANISOU 9623 CB THR J 75 46194 48432 42576 -3480 -530 -2691 C ATOM 9624 OG1 THR J 75 91.971 47.588 11.585 1.00356.35 O ANISOU 9624 OG1 THR J 75 45642 47799 41956 -3188 -703 -2530 O ATOM 9625 CG2 THR J 75 92.984 48.803 13.420 1.00360.61 C ANISOU 9625 CG2 THR J 75 45655 49272 42088 -3792 -364 -3151 C ATOM 9626 N THR J 76 88.860 46.114 12.757 1.00344.71 N ANISOU 9626 N THR J 76 44622 45178 41171 -2317 -1148 -1698 N ATOM 9627 CA THR J 76 87.623 45.668 12.000 1.00339.02 C ANISOU 9627 CA THR J 76 44268 43753 40788 -2089 -1291 -1358 C ATOM 9628 C THR J 76 86.654 44.757 12.759 1.00352.83 C ANISOU 9628 C THR J 76 46060 45303 42694 -1724 -1463 -1106 C ATOM 9629 O THR J 76 87.091 43.832 13.454 1.00360.30 O ANISOU 9629 O THR J 76 46795 46637 43463 -1423 -1557 -1081 O ATOM 9630 CB THR J 76 87.949 44.876 10.706 1.00323.25 C ANISOU 9630 CB THR J 76 42356 41690 38771 -1875 -1420 -1243 C ATOM 9631 OG1 THR J 76 88.450 43.567 11.040 1.00316.84 O ANISOU 9631 OG1 THR J 76 41349 41252 37782 -1462 -1581 -1167 O ATOM 9632 CG2 THR J 76 88.941 45.623 9.819 1.00313.01 C ANISOU 9632 CG2 THR J 76 41029 40589 37311 -2201 -1261 -1474 C ATOM 9633 N ILE J 77 85.346 44.984 12.564 1.00363.52 N ANISOU 9633 N ILE J 77 47698 46065 44355 -1728 -1489 -916 N ATOM 9634 CA ILE J 77 84.281 44.268 13.326 1.00368.67 C ANISOU 9634 CA ILE J 77 48412 46486 45178 -1465 -1612 -705 C ATOM 9635 C ILE J 77 84.170 42.740 13.081 1.00379.30 C ANISOU 9635 C ILE J 77 49792 47803 46520 -1053 -1786 -510 C ATOM 9636 O ILE J 77 84.130 42.291 11.917 1.00384.88 O ANISOU 9636 O ILE J 77 50642 48313 47282 -971 -1856 -427 O ATOM 9637 CB ILE J 77 82.848 44.870 13.122 1.00359.07 C ANISOU 9637 CB ILE J 77 47470 44688 44269 -1562 -1600 -566 C ATOM 9638 CG1 ILE J 77 82.862 46.396 12.981 1.00356.92 C ANISOU 9638 CG1 ILE J 77 47303 44289 44019 -1935 -1387 -714 C ATOM 9639 CG2 ILE J 77 81.913 44.465 14.271 1.00357.58 C ANISOU 9639 CG2 ILE J 77 47267 44391 44205 -1412 -1661 -445 C ATOM 9640 CD1 ILE J 77 81.542 46.988 12.523 1.00355.68 C ANISOU 9640 CD1 ILE J 77 47441 43591 44109 -1950 -1368 -557 C ATOM 9641 N ASN J 78 84.097 41.967 14.186 1.00382.92 N ANISOU 9641 N ASN J 78 50147 48439 46907 -799 -1827 -438 N ATOM 9642 CA ASN J 78 83.710 40.515 14.191 1.00372.67 C ANISOU 9642 CA ASN J 78 48975 46984 45638 -410 -1928 -226 C ATOM 9643 C ASN J 78 82.379 40.170 14.915 1.00353.89 C ANISOU 9643 C ASN J 78 46750 44223 43487 -337 -1947 -64 C ATOM 9644 O ASN J 78 81.682 41.056 15.423 1.00355.36 O ANISOU 9644 O ASN J 78 46934 44263 43822 -559 -1910 -97 O ATOM 9645 CB ASN J 78 84.876 39.553 14.601 1.00384.28 C ANISOU 9645 CB ASN J 78 50273 48966 46771 -54 -1933 -235 C ATOM 9646 CG ASN J 78 85.294 39.658 16.072 1.00392.19 C ANISOU 9646 CG ASN J 78 51024 50430 47559 49 -1880 -308 C ATOM 9647 OD1 ASN J 78 84.488 39.887 16.948 1.00394.45 O ANISOU 9647 OD1 ASN J 78 51343 50544 47985 -5 -1858 -258 O ATOM 9648 ND2 ASN J 78 86.575 39.439 16.334 1.00397.22 N ANISOU 9648 ND2 ASN J 78 51391 51705 47827 228 -1861 -431 N ATOM 9649 N THR J 79 82.049 38.879 14.950 1.00330.30 N ANISOU 9649 N THR J 79 43913 41072 40512 -34 -1980 99 N ATOM 9650 CA THR J 79 80.772 38.388 15.500 1.00306.82 C ANISOU 9650 CA THR J 79 41114 37716 37747 17 -1976 240 C ATOM 9651 C THR J 79 80.616 38.615 17.005 1.00289.36 C ANISOU 9651 C THR J 79 38777 35679 35487 56 -1923 240 C ATOM 9652 O THR J 79 79.503 38.760 17.497 1.00282.75 O ANISOU 9652 O THR J 79 38025 34554 34852 -39 -1917 300 O ATOM 9653 CB THR J 79 80.540 36.880 15.210 1.00310.71 C ANISOU 9653 CB THR J 79 41841 37981 38231 308 -1960 391 C ATOM 9654 OG1 THR J 79 81.540 36.093 15.876 1.00313.35 O ANISOU 9654 OG1 THR J 79 42119 38667 38270 671 -1899 436 O ATOM 9655 CG2 THR J 79 80.561 36.589 13.700 1.00317.14 C ANISOU 9655 CG2 THR J 79 42790 38595 39111 256 -2012 385 C ATOM 9656 N GLU J 80 81.735 38.642 17.722 1.00276.62 N ANISOU 9656 N GLU J 80 36937 34580 33583 203 -1886 162 N ATOM 9657 CA GLU J 80 81.724 38.758 19.178 1.00269.44 C ANISOU 9657 CA GLU J 80 35879 33923 32571 291 -1835 155 C ATOM 9658 C GLU J 80 81.386 40.172 19.673 1.00265.92 C ANISOU 9658 C GLU J 80 35285 33512 32241 -88 -1810 3 C ATOM 9659 O GLU J 80 80.701 40.306 20.695 1.00261.12 O ANISOU 9659 O GLU J 80 34669 32828 31716 -97 -1783 45 O ATOM 9660 CB GLU J 80 83.052 38.262 19.767 1.00271.54 C ANISOU 9660 CB GLU J 80 35923 34816 32434 624 -1803 111 C ATOM 9661 CG GLU J 80 83.492 36.889 19.267 1.00273.08 C ANISOU 9661 CG GLU J 80 36296 34990 32471 1051 -1794 268 C ATOM 9662 CD GLU J 80 82.396 35.847 19.358 1.00272.63 C ANISOU 9662 CD GLU J 80 36607 34369 32611 1223 -1743 494 C ATOM 9663 OE1 GLU J 80 82.261 35.055 18.403 1.00272.83 O ANISOU 9663 OE1 GLU J 80 36883 34079 32700 1317 -1735 583 O ATOM 9664 OE2 GLU J 80 81.670 35.818 20.371 1.00272.98 O ANISOU 9664 OE2 GLU J 80 36693 34287 32737 1238 -1695 564 O ATOM 9665 N ASP J 81 81.871 41.203 18.957 1.00266.96 N ANISOU 9665 N ASP J 81 35329 33736 32366 -395 -1793 -171 N ATOM 9666 CA ASP J 81 81.571 42.624 19.237 1.00269.08 C ANISOU 9666 CA ASP J 81 35537 33956 32742 -783 -1715 -324 C ATOM 9667 C ASP J 81 80.066 42.885 19.111 1.00274.23 C ANISOU 9667 C ASP J 81 36430 34036 33729 -883 -1739 -187 C ATOM 9668 O ASP J 81 79.459 43.521 19.981 1.00269.27 O ANISOU 9668 O ASP J 81 35775 33342 33192 -1011 -1688 -211 O ATOM 9669 CB ASP J 81 82.363 43.569 18.302 1.00262.77 C ANISOU 9669 CB ASP J 81 34692 33280 31867 -1082 -1644 -521 C ATOM 9670 CG ASP J 81 83.865 43.629 18.628 1.00259.90 C ANISOU 9670 CG ASP J 81 34009 33602 31139 -1089 -1586 -744 C ATOM 9671 OD1 ASP J 81 84.288 43.446 19.790 1.00257.96 O ANISOU 9671 OD1 ASP J 81 33522 33803 30687 -968 -1566 -815 O ATOM 9672 OD2 ASP J 81 84.647 43.877 17.701 1.00256.90 O ANISOU 9672 OD2 ASP J 81 33599 33359 30652 -1216 -1556 -864 O ATOM 9673 N VAL J 82 79.485 42.363 18.026 1.00287.54 N ANISOU 9673 N VAL J 82 38326 35354 35570 -813 -1817 -57 N ATOM 9674 CA VAL J 82 78.040 42.434 17.736 1.00299.89 C ANISOU 9674 CA VAL J 82 40088 36445 37410 -864 -1858 64 C ATOM 9675 C VAL J 82 77.219 41.765 18.860 1.00302.69 C ANISOU 9675 C VAL J 82 40457 36710 37841 -720 -1868 174 C ATOM 9676 O VAL J 82 76.278 42.365 19.396 1.00313.35 O ANISOU 9676 O VAL J 82 41827 37888 39342 -840 -1850 186 O ATOM 9677 CB VAL J 82 77.679 41.802 16.344 1.00303.34 C ANISOU 9677 CB VAL J 82 40702 36608 37942 -794 -1941 152 C ATOM 9678 CG1 VAL J 82 76.171 41.835 16.085 1.00303.39 C ANISOU 9678 CG1 VAL J 82 40853 36235 38186 -839 -1986 243 C ATOM 9679 CG2 VAL J 82 78.436 42.473 15.195 1.00305.19 C ANISOU 9679 CG2 VAL J 82 40945 36907 38106 -929 -1925 58 C ATOM 9680 N LYS J 83 77.589 40.534 19.224 1.00295.27 N ANISOU 9680 N LYS J 83 39526 35883 36778 -448 -1875 259 N ATOM 9681 CA LYS J 83 76.850 39.773 20.241 1.00283.36 C ANISOU 9681 CA LYS J 83 38084 34257 35323 -293 -1847 376 C ATOM 9682 C LYS J 83 77.033 40.333 21.657 1.00278.67 C ANISOU 9682 C LYS J 83 37303 33941 34637 -305 -1793 322 C ATOM 9683 O LYS J 83 76.189 40.109 22.523 1.00281.45 O ANISOU 9683 O LYS J 83 37701 34149 35087 -271 -1768 399 O ATOM 9684 CB LYS J 83 77.097 38.253 20.116 1.00276.38 C ANISOU 9684 CB LYS J 83 37359 33319 34333 18 -1817 503 C ATOM 9685 CG LYS J 83 76.536 37.693 18.804 1.00267.79 C ANISOU 9685 CG LYS J 83 36481 31873 33392 -34 -1854 542 C ATOM 9686 CD LYS J 83 76.186 36.220 18.837 1.00258.37 C ANISOU 9686 CD LYS J 83 35538 30438 32190 176 -1766 663 C ATOM 9687 CE LYS J 83 77.322 35.357 18.315 1.00253.78 C ANISOU 9687 CE LYS J 83 35035 30003 31385 452 -1729 702 C ATOM 9688 NZ LYS J 83 77.205 33.987 18.863 1.00248.76 N ANISOU 9688 NZ LYS J 83 34659 29199 30657 743 -1569 840 N ATOM 9689 N LEU J 84 78.088 41.130 21.848 1.00268.87 N ANISOU 9689 N LEU J 84 35843 33102 33211 -399 -1766 164 N ATOM 9690 CA LEU J 84 78.244 41.953 23.046 1.00259.75 C ANISOU 9690 CA LEU J 84 34485 32228 31980 -516 -1704 48 C ATOM 9691 C LEU J 84 77.205 43.042 23.103 1.00256.50 C ANISOU 9691 C LEU J 84 34145 31497 31815 -811 -1680 14 C ATOM 9692 O LEU J 84 76.652 43.306 24.152 1.00255.35 O ANISOU 9692 O LEU J 84 33948 31349 31721 -840 -1648 21 O ATOM 9693 CB LEU J 84 79.591 42.653 23.069 1.00257.75 C ANISOU 9693 CB LEU J 84 33977 32486 31467 -638 -1650 -174 C ATOM 9694 CG LEU J 84 80.152 42.684 24.485 1.00258.70 C ANISOU 9694 CG LEU J 84 33831 33116 31346 -536 -1597 -264 C ATOM 9695 CD1 LEU J 84 81.380 41.786 24.499 1.00264.03 C ANISOU 9695 CD1 LEU J 84 34346 34301 31672 -196 -1615 -270 C ATOM 9696 CD2 LEU J 84 80.489 44.089 24.970 1.00259.29 C ANISOU 9696 CD2 LEU J 84 33706 33444 31368 -919 -1490 -529 C ATOM 9697 N LEU J 85 76.977 43.682 21.965 1.00255.25 N ANISOU 9697 N LEU J 85 34110 31089 31785 -1001 -1687 -18 N ATOM 9698 CA LEU J 85 76.161 44.891 21.863 1.00255.33 C ANISOU 9698 CA LEU J 85 34211 30830 31972 -1249 -1631 -59 C ATOM 9699 C LEU J 85 74.651 44.767 22.244 1.00261.20 C ANISOU 9699 C LEU J 85 35070 31231 32940 -1206 -1675 78 C ATOM 9700 O LEU J 85 74.072 45.740 22.715 1.00261.61 O ANISOU 9700 O LEU J 85 35137 31182 33079 -1354 -1607 37 O ATOM 9701 CB LEU J 85 76.354 45.492 20.463 1.00246.99 C ANISOU 9701 CB LEU J 85 33288 29606 30949 -1386 -1612 -99 C ATOM 9702 CG LEU J 85 75.844 46.875 20.076 1.00240.61 C ANISOU 9702 CG LEU J 85 32628 28545 30245 -1612 -1497 -152 C ATOM 9703 CD1 LEU J 85 76.627 47.983 20.756 1.00238.04 C ANISOU 9703 CD1 LEU J 85 32210 28444 29788 -1876 -1306 -365 C ATOM 9704 CD2 LEU J 85 75.947 47.025 18.569 1.00236.03 C ANISOU 9704 CD2 LEU J 85 32212 27784 29685 -1622 -1510 -123 C ATOM 9705 N ALA J 86 74.007 43.610 22.058 1.00267.50 N ANISOU 9705 N ALA J 86 35955 31861 33820 -1022 -1764 221 N ATOM 9706 CA ALA J 86 72.591 43.467 22.492 1.00266.52 C ANISOU 9706 CA ALA J 86 35903 31480 33882 -1015 -1790 312 C ATOM 9707 C ALA J 86 72.417 42.414 23.606 1.00265.64 C ANISOU 9707 C ALA J 86 35764 31431 33736 -849 -1777 392 C ATOM 9708 O ALA J 86 71.610 41.480 23.502 1.00262.87 O ANISOU 9708 O ALA J 86 35529 30870 33478 -772 -1797 485 O ATOM 9709 CB ALA J 86 71.654 43.207 21.308 1.00267.60 C ANISOU 9709 CB ALA J 86 36182 31331 34161 -1019 -1865 373 C ATOM 9710 N ARG J 87 73.191 42.592 24.680 1.00264.47 N ANISOU 9710 N ARG J 87 35463 31590 33432 -804 -1720 341 N ATOM 9711 CA ARG J 87 73.248 41.666 25.847 1.00261.95 C ANISOU 9711 CA ARG J 87 35113 31401 33014 -591 -1681 424 C ATOM 9712 C ARG J 87 72.065 41.829 26.797 1.00261.16 C ANISOU 9712 C ARG J 87 35027 31136 33065 -649 -1659 471 C ATOM 9713 O ARG J 87 71.906 41.058 27.754 1.00264.26 O ANISOU 9713 O ARG J 87 35437 31568 33401 -481 -1609 557 O ATOM 9714 CB ARG J 87 74.534 41.932 26.651 1.00258.16 C ANISOU 9714 CB ARG J 87 34410 31412 32267 -511 -1634 326 C ATOM 9715 CG ARG J 87 74.538 43.285 27.374 1.00247.80 C ANISOU 9715 CG ARG J 87 32927 30263 30962 -756 -1585 170 C ATOM 9716 CD ARG J 87 75.914 43.962 27.446 1.00238.46 C ANISOU 9716 CD ARG J 87 31518 29552 29533 -856 -1531 -35 C ATOM 9717 NE ARG J 87 76.217 44.943 26.384 1.00231.64 N ANISOU 9717 NE ARG J 87 30698 28594 28718 -1133 -1499 -170 N ATOM 9718 CZ ARG J 87 75.937 46.250 26.415 1.00230.59 C ANISOU 9718 CZ ARG J 87 30589 28347 28678 -1438 -1402 -301 C ATOM 9719 NH1 ARG J 87 75.321 46.793 27.461 1.00230.46 N ANISOU 9719 NH1 ARG J 87 30530 28305 28729 -1525 -1345 -328 N ATOM 9720 NH2 ARG J 87 76.271 47.020 25.383 1.00230.84 N ANISOU 9720 NH2 ARG J 87 30715 28266 28725 -1647 -1339 -400 N ATOM 9721 N ARG J 88 71.252 42.841 26.511 1.00255.75 N ANISOU 9721 N ARG J 88 34350 30272 32551 -863 -1681 419 N ATOM 9722 CA ARG J 88 70.364 43.456 27.492 1.00253.45 C ANISOU 9722 CA ARG J 88 34008 29927 32364 -954 -1652 412 C ATOM 9723 C ARG J 88 69.021 42.763 27.647 1.00263.46 C ANISOU 9723 C ARG J 88 35380 30930 33790 -927 -1671 511 C ATOM 9724 O ARG J 88 68.623 42.507 28.772 1.00275.50 O ANISOU 9724 O ARG J 88 36869 32487 35319 -882 -1627 550 O ATOM 9725 CB ARG J 88 70.164 44.932 27.168 1.00237.69 C ANISOU 9725 CB ARG J 88 31997 27873 30439 -1161 -1630 310 C ATOM 9726 CG ARG J 88 71.461 45.679 26.938 1.00229.40 C ANISOU 9726 CG ARG J 88 30868 27062 29232 -1266 -1565 170 C ATOM 9727 CD ARG J 88 71.307 46.599 25.749 1.00226.25 C ANISOU 9727 CD ARG J 88 30602 26456 28906 -1403 -1543 130 C ATOM 9728 NE ARG J 88 72.353 47.609 25.696 1.00228.40 N ANISOU 9728 NE ARG J 88 30831 26903 29047 -1592 -1416 -40 N ATOM 9729 CZ ARG J 88 72.426 48.662 26.506 1.00230.74 C ANISOU 9729 CZ ARG J 88 31084 27270 29315 -1773 -1276 -167 C ATOM 9730 NH1 ARG J 88 71.529 48.855 27.471 1.00229.62 N ANISOU 9730 NH1 ARG J 88 30924 27050 29270 -1758 -1268 -125 N ATOM 9731 NH2 ARG J 88 73.405 49.529 26.348 1.00234.88 N ANISOU 9731 NH2 ARG J 88 31588 27946 29707 -1993 -1124 -356 N ATOM 9732 N SER J 89 68.322 42.471 26.540 1.00267.54 N ANISOU 9732 N SER J 89 36009 31223 34419 -970 -1726 533 N ATOM 9733 CA SER J 89 67.102 41.621 26.570 1.00270.43 C ANISOU 9733 CA SER J 89 36461 31386 34901 -981 -1723 582 C ATOM 9734 C SER J 89 67.416 40.169 26.173 1.00278.33 C ANISOU 9734 C SER J 89 37614 32294 35842 -875 -1675 638 C ATOM 9735 O SER J 89 68.097 39.907 25.176 1.00271.68 O ANISOU 9735 O SER J 89 36828 31453 34941 -833 -1705 630 O ATOM 9736 CB SER J 89 65.925 42.217 25.764 1.00264.02 C ANISOU 9736 CB SER J 89 35641 30450 34223 -1104 -1793 539 C ATOM 9737 OG SER J 89 65.720 41.621 24.493 1.00255.73 O ANISOU 9737 OG SER J 89 34670 29305 33189 -1120 -1839 523 O ATOM 9738 N ASN J 90 66.933 39.230 26.983 1.00295.17 N ANISOU 9738 N ASN J 90 39841 34330 37980 -827 -1572 695 N ATOM 9739 CA ASN J 90 67.406 37.846 26.898 1.00307.19 C ANISOU 9739 CA ASN J 90 41569 35749 39400 -675 -1455 769 C ATOM 9740 C ASN J 90 66.694 36.999 25.795 1.00301.38 C ANISOU 9740 C ASN J 90 40999 34761 38749 -804 -1420 722 C ATOM 9741 O ASN J 90 67.284 36.051 25.271 1.00306.81 O ANISOU 9741 O ASN J 90 41870 35354 39348 -695 -1340 759 O ATOM 9742 CB ASN J 90 67.470 37.152 28.301 1.00319.14 C ANISOU 9742 CB ASN J 90 43169 37269 40819 -506 -1302 872 C ATOM 9743 CG ASN J 90 67.995 38.070 29.431 1.00317.97 C ANISOU 9743 CG ASN J 90 42805 37420 40587 -422 -1343 878 C ATOM 9744 OD1 ASN J 90 67.236 38.840 30.014 1.00311.30 O ANISOU 9744 OD1 ASN J 90 41834 36590 39854 -568 -1380 834 O ATOM 9745 ND2 ASN J 90 69.277 37.935 29.776 1.00320.93 N ANISOU 9745 ND2 ASN J 90 43132 38063 40741 -179 -1322 921 N ATOM 9746 N SER J 91 65.454 37.374 25.429 1.00283.91 N ANISOU 9746 N SER J 91 38708 32481 36683 -1029 -1476 627 N ATOM 9747 CA SER J 91 64.736 36.822 24.243 1.00265.40 C ANISOU 9747 CA SER J 91 36431 30007 34399 -1197 -1476 524 C ATOM 9748 C SER J 91 65.545 37.067 22.979 1.00259.68 C ANISOU 9748 C SER J 91 35696 29342 33627 -1140 -1585 509 C ATOM 9749 O SER J 91 65.597 36.235 22.063 1.00251.06 O ANISOU 9749 O SER J 91 34737 28138 32515 -1179 -1541 465 O ATOM 9750 CB SER J 91 63.348 37.476 24.079 1.00256.81 C ANISOU 9750 CB SER J 91 35167 28984 33424 -1397 -1558 410 C ATOM 9751 OG SER J 91 63.428 38.827 23.631 1.00241.95 O ANISOU 9751 OG SER J 91 33106 27266 31558 -1358 -1727 405 O ATOM 9752 N LEU J 92 66.181 38.231 22.968 1.00262.87 N ANISOU 9752 N LEU J 92 35954 29917 34008 -1065 -1705 536 N ATOM 9753 CA LEU J 92 67.060 38.690 21.913 1.00276.81 C ANISOU 9753 CA LEU J 92 37696 31763 35715 -1012 -1799 526 C ATOM 9754 C LEU J 92 68.402 37.894 21.814 1.00274.29 C ANISOU 9754 C LEU J 92 37498 31466 35253 -835 -1737 588 C ATOM 9755 O LEU J 92 68.812 37.474 20.717 1.00281.40 O ANISOU 9755 O LEU J 92 38476 32326 36116 -818 -1760 567 O ATOM 9756 CB LEU J 92 67.303 40.172 22.180 1.00293.11 C ANISOU 9756 CB LEU J 92 39608 33976 37784 -1017 -1874 521 C ATOM 9757 CG LEU J 92 67.466 41.197 21.077 1.00311.40 C ANISOU 9757 CG LEU J 92 41881 36336 40099 -1049 -1963 483 C ATOM 9758 CD1 LEU J 92 67.648 42.547 21.742 1.00314.54 C ANISOU 9758 CD1 LEU J 92 42195 36822 40493 -1072 -1948 477 C ATOM 9759 CD2 LEU J 92 68.669 40.874 20.207 1.00319.52 C ANISOU 9759 CD2 LEU J 92 42970 37406 41025 -982 -1976 484 C ATOM 9760 N LEU J 93 69.080 37.715 22.952 1.00263.95 N ANISOU 9760 N LEU J 93 36188 30259 33840 -679 -1661 662 N ATOM 9761 CA LEU J 93 70.324 36.939 23.062 1.00255.35 C ANISOU 9761 CA LEU J 93 35195 29263 32562 -437 -1589 734 C ATOM 9762 C LEU J 93 70.238 35.536 22.417 1.00256.94 C ANISOU 9762 C LEU J 93 35664 29221 32738 -372 -1473 767 C ATOM 9763 O LEU J 93 71.091 35.172 21.573 1.00259.64 O ANISOU 9763 O LEU J 93 36072 29599 32979 -261 -1486 774 O ATOM 9764 CB LEU J 93 70.722 36.869 24.550 1.00247.81 C ANISOU 9764 CB LEU J 93 34194 28474 31486 -258 -1505 810 C ATOM 9765 CG LEU J 93 71.371 35.648 25.199 1.00246.36 C ANISOU 9765 CG LEU J 93 34194 28303 31105 58 -1344 935 C ATOM 9766 CD1 LEU J 93 72.852 35.690 24.880 1.00243.51 C ANISOU 9766 CD1 LEU J 93 33746 28261 30515 286 -1385 941 C ATOM 9767 CD2 LEU J 93 71.135 35.605 26.708 1.00247.79 C ANISOU 9767 CD2 LEU J 93 34349 28566 31232 171 -1251 1007 C ATOM 9768 N LYS J 94 69.209 34.769 22.810 1.00254.88 N ANISOU 9768 N LYS J 94 35566 28711 32562 -464 -1338 772 N ATOM 9769 CA LYS J 94 68.981 33.422 22.265 1.00254.60 C ANISOU 9769 CA LYS J 94 35832 28392 32510 -469 -1164 770 C ATOM 9770 C LYS J 94 68.713 33.514 20.767 1.00262.31 C ANISOU 9770 C LYS J 94 36776 29321 33567 -661 -1269 646 C ATOM 9771 O LYS J 94 69.364 32.826 19.997 1.00267.37 O ANISOU 9771 O LYS J 94 37575 29889 34122 -562 -1218 657 O ATOM 9772 CB LYS J 94 67.850 32.646 22.970 1.00247.14 C ANISOU 9772 CB LYS J 94 35075 27185 31640 -608 -960 755 C ATOM 9773 CG LYS J 94 68.064 31.126 22.931 1.00243.99 C ANISOU 9773 CG LYS J 94 35090 26481 31133 -488 -668 813 C ATOM 9774 CD LYS J 94 66.807 30.319 22.643 1.00245.57 C ANISOU 9774 CD LYS J 94 35489 26368 31445 -825 -471 670 C ATOM 9775 CE LYS J 94 66.988 28.816 22.929 1.00247.72 C ANISOU 9775 CE LYS J 94 36256 26271 31595 -700 -90 746 C ATOM 9776 NZ LYS J 94 68.189 28.196 22.287 1.00248.31 N ANISOU 9776 NZ LYS J 94 36546 26295 31502 -394 -27 845 N ATOM 9777 N TYR J 95 67.765 34.368 20.377 1.00268.95 N ANISOU 9777 N TYR J 95 37411 30227 34550 -901 -1410 536 N ATOM 9778 CA TYR J 95 67.391 34.656 18.978 1.00275.98 C ANISOU 9778 CA TYR J 95 38214 31147 35497 -1061 -1535 415 C ATOM 9779 C TYR J 95 68.595 34.801 18.050 1.00274.98 C ANISOU 9779 C TYR J 95 38092 31111 35274 -914 -1622 449 C ATOM 9780 O TYR J 95 68.681 34.186 16.975 1.00278.82 O ANISOU 9780 O TYR J 95 38681 31516 35741 -956 -1606 388 O ATOM 9781 CB TYR J 95 66.648 35.991 18.994 1.00279.53 C ANISOU 9781 CB TYR J 95 38400 31768 36038 -1170 -1702 367 C ATOM 9782 CG TYR J 95 66.011 36.449 17.715 1.00287.53 C ANISOU 9782 CG TYR J 95 39291 32869 37088 -1295 -1830 253 C ATOM 9783 CD1 TYR J 95 66.750 36.584 16.537 1.00293.34 C ANISOU 9783 CD1 TYR J 95 40037 33651 37764 -1230 -1914 250 C ATOM 9784 CD2 TYR J 95 64.659 36.799 17.695 1.00288.70 C ANISOU 9784 CD2 TYR J 95 39291 33098 37302 -1452 -1870 149 C ATOM 9785 CE1 TYR J 95 66.153 37.020 15.366 1.00300.64 C ANISOU 9785 CE1 TYR J 95 40848 34684 38695 -1306 -2027 156 C ATOM 9786 CE2 TYR J 95 64.053 37.234 16.529 1.00297.88 C ANISOU 9786 CE2 TYR J 95 40318 34412 38451 -1510 -1989 48 C ATOM 9787 CZ TYR J 95 64.794 37.349 15.367 1.00302.65 C ANISOU 9787 CZ TYR J 95 40950 35046 38994 -1430 -2066 58 C ATOM 9788 OH TYR J 95 64.182 37.780 14.200 1.00307.33 O ANISOU 9788 OH TYR J 95 41408 35816 39546 -1451 -2178 -32 O ATOM 9789 N ILE J 96 69.522 35.636 18.487 1.00268.41 N ANISOU 9789 N ILE J 96 37138 30470 34375 -763 -1704 526 N ATOM 9790 CA ILE J 96 70.665 35.986 17.688 1.00258.03 C ANISOU 9790 CA ILE J 96 35780 29297 32962 -657 -1790 536 C ATOM 9791 C ILE J 96 71.753 34.913 17.626 1.00264.43 C ANISOU 9791 C ILE J 96 36767 30092 33611 -430 -1685 605 C ATOM 9792 O ILE J 96 72.290 34.696 16.536 1.00269.95 O ANISOU 9792 O ILE J 96 37509 30797 34259 -403 -1725 577 O ATOM 9793 CB ILE J 96 71.186 37.381 18.065 1.00246.19 C ANISOU 9793 CB ILE J 96 34073 28026 31439 -652 -1889 539 C ATOM 9794 CG1 ILE J 96 70.290 38.437 17.395 1.00237.74 C ANISOU 9794 CG1 ILE J 96 32897 26940 30491 -828 -1995 473 C ATOM 9795 CG2 ILE J 96 72.659 37.558 17.703 1.00241.64 C ANISOU 9795 CG2 ILE J 96 33457 27654 30699 -517 -1913 547 C ATOM 9796 CD1 ILE J 96 70.127 38.285 15.892 1.00232.40 C ANISOU 9796 CD1 ILE J 96 32260 26215 29826 -879 -2064 419 C ATOM 9797 N THR J 97 72.071 34.240 18.747 1.00265.90 N ANISOU 9797 N THR J 97 37067 30266 33696 -236 -1543 701 N ATOM 9798 CA THR J 97 73.019 33.085 18.704 1.00268.36 C ANISOU 9798 CA THR J 97 37601 30544 33817 52 -1403 791 C ATOM 9799 C THR J 97 72.574 32.014 17.657 1.00283.53 C ANISOU 9799 C THR J 97 39791 32150 35788 -39 -1294 743 C ATOM 9800 O THR J 97 73.407 31.458 16.924 1.00284.51 O ANISOU 9800 O THR J 97 40034 32278 35789 120 -1265 764 O ATOM 9801 CB THR J 97 73.355 32.454 20.100 1.00259.35 C ANISOU 9801 CB THR J 97 36585 29434 32522 341 -1231 927 C ATOM 9802 OG1 THR J 97 72.176 31.941 20.729 1.00253.14 O ANISOU 9802 OG1 THR J 97 35970 28352 31860 205 -1081 934 O ATOM 9803 CG2 THR J 97 73.993 33.456 21.021 1.00253.86 C ANISOU 9803 CG2 THR J 97 35598 29127 31728 441 -1337 942 C ATOM 9804 N ASP J 98 71.257 31.793 17.556 1.00303.25 N ANISOU 9804 N ASP J 98 42352 34415 38454 -321 -1237 650 N ATOM 9805 CA ASP J 98 70.626 30.814 16.625 1.00319.65 C ANISOU 9805 CA ASP J 98 44653 36213 40583 -505 -1106 542 C ATOM 9806 C ASP J 98 70.775 31.173 15.151 1.00308.86 C ANISOU 9806 C ASP J 98 43163 34941 39245 -621 -1274 436 C ATOM 9807 O ASP J 98 71.247 30.371 14.326 1.00304.75 O ANISOU 9807 O ASP J 98 42833 34306 38651 -563 -1191 416 O ATOM 9808 CB ASP J 98 69.122 30.679 16.945 1.00346.64 C ANISOU 9808 CB ASP J 98 48077 39475 44154 -829 -1021 419 C ATOM 9809 CG ASP J 98 68.841 30.274 18.414 1.00367.71 C ANISOU 9809 CG ASP J 98 50894 42012 46804 -746 -827 518 C ATOM 9810 OD1 ASP J 98 69.791 29.882 19.146 1.00380.74 O ANISOU 9810 OD1 ASP J 98 52701 43660 48299 -406 -720 689 O ATOM 9811 OD2 ASP J 98 67.655 30.352 18.831 1.00380.81 O ANISOU 9811 OD2 ASP J 98 52502 43605 48582 -1006 -781 420 O ATOM 9812 N LYS J 99 70.321 32.385 14.852 1.00299.30 N ANISOU 9812 N LYS J 99 41654 33930 38134 -771 -1491 373 N ATOM 9813 CA LYS J 99 70.580 33.068 13.602 1.00296.87 C ANISOU 9813 CA LYS J 99 41189 33776 37832 -819 -1677 312 C ATOM 9814 C LYS J 99 72.065 33.047 13.177 1.00308.24 C ANISOU 9814 C LYS J 99 42662 35328 39127 -581 -1715 394 C ATOM 9815 O LYS J 99 72.366 33.062 11.976 1.00312.64 O ANISOU 9815 O LYS J 99 43206 35921 39660 -607 -1792 339 O ATOM 9816 CB LYS J 99 70.073 34.511 13.717 1.00285.90 C ANISOU 9816 CB LYS J 99 39524 32577 36525 -909 -1855 296 C ATOM 9817 CG LYS J 99 68.813 34.818 12.913 1.00277.87 C ANISOU 9817 CG LYS J 99 38385 31596 35595 -1125 -1936 159 C ATOM 9818 CD LYS J 99 67.548 34.128 13.408 1.00276.99 C ANISOU 9818 CD LYS J 99 38312 31374 35555 -1322 -1813 55 C ATOM 9819 CE LYS J 99 66.312 34.584 12.638 1.00274.58 C ANISOU 9819 CE LYS J 99 37804 31234 35288 -1507 -1918 -100 C ATOM 9820 NZ LYS J 99 66.294 34.325 11.171 1.00270.26 N ANISOU 9820 NZ LYS J 99 37232 30767 34684 -1567 -1978 -216 N ATOM 9821 N SER J 100 72.980 33.022 14.152 1.00319.64 N ANISOU 9821 N SER J 100 44124 36872 40452 -344 -1663 513 N ATOM 9822 CA SER J 100 74.415 33.038 13.854 1.00324.83 C ANISOU 9822 CA SER J 100 44760 37727 40931 -108 -1698 569 C ATOM 9823 C SER J 100 74.896 31.682 13.344 1.00325.36 C ANISOU 9823 C SER J 100 45111 37627 40883 63 -1547 601 C ATOM 9824 O SER J 100 75.825 31.620 12.539 1.00324.55 O ANISOU 9824 O SER J 100 44998 37648 40668 183 -1601 600 O ATOM 9825 CB SER J 100 75.260 33.514 15.047 1.00326.22 C ANISOU 9825 CB SER J 100 44802 38174 40971 93 -1698 651 C ATOM 9826 OG SER J 100 75.493 32.461 15.965 1.00322.70 O ANISOU 9826 OG SER J 100 44560 37653 40398 352 -1514 760 O ATOM 9827 N GLU J 101 74.272 30.593 13.786 1.00325.55 N ANISOU 9827 N GLU J 101 45413 37354 40926 69 -1334 623 N ATOM 9828 CA GLU J 101 74.596 29.294 13.188 1.00329.97 C ANISOU 9828 CA GLU J 101 46306 37680 41387 194 -1143 634 C ATOM 9829 C GLU J 101 74.076 29.128 11.745 1.00337.01 C ANISOU 9829 C GLU J 101 47215 38449 42385 -80 -1193 474 C ATOM 9830 O GLU J 101 74.678 28.389 10.949 1.00335.76 O ANISOU 9830 O GLU J 101 47242 38205 42125 33 -1116 470 O ATOM 9831 CB GLU J 101 74.136 28.147 14.068 1.00334.43 C ANISOU 9831 CB GLU J 101 47233 37917 41916 276 -834 700 C ATOM 9832 CG GLU J 101 75.230 27.568 14.930 1.00344.09 C ANISOU 9832 CG GLU J 101 48636 39213 42886 759 -684 896 C ATOM 9833 CD GLU J 101 74.681 27.049 16.238 1.00359.29 C ANISOU 9833 CD GLU J 101 50780 40936 44795 842 -450 992 C ATOM 9834 OE1 GLU J 101 73.900 26.073 16.222 1.00368.38 O ANISOU 9834 OE1 GLU J 101 52297 41666 46003 699 -174 953 O ATOM 9835 OE2 GLU J 101 75.015 27.621 17.296 1.00368.91 O ANISOU 9835 OE2 GLU J 101 51810 42420 45936 1030 -524 1091 O ATOM 9836 N GLU J 102 72.981 29.820 11.411 1.00347.11 N ANISOU 9836 N GLU J 102 48290 39756 43839 -411 -1322 343 N ATOM 9837 CA GLU J 102 72.459 29.881 10.038 1.00357.72 C ANISOU 9837 CA GLU J 102 49559 41101 45253 -653 -1414 180 C ATOM 9838 C GLU J 102 73.425 30.613 9.069 1.00352.22 C ANISOU 9838 C GLU J 102 48689 40647 44490 -538 -1623 203 C ATOM 9839 O GLU J 102 73.770 30.099 8.004 1.00360.45 O ANISOU 9839 O GLU J 102 49826 41648 45480 -536 -1611 146 O ATOM 9840 CB GLU J 102 71.075 30.542 10.062 1.00366.50 C ANISOU 9840 CB GLU J 102 50457 42277 46517 -957 -1507 52 C ATOM 9841 CG GLU J 102 70.616 31.182 8.751 1.00381.88 C ANISOU 9841 CG GLU J 102 52184 44408 48502 -1122 -1698 -80 C ATOM 9842 CD GLU J 102 69.683 32.374 8.956 1.00388.48 C ANISOU 9842 CD GLU J 102 52733 45444 49426 -1237 -1862 -113 C ATOM 9843 OE1 GLU J 102 69.789 33.328 8.152 1.00400.95 O ANISOU 9843 OE1 GLU J 102 54128 47223 50991 -1204 -2047 -113 O ATOM 9844 OE2 GLU J 102 68.855 32.343 9.895 1.00383.54 O ANISOU 9844 OE2 GLU J 102 52089 44768 48868 -1342 -1789 -134 O ATOM 9845 N ILE J 103 73.858 31.812 9.456 1.00332.62 N ANISOU 9845 N ILE J 103 45967 38408 42004 -464 -1788 276 N ATOM 9846 CA ILE J 103 74.807 32.609 8.675 1.00304.69 C ANISOU 9846 CA ILE J 103 42276 35099 38392 -383 -1948 291 C ATOM 9847 C ILE J 103 76.206 31.916 8.603 1.00308.50 C ANISOU 9847 C ILE J 103 42886 35644 38684 -103 -1876 367 C ATOM 9848 O ILE J 103 76.932 32.068 7.609 1.00308.26 O ANISOU 9848 O ILE J 103 42812 35733 38580 -60 -1958 342 O ATOM 9849 CB ILE J 103 74.796 34.079 9.188 1.00281.73 C ANISOU 9849 CB ILE J 103 39123 32393 35527 -432 -2078 318 C ATOM 9850 CG1 ILE J 103 73.377 34.652 9.046 1.00267.23 C ANISOU 9850 CG1 ILE J 103 37188 30501 33844 -652 -2141 246 C ATOM 9851 CG2 ILE J 103 75.771 34.956 8.429 1.00272.96 C ANISOU 9851 CG2 ILE J 103 37886 31494 34331 -394 -2191 315 C ATOM 9852 CD1 ILE J 103 73.058 35.789 9.992 1.00252.36 C ANISOU 9852 CD1 ILE J 103 35153 28711 32018 -686 -2185 287 C ATOM 9853 N ALA J 104 76.539 31.106 9.622 1.00308.79 N ANISOU 9853 N ALA J 104 43093 35607 38623 111 -1711 462 N ATOM 9854 CA ALA J 104 77.810 30.324 9.712 1.00304.98 C ANISOU 9854 CA ALA J 104 42755 35212 37911 464 -1610 556 C ATOM 9855 C ALA J 104 77.959 29.156 8.723 1.00302.67 C ANISOU 9855 C ALA J 104 42745 34690 37563 527 -1484 529 C ATOM 9856 O ALA J 104 79.057 28.608 8.567 1.00304.65 O ANISOU 9856 O ALA J 104 43099 35045 37609 836 -1424 601 O ATOM 9857 CB ALA J 104 78.066 29.841 11.144 1.00306.29 C ANISOU 9857 CB ALA J 104 43032 35391 37952 736 -1453 685 C ATOM 9858 N GLN J 105 76.865 28.774 8.069 1.00296.97 N ANISOU 9858 N GLN J 105 42139 33694 37003 236 -1435 410 N ATOM 9859 CA GLN J 105 76.929 27.878 6.911 1.00291.63 C ANISOU 9859 CA GLN J 105 41675 32835 36296 200 -1344 329 C ATOM 9860 C GLN J 105 77.971 28.295 5.868 1.00290.53 C ANISOU 9860 C GLN J 105 41386 32946 36054 311 -1515 325 C ATOM 9861 O GLN J 105 78.524 27.440 5.175 1.00289.84 O ANISOU 9861 O GLN J 105 41505 32763 35856 447 -1414 320 O ATOM 9862 CB GLN J 105 75.559 27.772 6.248 1.00292.06 C ANISOU 9862 CB GLN J 105 41728 32711 36531 -203 -1334 142 C ATOM 9863 CG GLN J 105 74.754 26.605 6.768 1.00292.98 C ANISOU 9863 CG GLN J 105 42184 32456 36679 -317 -1026 89 C ATOM 9864 CD GLN J 105 73.264 26.834 6.659 1.00297.43 C ANISOU 9864 CD GLN J 105 42618 32977 37415 -737 -1042 -100 C ATOM 9865 OE1 GLN J 105 72.564 26.886 7.669 1.00300.08 O ANISOU 9865 OE1 GLN J 105 42962 33233 37820 -825 -959 -88 O ATOM 9866 NE2 GLN J 105 72.769 26.982 5.433 1.00298.78 N ANISOU 9866 NE2 GLN J 105 42644 33244 37632 -983 -1151 -283 N ATOM 9867 N ALA J 106 78.214 29.605 5.754 1.00288.76 N ANISOU 9867 N ALA J 106 40830 33023 35863 241 -1745 320 N ATOM 9868 CA ALA J 106 79.228 30.158 4.847 1.00285.62 C ANISOU 9868 CA ALA J 106 40273 32886 35361 316 -1894 309 C ATOM 9869 C ALA J 106 80.610 30.162 5.497 1.00282.93 C ANISOU 9869 C ALA J 106 39879 32827 34792 649 -1875 411 C ATOM 9870 O ALA J 106 81.287 29.135 5.541 1.00284.40 O ANISOU 9870 O ALA J 106 40272 32979 34808 938 -1738 475 O ATOM 9871 CB ALA J 106 78.842 31.568 4.404 1.00285.04 C ANISOU 9871 CB ALA J 106 39921 32975 35404 78 -2093 248 C TER 9872 ALA J 106 ATOM 9873 N SER K 14 90.352 11.725 54.214 1.00420.95 N ANISOU 9873 N SER K 14 52733 55691 51516 -2648 -6905 -3618 N ATOM 9874 CA SER K 14 91.829 11.591 54.199 1.00419.42 C ANISOU 9874 CA SER K 14 52355 55778 51227 -2826 -6914 -3720 C ATOM 9875 C SER K 14 92.469 12.500 53.133 1.00423.25 C ANISOU 9875 C SER K 14 52982 56037 51794 -3084 -6831 -3820 C ATOM 9876 O SER K 14 91.782 13.085 52.275 1.00433.47 O ANISOU 9876 O SER K 14 54518 56958 53222 -3086 -6766 -3762 O ATOM 9877 CB SER K 14 92.228 10.120 54.006 1.00413.45 C ANISOU 9877 CB SER K 14 51396 55260 50433 -2658 -6974 -3519 C ATOM 9878 OG SER K 14 93.610 9.936 54.252 1.00410.30 O ANISOU 9878 OG SER K 14 50784 55211 49900 -2783 -6993 -3620 O ATOM 9879 N TYR K 15 93.789 12.628 53.204 1.00419.68 N ANISOU 9879 N TYR K 15 52377 55831 51251 -3291 -6823 -3972 N ATOM 9880 CA TYR K 15 94.536 13.435 52.247 1.00423.43 C ANISOU 9880 CA TYR K 15 52965 56122 51794 -3555 -6728 -4082 C ATOM 9881 C TYR K 15 94.300 13.006 50.782 1.00438.70 C ANISOU 9881 C TYR K 15 55022 57788 53874 -3478 -6720 -3852 C ATOM 9882 O TYR K 15 94.119 13.865 49.928 1.00436.60 O ANISOU 9882 O TYR K 15 54987 57182 53718 -3586 -6618 -3872 O ATOM 9883 CB TYR K 15 96.014 13.416 52.600 1.00415.23 C ANISOU 9883 CB TYR K 15 51687 55466 50615 -3768 -6736 -4276 C ATOM 9884 CG TYR K 15 96.773 14.593 52.085 1.00418.81 C ANISOU 9884 CG TYR K 15 52258 55761 51109 -4108 -6600 -4508 C ATOM 9885 CD1 TYR K 15 96.820 15.780 52.812 1.00422.54 C ANISOU 9885 CD1 TYR K 15 52808 56192 51546 -4322 -6491 -4798 C ATOM 9886 CD2 TYR K 15 97.475 14.519 50.891 1.00423.23 C ANISOU 9886 CD2 TYR K 15 52850 56214 51743 -4227 -6561 -4451 C ATOM 9887 CE1 TYR K 15 97.542 16.874 52.345 1.00431.19 C ANISOU 9887 CE1 TYR K 15 54023 57121 52686 -4656 -6324 -5031 C ATOM 9888 CE2 TYR K 15 98.200 15.599 50.415 1.00431.22 C ANISOU 9888 CE2 TYR K 15 53977 57069 52796 -4548 -6410 -4670 C ATOM 9889 CZ TYR K 15 98.233 16.776 51.139 1.00433.27 C ANISOU 9889 CZ TYR K 15 54325 57270 53027 -4766 -6281 -4963 C ATOM 9890 OH TYR K 15 98.965 17.838 50.645 1.00433.61 O ANISOU 9890 OH TYR K 15 54496 57133 53122 -5101 -6093 -5191 O ATOM 9891 N GLN K 16 94.278 11.689 50.520 1.00462.42 N ANISOU 9891 N GLN K 16 57877 60947 56873 -3283 -6811 -3638 N ATOM 9892 CA GLN K 16 93.953 11.081 49.195 1.00479.16 C ANISOU 9892 CA GLN K 16 60077 62860 59122 -3181 -6813 -3413 C ATOM 9893 C GLN K 16 92.630 11.523 48.527 1.00481.80 C ANISOU 9893 C GLN K 16 60665 62809 59586 -3062 -6770 -3308 C ATOM 9894 O GLN K 16 92.605 11.855 47.327 1.00481.37 O ANISOU 9894 O GLN K 16 60757 62512 59629 -3109 -6716 -3244 O ATOM 9895 CB GLN K 16 93.950 9.535 49.287 1.00485.39 C ANISOU 9895 CB GLN K 16 60665 63883 59878 -2965 -6892 -3215 C ATOM 9896 CG GLN K 16 95.054 8.795 48.500 1.00481.46 C ANISOU 9896 CG GLN K 16 60027 63532 59372 -3026 -6905 -3136 C ATOM 9897 CD GLN K 16 94.785 7.300 48.286 1.00474.61 C ANISOU 9897 CD GLN K 16 59040 62763 58524 -2795 -6934 -2903 C ATOM 9898 OE1 GLN K 16 93.753 6.776 48.704 1.00472.27 O ANISOU 9898 OE1 GLN K 16 58764 62424 58252 -2593 -6938 -2803 O ATOM 9899 NE2 GLN K 16 95.742 6.604 47.675 1.00469.53 N ANISOU 9899 NE2 GLN K 16 58272 62260 57867 -2830 -6937 -2828 N ATOM 9900 N GLN K 17 91.527 11.486 49.279 1.00478.32 N ANISOU 9900 N GLN K 17 60266 62336 59137 -2888 -6793 -3282 N ATOM 9901 CA GLN K 17 90.199 11.787 48.696 1.00458.88 C ANISOU 9901 CA GLN K 17 58011 59569 56774 -2735 -6763 -3173 C ATOM 9902 C GLN K 17 90.018 13.286 48.434 1.00451.39 C ANISOU 9902 C GLN K 17 57318 58325 55863 -2860 -6649 -3293 C ATOM 9903 O GLN K 17 89.193 13.686 47.604 1.00443.79 O ANISOU 9903 O GLN K 17 56547 57097 54975 -2757 -6597 -3196 O ATOM 9904 CB GLN K 17 89.023 11.234 49.534 1.00452.00 C ANISOU 9904 CB GLN K 17 57101 58756 55883 -2503 -6816 -3104 C ATOM 9905 CG GLN K 17 88.830 9.717 49.545 1.00440.28 C ANISOU 9905 CG GLN K 17 55430 57457 54399 -2328 -6877 -2940 C ATOM 9906 CD GLN K 17 89.362 9.043 50.815 1.00437.93 C ANISOU 9906 CD GLN K 17 54923 57486 53983 -2290 -6920 -2977 C ATOM 9907 OE1 GLN K 17 89.286 9.585 51.938 1.00435.15 O ANISOU 9907 OE1 GLN K 17 54563 57225 53548 -2307 -6930 -3106 O ATOM 9908 NE2 GLN K 17 89.892 7.841 50.643 1.00435.34 N ANISOU 9908 NE2 GLN K 17 54424 57344 53638 -2223 -6935 -2856 N ATOM 9909 N ARG K 18 90.798 14.103 49.146 1.00442.21 N ANISOU 9909 N ARG K 18 56155 57222 54639 -3076 -6593 -3510 N ATOM 9910 CA ARG K 18 90.852 15.541 48.906 1.00422.73 C ANISOU 9910 CA ARG K 18 53937 54467 52212 -3241 -6437 -3651 C ATOM 9911 C ARG K 18 91.546 15.857 47.563 1.00407.83 C ANISOU 9911 C ARG K 18 52157 52400 50400 -3376 -6348 -3613 C ATOM 9912 O ARG K 18 91.117 16.759 46.839 1.00399.30 O ANISOU 9912 O ARG K 18 51338 50987 49390 -3369 -6214 -3585 O ATOM 9913 CB ARG K 18 91.536 16.241 50.087 1.00422.14 C ANISOU 9913 CB ARG K 18 53803 54542 52047 -3462 -6388 -3927 C ATOM 9914 CG ARG K 18 91.025 17.635 50.375 1.00418.86 C ANISOU 9914 CG ARG K 18 53654 53828 51664 -3543 -6225 -4071 C ATOM 9915 CD ARG K 18 92.098 18.482 51.052 1.00416.35 C ANISOU 9915 CD ARG K 18 53299 53608 51284 -3875 -6113 -4388 C ATOM 9916 NE ARG K 18 93.405 18.338 50.391 1.00416.91 N ANISOU 9916 NE ARG K 18 53263 53790 51352 -4097 -6088 -4454 N ATOM 9917 CZ ARG K 18 93.810 19.004 49.306 1.00422.39 C ANISOU 9917 CZ ARG K 18 54152 54197 52139 -4242 -5932 -4459 C ATOM 9918 NH1 ARG K 18 95.019 18.767 48.807 1.00424.92 N ANISOU 9918 NH1 ARG K 18 54337 54666 52444 -4442 -5928 -4526 N ATOM 9919 NH2 ARG K 18 93.029 19.909 48.713 1.00427.16 N ANISOU 9919 NH2 ARG K 18 55086 54373 52843 -4178 -5768 -4393 N ATOM 9920 N LEU K 19 92.592 15.093 47.228 1.00396.07 N ANISOU 9920 N LEU K 19 50466 51133 48887 -3474 -6414 -3598 N ATOM 9921 CA LEU K 19 93.249 15.156 45.910 1.00387.78 C ANISOU 9921 CA LEU K 19 49481 49951 47907 -3576 -6355 -3532 C ATOM 9922 C LEU K 19 92.349 14.619 44.818 1.00377.46 C ANISOU 9922 C LEU K 19 48254 48483 46678 -3336 -6391 -3279 C ATOM 9923 O LEU K 19 92.387 15.107 43.697 1.00374.73 O ANISOU 9923 O LEU K 19 48078 47901 46400 -3359 -6298 -3214 O ATOM 9924 CB LEU K 19 94.545 14.341 45.890 1.00391.83 C ANISOU 9924 CB LEU K 19 49731 50784 48362 -3711 -6434 -3566 C ATOM 9925 CG LEU K 19 95.731 14.814 46.736 1.00398.75 C ANISOU 9925 CG LEU K 19 50475 51892 49139 -3988 -6397 -3838 C ATOM 9926 CD1 LEU K 19 96.785 13.723 46.863 1.00398.28 C ANISOU 9926 CD1 LEU K 19 50108 52231 48987 -4015 -6513 -3820 C ATOM 9927 CD2 LEU K 19 96.330 16.097 46.182 1.00407.08 C ANISOU 9927 CD2 LEU K 19 51733 52689 50249 -4264 -6206 -4012 C ATOM 9928 N LYS K 20 91.574 13.585 45.144 1.00367.59 N ANISOU 9928 N LYS K 20 46870 47384 45413 -3111 -6516 -3147 N ATOM 9929 CA LYS K 20 90.503 13.107 44.275 1.00362.25 C ANISOU 9929 CA LYS K 20 46256 46585 44796 -2876 -6544 -2946 C ATOM 9930 C LYS K 20 89.555 14.266 43.928 1.00371.32 C ANISOU 9930 C LYS K 20 47687 47421 45976 -2787 -6433 -2936 C ATOM 9931 O LYS K 20 89.187 14.407 42.766 1.00377.29 O ANISOU 9931 O LYS K 20 48561 48014 46777 -2692 -6388 -2811 O ATOM 9932 CB LYS K 20 89.725 11.935 44.907 1.00345.92 C ANISOU 9932 CB LYS K 20 44014 44715 42704 -2671 -6659 -2854 C ATOM 9933 CG LYS K 20 90.468 10.604 45.004 1.00333.15 C ANISOU 9933 CG LYS K 20 42141 43375 41064 -2680 -6742 -2794 C ATOM 9934 CD LYS K 20 89.581 9.532 45.630 1.00320.18 C ANISOU 9934 CD LYS K 20 40372 41872 39409 -2468 -6805 -2703 C ATOM 9935 CE LYS K 20 90.389 8.342 46.117 1.00315.34 C ANISOU 9935 CE LYS K 20 39521 41546 38745 -2467 -6851 -2665 C ATOM 9936 NZ LYS K 20 89.520 7.162 46.399 1.00309.04 N ANISOU 9936 NZ LYS K 20 38625 40830 37966 -2257 -6866 -2544 N ATOM 9937 N ALA K 21 89.190 15.095 44.916 1.00379.65 N ANISOU 9937 N ALA K 21 48848 48404 46997 -2808 -6378 -3064 N ATOM 9938 CA ALA K 21 88.293 16.261 44.719 1.00390.71 C ANISOU 9938 CA ALA K 21 50533 49501 48416 -2709 -6247 -3057 C ATOM 9939 C ALA K 21 88.900 17.459 43.950 1.00398.91 C ANISOU 9939 C ALA K 21 51817 50253 49495 -2867 -6050 -3111 C ATOM 9940 O ALA K 21 88.175 18.176 43.238 1.00409.58 O ANISOU 9940 O ALA K 21 53407 51346 50868 -2716 -5932 -3011 O ATOM 9941 CB ALA K 21 87.707 16.718 46.048 1.00391.39 C ANISOU 9941 CB ALA K 21 50653 49600 48455 -2681 -6242 -3177 C ATOM 9942 N ALA K 22 90.210 17.669 44.104 1.00400.17 N ANISOU 9942 N ALA K 22 51917 50471 49657 -3156 -6001 -3268 N ATOM 9943 CA ALA K 22 90.960 18.678 43.333 1.00406.49 C ANISOU 9943 CA ALA K 22 52927 51015 50506 -3347 -5799 -3334 C ATOM 9944 C ALA K 22 91.040 18.333 41.825 1.00412.85 C ANISOU 9944 C ALA K 22 53773 51731 51360 -3250 -5795 -3135 C ATOM 9945 O ALA K 22 90.925 19.221 40.961 1.00423.70 O ANISOU 9945 O ALA K 22 55408 52805 52773 -3222 -5613 -3077 O ATOM 9946 CB ALA K 22 92.351 18.872 43.926 1.00401.75 C ANISOU 9946 CB ALA K 22 52202 50560 49882 -3695 -5761 -3578 C ATOM 9947 N VAL K 23 91.243 17.040 41.535 1.00413.90 N ANISOU 9947 N VAL K 23 53650 52127 51486 -3193 -5982 -3030 N ATOM 9948 CA VAL K 23 91.186 16.451 40.164 1.00417.79 C ANISOU 9948 CA VAL K 23 54123 52602 52014 -3072 -6019 -2834 C ATOM 9949 C VAL K 23 89.780 16.616 39.531 1.00426.52 C ANISOU 9949 C VAL K 23 55378 53564 53116 -2754 -6000 -2656 C ATOM 9950 O VAL K 23 89.635 16.980 38.353 1.00432.95 O ANISOU 9950 O VAL K 23 56340 54211 53948 -2659 -5909 -2534 O ATOM 9951 CB VAL K 23 91.623 14.942 40.182 1.00410.94 C ANISOU 9951 CB VAL K 23 52935 52064 51137 -3073 -6213 -2777 C ATOM 9952 CG1 VAL K 23 91.334 14.222 38.859 1.00409.33 C ANISOU 9952 CG1 VAL K 23 52692 51866 50968 -2921 -6262 -2581 C ATOM 9953 CG2 VAL K 23 93.096 14.804 40.556 1.00405.39 C ANISOU 9953 CG2 VAL K 23 52086 51525 50419 -3360 -6221 -2926 C ATOM 9954 N HIS K 24 88.756 16.367 40.345 1.00431.29 N ANISOU 9954 N HIS K 24 55933 54253 53682 -2584 -6081 -2650 N ATOM 9955 CA HIS K 24 87.348 16.498 39.968 1.00432.53 C ANISOU 9955 CA HIS K 24 56195 54335 53811 -2278 -6077 -2513 C ATOM 9956 C HIS K 24 86.993 17.888 39.418 1.00433.39 C ANISOU 9956 C HIS K 24 56637 54119 53913 -2190 -5865 -2474 C ATOM 9957 O HIS K 24 86.203 17.990 38.473 1.00428.25 O ANISOU 9957 O HIS K 24 56075 53409 53231 -1942 -5834 -2315 O ATOM 9958 CB HIS K 24 86.499 16.173 41.193 1.00435.66 C ANISOU 9958 CB HIS K 24 56497 54862 54169 -2175 -6174 -2565 C ATOM 9959 CG HIS K 24 85.116 15.700 40.879 1.00435.11 C ANISOU 9959 CG HIS K 24 56390 54867 54064 -1875 -6245 -2435 C ATOM 9960 ND1 HIS K 24 84.851 14.683 39.988 1.00430.83 N ANISOU 9960 ND1 HIS K 24 55685 54484 53527 -1765 -6337 -2319 N ATOM 9961 CD2 HIS K 24 83.919 16.078 41.386 1.00437.59 C ANISOU 9961 CD2 HIS K 24 56790 55143 54332 -1673 -6235 -2424 C ATOM 9962 CE1 HIS K 24 83.547 14.476 39.939 1.00429.55 C ANISOU 9962 CE1 HIS K 24 55503 54388 53318 -1516 -6376 -2254 C ATOM 9963 NE2 HIS K 24 82.959 15.309 40.777 1.00434.46 N ANISOU 9963 NE2 HIS K 24 56274 54895 53905 -1448 -6320 -2309 N ATOM 9964 N TYR K 25 87.585 18.938 40.003 1.00439.05 N ANISOU 9964 N TYR K 25 57530 54637 54649 -2387 -5704 -2624 N ATOM 9965 CA TYR K 25 87.460 20.325 39.508 1.00447.73 C ANISOU 9965 CA TYR K 25 58980 55380 55756 -2346 -5442 -2602 C ATOM 9966 C TYR K 25 87.825 20.499 38.032 1.00437.08 C ANISOU 9966 C TYR K 25 57744 53900 54426 -2297 -5339 -2458 C ATOM 9967 O TYR K 25 86.990 20.949 37.239 1.00427.70 O ANISOU 9967 O TYR K 25 56733 52576 53195 -2015 -5243 -2289 O ATOM 9968 CB TYR K 25 88.308 21.301 40.351 1.00472.45 C ANISOU 9968 CB TYR K 25 62249 58337 58923 -2653 -5265 -2833 C ATOM 9969 CG TYR K 25 88.532 22.706 39.735 1.00491.59 C ANISOU 9969 CG TYR K 25 65045 60355 61380 -2693 -4936 -2835 C ATOM 9970 CD1 TYR K 25 87.534 23.696 39.799 1.00497.72 C ANISOU 9970 CD1 TYR K 25 66116 60866 62128 -2466 -4749 -2765 C ATOM 9971 CD2 TYR K 25 89.753 23.055 39.117 1.00498.16 C ANISOU 9971 CD2 TYR K 25 65945 61059 62271 -2955 -4788 -2908 C ATOM 9972 CE1 TYR K 25 87.735 24.972 39.257 1.00503.02 C ANISOU 9972 CE1 TYR K 25 67150 61143 62831 -2484 -4409 -2754 C ATOM 9973 CE2 TYR K 25 89.956 24.334 38.571 1.00501.54 C ANISOU 9973 CE2 TYR K 25 66731 61091 62737 -2993 -4451 -2911 C ATOM 9974 CZ TYR K 25 88.945 25.291 38.649 1.00503.02 C ANISOU 9974 CZ TYR K 25 67221 61003 62898 -2753 -4252 -2829 C ATOM 9975 OH TYR K 25 89.113 26.558 38.123 1.00504.12 O ANISOU 9975 OH TYR K 25 67741 60725 63073 -2765 -3880 -2815 O ATOM 9976 N THR K 26 89.071 20.170 37.678 1.00431.53 N ANISOU 9976 N THR K 26 56934 53250 53774 -2558 -5353 -2523 N ATOM 9977 CA THR K 26 89.599 20.467 36.344 1.00428.53 C ANISOU 9977 CA THR K 26 56683 52714 53421 -2562 -5224 -2414 C ATOM 9978 C THR K 26 88.906 19.636 35.268 1.00435.74 C ANISOU 9978 C THR K 26 57480 53787 54293 -2277 -5362 -2193 C ATOM 9979 O THR K 26 88.651 20.123 34.167 1.00431.29 O ANISOU 9979 O THR K 26 57095 53068 53706 -2099 -5231 -2041 O ATOM 9980 CB THR K 26 91.127 20.286 36.248 1.00421.91 C ANISOU 9980 CB THR K 26 55742 51919 52645 -2922 -5211 -2551 C ATOM 9981 OG1 THR K 26 91.761 20.713 37.466 1.00418.97 O ANISOU 9981 OG1 THR K 26 55355 51546 52289 -3207 -5158 -2801 O ATOM 9982 CG2 THR K 26 91.660 21.101 35.093 1.00418.72 C ANISOU 9982 CG2 THR K 26 55587 51229 52278 -2961 -4975 -2484 C ATOM 9983 N VAL K 27 88.591 18.390 35.610 1.00452.49 N ANISOU 9983 N VAL K 27 59301 56224 56399 -2231 -5608 -2185 N ATOM 9984 CA VAL K 27 87.832 17.496 34.734 1.00471.34 C ANISOU 9984 CA VAL K 27 61538 58805 58745 -1981 -5744 -2019 C ATOM 9985 C VAL K 27 86.403 18.013 34.476 1.00477.95 C ANISOU 9985 C VAL K 27 62522 59583 59493 -1625 -5686 -1896 C ATOM 9986 O VAL K 27 85.868 17.851 33.369 1.00483.07 O ANISOU 9986 O VAL K 27 63167 60293 60084 -1395 -5689 -1745 O ATOM 9987 CB VAL K 27 87.822 16.040 35.274 1.00476.75 C ANISOU 9987 CB VAL K 27 61881 59817 59442 -2035 -5979 -2060 C ATOM 9988 CG1 VAL K 27 86.965 15.129 34.404 1.00480.82 C ANISOU 9988 CG1 VAL K 27 62241 60531 59918 -1798 -6091 -1924 C ATOM 9989 CG2 VAL K 27 89.242 15.492 35.351 1.00479.58 C ANISOU 9989 CG2 VAL K 27 62090 60263 59864 -2337 -6028 -2146 C ATOM 9990 N GLY K 28 85.794 18.638 35.487 1.00480.08 N ANISOU 9990 N GLY K 28 62910 59758 59740 -1571 -5634 -1965 N ATOM 9991 CA GLY K 28 84.466 19.267 35.336 1.00477.46 C ANISOU 9991 CA GLY K 28 62742 59358 59313 -1227 -5557 -1855 C ATOM 9992 C GLY K 28 84.473 20.427 34.345 1.00471.92 C ANISOU 9992 C GLY K 28 62357 58375 58573 -1075 -5307 -1725 C ATOM 9993 O GLY K 28 83.517 20.618 33.558 1.00467.16 O ANISOU 9993 O GLY K 28 61821 57815 57864 -730 -5271 -1561 O ATOM 9994 N CYS K 29 85.568 21.193 34.394 1.00468.60 N ANISOU 9994 N CYS K 29 62127 57685 58233 -1331 -5123 -1807 N ATOM 9995 CA CYS K 29 85.861 22.277 33.447 1.00468.56 C ANISOU 9995 CA CYS K 29 62440 57369 58219 -1254 -4843 -1698 C ATOM 9996 C CYS K 29 85.920 21.763 32.014 1.00467.35 C ANISOU 9996 C CYS K 29 62203 57345 58023 -1098 -4893 -1524 C ATOM 9997 O CYS K 29 85.223 22.278 31.132 1.00465.98 O ANISOU 9997 O CYS K 29 62194 57107 57749 -765 -4767 -1339 O ATOM 9998 CB CYS K 29 87.207 22.943 33.769 1.00470.10 C ANISOU 9998 CB CYS K 29 62785 57302 58527 -1640 -4657 -1865 C ATOM 9999 SG CYS K 29 87.268 23.925 35.283 1.00466.60 S ANISOU 9999 SG CYS K 29 62528 56628 58130 -1843 -4492 -2089 S ATOM 10000 N LEU K 30 86.769 20.756 31.790 1.00466.96 N ANISOU10000 N LEU K 30 61894 57489 58040 -1331 -5067 -1583 N ATOM 10001 CA LEU K 30 86.987 20.195 30.447 1.00467.09 C ANISOU10001 CA LEU K 30 61806 57634 58029 -1240 -5121 -1444 C ATOM 10002 C LEU K 30 85.772 19.412 29.882 1.00458.64 C ANISOU10002 C LEU K 30 60538 56881 56842 -899 -5292 -1316 C ATOM 10003 O LEU K 30 85.585 19.345 28.651 1.00472.75 O ANISOU10003 O LEU K 30 62326 58741 58556 -697 -5265 -1165 O ATOM 10004 CB LEU K 30 88.298 19.380 30.374 1.00464.47 C ANISOU10004 CB LEU K 30 61268 57405 57804 -1594 -5237 -1548 C ATOM 10005 CG LEU K 30 89.656 19.977 30.795 1.00457.13 C ANISOU10005 CG LEU K 30 60462 56245 56979 -1970 -5091 -1704 C ATOM 10006 CD1 LEU K 30 90.677 18.860 30.756 1.00448.96 C ANISOU10006 CD1 LEU K 30 59134 55440 56010 -2237 -5279 -1784 C ATOM 10007 CD2 LEU K 30 90.134 21.169 29.966 1.00457.08 C ANISOU10007 CD2 LEU K 30 60792 55888 56987 -1967 -4786 -1634 C ATOM 10008 N CYS K 31 84.947 18.848 30.770 1.00430.68 N ANISOU10008 N CYS K 31 56824 53538 53275 -838 -5453 -1385 N ATOM 10009 CA CYS K 31 83.721 18.145 30.356 1.00405.40 C ANISOU10009 CA CYS K 31 53427 50648 49958 -537 -5597 -1305 C ATOM 10010 C CYS K 31 82.674 19.100 29.794 1.00406.62 C ANISOU10010 C CYS K 31 53797 50737 49960 -136 -5443 -1150 C ATOM 10011 O CYS K 31 82.006 18.790 28.809 1.00411.85 O ANISOU10011 O CYS K 31 54357 51626 50501 133 -5486 -1035 O ATOM 10012 CB CYS K 31 83.155 17.301 31.494 1.00387.08 C ANISOU10012 CB CYS K 31 50876 48537 47658 -596 -5784 -1432 C ATOM 10013 SG CYS K 31 83.875 15.643 31.555 1.00354.94 S ANISOU10013 SG CYS K 31 46432 44737 43689 -872 -6006 -1529 S ATOM 10014 N GLU K 32 82.561 20.268 30.406 1.00404.10 N ANISOU10014 N GLU K 32 53777 50119 49640 -94 -5252 -1150 N ATOM 10015 CA GLU K 32 81.744 21.330 29.859 1.00406.78 C ANISOU10015 CA GLU K 32 54384 50334 49839 288 -5047 -980 C ATOM 10016 C GLU K 32 82.247 21.988 28.548 1.00418.39 C ANISOU10016 C GLU K 32 56067 51633 51267 413 -4837 -810 C ATOM 10017 O GLU K 32 81.424 22.435 27.748 1.00424.85 O ANISOU10017 O GLU K 32 56985 52519 51919 817 -4739 -630 O ATOM 10018 CB GLU K 32 81.473 22.367 30.938 1.00399.04 C ANISOU10018 CB GLU K 32 53672 49064 48877 291 -4880 -1034 C ATOM 10019 CG GLU K 32 80.200 22.078 31.700 1.00388.85 C ANISOU10019 CG GLU K 32 52252 47994 47499 495 -5019 -1065 C ATOM 10020 CD GLU K 32 78.963 22.458 30.903 1.00383.53 C ANISOU10020 CD GLU K 32 51639 47468 46616 991 -4953 -873 C ATOM 10021 OE1 GLU K 32 78.882 23.622 30.445 1.00382.46 O ANISOU10021 OE1 GLU K 32 51839 47067 46410 1215 -4681 -726 O ATOM 10022 OE2 GLU K 32 78.078 21.594 30.733 1.00374.25 O ANISOU10022 OE2 GLU K 32 50176 46682 45340 1161 -5158 -875 O ATOM 10023 N GLU K 33 83.569 22.065 28.333 1.00421.72 N ANISOU10023 N GLU K 33 56558 51851 51825 90 -4761 -864 N ATOM 10024 CA GLU K 33 84.150 22.601 27.064 1.00422.10 C ANISOU10024 CA GLU K 33 56795 51735 51847 176 -4563 -709 C ATOM 10025 C GLU K 33 83.837 21.707 25.845 1.00423.54 C ANISOU10025 C GLU K 33 56720 52283 51922 378 -4729 -591 C ATOM 10026 O GLU K 33 83.621 22.213 24.732 1.00424.15 O ANISOU10026 O GLU K 33 56940 52338 51878 677 -4577 -400 O ATOM 10027 CB GLU K 33 85.679 22.805 27.170 1.00415.42 C ANISOU10027 CB GLU K 33 56046 50614 51178 -257 -4456 -827 C ATOM 10028 CG GLU K 33 86.189 24.223 27.433 1.00410.65 C ANISOU10028 CG GLU K 33 55863 49529 50635 -345 -4093 -840 C ATOM 10029 CD GLU K 33 87.716 24.315 27.463 1.00404.67 C ANISOU10029 CD GLU K 33 55149 48566 50042 -796 -4003 -986 C ATOM 10030 OE1 GLU K 33 88.391 23.777 26.554 1.00399.82 O ANISOU10030 OE1 GLU K 33 54411 48052 49448 -878 -4071 -938 O ATOM 10031 OE2 GLU K 33 88.251 24.936 28.403 1.00401.72 O ANISOU10031 OE2 GLU K 33 54924 47940 49769 -1078 -3859 -1164 O ATOM 10032 N VAL K 34 83.843 20.386 26.074 1.00424.29 N ANISOU10032 N VAL K 34 56440 52709 52062 208 -5022 -711 N ATOM 10033 CA VAL K 34 83.471 19.375 25.063 1.00422.69 C ANISOU10033 CA VAL K 34 55939 52895 51766 356 -5200 -651 C ATOM 10034 C VAL K 34 81.941 19.367 24.879 1.00426.64 C ANISOU10034 C VAL K 34 56355 53685 52063 783 -5249 -571 C ATOM 10035 O VAL K 34 81.448 19.130 23.779 1.00429.27 O ANISOU10035 O VAL K 34 56574 54282 52246 1054 -5273 -460 O ATOM 10036 CB VAL K 34 83.998 17.943 25.402 1.00416.27 C ANISOU10036 CB VAL K 34 54769 52317 51077 22 -5459 -814 C ATOM 10037 CG1 VAL K 34 83.487 16.911 24.401 1.00412.56 C ANISOU10037 CG1 VAL K 34 53995 52250 50510 175 -5617 -777 C ATOM 10038 CG2 VAL K 34 85.525 17.896 25.454 1.00411.68 C ANISOU10038 CG2 VAL K 34 54238 51514 50666 -368 -5421 -883 C ATOM 10039 N ALA K 35 81.205 19.638 25.962 1.00427.98 N ANISOU10039 N ALA K 35 56569 53823 52218 841 -5260 -638 N ATOM 10040 CA ALA K 35 79.748 19.830 25.910 1.00425.12 C ANISOU10040 CA ALA K 35 56169 53700 51656 1256 -5273 -565 C ATOM 10041 C ALA K 35 79.355 21.030 25.034 1.00427.02 C ANISOU10041 C ALA K 35 56710 53815 51721 1671 -5019 -336 C ATOM 10042 O ALA K 35 78.285 21.025 24.429 1.00424.07 O ANISOU10042 O ALA K 35 56242 53754 51131 2071 -5040 -235 O ATOM 10043 CB ALA K 35 79.181 19.990 27.313 1.00425.49 C ANISOU10043 CB ALA K 35 56247 53676 51744 1205 -5310 -681 C ATOM 10044 N LEU K 36 80.227 22.046 24.976 1.00431.00 N ANISOU10044 N LEU K 36 57573 53874 52313 1580 -4764 -262 N ATOM 10045 CA LEU K 36 80.058 23.235 24.103 1.00437.60 C ANISOU10045 CA LEU K 36 58749 54513 53006 1953 -4462 -25 C ATOM 10046 C LEU K 36 80.294 22.961 22.601 1.00449.04 C ANISOU10046 C LEU K 36 60109 56160 54346 2127 -4456 121 C ATOM 10047 O LEU K 36 79.574 23.500 21.746 1.00455.35 O ANISOU10047 O LEU K 36 61007 57083 54921 2594 -4323 326 O ATOM 10048 CB LEU K 36 80.941 24.414 24.581 1.00429.71 C ANISOU10048 CB LEU K 36 58177 52938 52154 1760 -4151 -20 C ATOM 10049 CG LEU K 36 80.301 25.635 25.278 1.00423.65 C ANISOU10049 CG LEU K 36 57762 51873 51332 1983 -3892 44 C ATOM 10050 CD1 LEU K 36 79.493 25.277 26.520 1.00416.97 C ANISOU10050 CD1 LEU K 36 56754 51182 50492 1943 -4082 -107 C ATOM 10051 CD2 LEU K 36 81.357 26.682 25.609 1.00421.69 C ANISOU10051 CD2 LEU K 36 57909 51059 51253 1717 -3566 11 C ATOM 10052 N ASP K 37 81.296 22.132 22.292 1.00457.27 N ANISOU10052 N ASP K 37 60962 57243 55533 1769 -4595 22 N ATOM 10053 CA ASP K 37 81.646 21.784 20.899 1.00461.65 C ANISOU10053 CA ASP K 37 61414 57981 56009 1875 -4605 138 C ATOM 10054 C ASP K 37 80.623 20.861 20.180 1.00461.90 C ANISOU10054 C ASP K 37 61066 58596 55837 2158 -4827 150 C ATOM 10055 O ASP K 37 80.321 21.097 18.993 1.00469.12 O ANISOU10055 O ASP K 37 61992 59693 56559 2509 -4745 325 O ATOM 10056 CB ASP K 37 83.090 21.230 20.818 1.00457.14 C ANISOU10056 CB ASP K 37 60776 57253 55662 1394 -4667 24 C ATOM 10057 CG ASP K 37 83.504 20.836 19.400 1.00450.91 C ANISOU10057 CG ASP K 37 59874 56643 54805 1477 -4684 134 C ATOM 10058 OD1 ASP K 37 83.453 21.688 18.485 1.00445.94 O ANISOU10058 OD1 ASP K 37 59487 55903 54047 1790 -4453 344 O ATOM 10059 OD2 ASP K 37 83.888 19.662 19.217 1.00447.06 O ANISOU10059 OD2 ASP K 37 59062 56405 54394 1232 -4916 13 O ATOM 10060 N LYS K 38 80.089 19.853 20.899 1.00449.70 N ANISOU10060 N LYS K 38 59195 57342 54326 2011 -5085 -39 N ATOM 10061 CA LYS K 38 79.163 18.822 20.352 1.00431.46 C ANISOU10061 CA LYS K 38 56480 55599 51856 2184 -5301 -99 C ATOM 10062 C LYS K 38 77.669 19.097 20.622 1.00429.03 C ANISOU10062 C LYS K 38 56115 55571 51323 2586 -5314 -74 C ATOM 10063 O LYS K 38 76.815 18.267 20.306 1.00429.41 O ANISOU10063 O LYS K 38 55815 56105 51234 2711 -5485 -163 O ATOM 10064 CB LYS K 38 79.546 17.413 20.854 1.00414.89 C ANISOU10064 CB LYS K 38 54037 53663 49937 1757 -5552 -332 C ATOM 10065 CG LYS K 38 80.937 16.935 20.443 1.00399.43 C ANISOU10065 CG LYS K 38 52056 51543 48164 1393 -5574 -361 C ATOM 10066 CD LYS K 38 81.000 16.420 19.004 1.00382.62 C ANISOU10066 CD LYS K 38 49735 49724 45919 1522 -5615 -296 C ATOM 10067 CE LYS K 38 82.432 16.118 18.575 1.00368.01 C ANISOU10067 CE LYS K 38 47915 47663 44249 1183 -5605 -299 C ATOM 10068 NZ LYS K 38 82.577 15.971 17.098 1.00356.70 N ANISOU10068 NZ LYS K 38 46396 46444 42690 1358 -5582 -185 N ATOM 10069 N ALA K 39 77.378 20.269 21.193 1.00423.36 N ANISOU10069 N ALA K 39 55739 54547 50569 2778 -5117 35 N ATOM 10070 CA ALA K 39 76.017 20.733 21.517 1.00415.70 C ANISOU10070 CA ALA K 39 54782 53778 49385 3184 -5089 85 C ATOM 10071 C ALA K 39 75.197 19.751 22.357 1.00407.93 C ANISOU10071 C ALA K 39 53453 53126 48413 3063 -5338 -136 C ATOM 10072 O ALA K 39 73.964 19.738 22.259 1.00408.93 O ANISOU10072 O ALA K 39 53432 53627 48314 3411 -5384 -128 O ATOM 10073 CB ALA K 39 75.256 21.150 20.256 1.00417.07 C ANISOU10073 CB ALA K 39 54941 54287 49240 3729 -4993 289 C ATOM 10074 N MET K 40 75.894 18.958 23.183 1.00395.17 N ANISOU10074 N MET K 40 51718 51375 47051 2581 -5481 -330 N ATOM 10075 CA MET K 40 75.277 17.969 24.089 1.00382.06 C ANISOU10075 CA MET K 40 49758 49960 45447 2407 -5693 -547 C ATOM 10076 C MET K 40 76.064 17.841 25.428 1.00370.76 C ANISOU10076 C MET K 40 48428 48156 44288 1974 -5725 -679 C ATOM 10077 O MET K 40 77.258 17.501 25.425 1.00363.46 O ANISOU10077 O MET K 40 47518 47027 43551 1625 -5741 -722 O ATOM 10078 CB MET K 40 75.125 16.610 23.375 1.00377.41 C ANISOU10078 CB MET K 40 48742 49827 44827 2307 -5884 -679 C ATOM 10079 CG MET K 40 73.780 15.906 23.587 1.00372.59 C ANISOU10079 CG MET K 40 47802 49694 44068 2459 -6024 -825 C ATOM 10080 SD MET K 40 72.514 16.154 22.310 1.00364.67 S ANISOU10080 SD MET K 40 46626 49252 42678 3017 -6000 -732 S ATOM 10081 CE MET K 40 71.629 17.606 22.905 1.00364.83 C ANISOU10081 CE MET K 40 46978 49115 42526 3451 -5837 -560 C ATOM 10082 N GLN K 41 75.381 18.124 26.549 1.00361.66 N ANISOU10082 N GLN K 41 47334 46944 43135 2016 -5733 -741 N ATOM 10083 CA GLN K 41 75.982 18.188 27.905 1.00347.86 C ANISOU10083 CA GLN K 41 45704 44862 41602 1673 -5743 -857 C ATOM 10084 C GLN K 41 76.053 16.836 28.637 1.00340.85 C ANISOU10084 C GLN K 41 44494 44161 40852 1351 -5958 -1064 C ATOM 10085 O GLN K 41 75.516 15.821 28.170 1.00335.67 O ANISOU10085 O GLN K 41 43518 43888 40133 1385 -6093 -1140 O ATOM 10086 CB GLN K 41 75.336 19.309 28.780 1.00343.60 C ANISOU10086 CB GLN K 41 45444 44102 41006 1871 -5607 -807 C ATOM 10087 CG GLN K 41 74.231 18.923 29.771 1.00337.39 C ANISOU10087 CG GLN K 41 44493 43525 40175 1938 -5734 -929 C ATOM 10088 CD GLN K 41 72.818 19.320 29.325 1.00338.43 C ANISOU10088 CD GLN K 41 44592 43956 40039 2422 -5702 -834 C ATOM 10089 OE1 GLN K 41 72.466 20.496 29.217 1.00339.95 O ANISOU10089 OE1 GLN K 41 45077 43978 40111 2730 -5512 -675 O ATOM 10090 NE2 GLN K 41 72.017 18.318 29.039 1.00337.98 N ANISOU10090 NE2 GLN K 41 44171 44362 39881 2493 -5873 -936 N ATOM 10091 N PHE K 42 76.730 16.837 29.781 1.00337.91 N ANISOU10091 N PHE K 42 44209 43520 40663 1042 -5970 -1160 N ATOM 10092 CA PHE K 42 77.063 15.609 30.488 1.00337.34 C ANISOU10092 CA PHE K 42 43876 43558 40737 721 -6136 -1329 C ATOM 10093 C PHE K 42 76.207 15.426 31.721 1.00341.07 C ANISOU10093 C PHE K 42 44282 44097 41209 739 -6205 -1438 C ATOM 10094 O PHE K 42 75.783 16.403 32.335 1.00341.01 O ANISOU10094 O PHE K 42 44496 43914 41155 880 -6114 -1401 O ATOM 10095 CB PHE K 42 78.526 15.650 30.919 1.00334.04 C ANISOU10095 CB PHE K 42 43570 42838 40511 356 -6108 -1365 C ATOM 10096 CG PHE K 42 79.501 15.574 29.781 1.00334.54 C ANISOU10096 CG PHE K 42 43648 42854 40606 266 -6066 -1288 C ATOM 10097 CD1 PHE K 42 79.165 16.045 28.509 1.00338.37 C ANISOU10097 CD1 PHE K 42 44201 43417 40947 548 -5981 -1143 C ATOM 10098 CD2 PHE K 42 80.769 15.046 29.982 1.00332.52 C ANISOU10098 CD2 PHE K 42 43337 42490 40513 -86 -6108 -1356 C ATOM 10099 CE1 PHE K 42 80.070 15.979 27.459 1.00341.02 C ANISOU10099 CE1 PHE K 42 44553 43706 41312 467 -5939 -1070 C ATOM 10100 CE2 PHE K 42 81.684 14.983 28.940 1.00336.25 C ANISOU10100 CE2 PHE K 42 43824 42916 41017 -175 -6069 -1287 C ATOM 10101 CZ PHE K 42 81.335 15.447 27.676 1.00340.83 C ANISOU10101 CZ PHE K 42 44477 43556 41464 94 -5984 -1145 C ATOM 10102 N SER K 43 75.963 14.169 32.088 1.00346.47 N ANISOU10102 N SER K 43 44670 45022 41951 594 -6348 -1573 N ATOM 10103 CA SER K 43 75.358 13.869 33.386 1.00351.29 C ANISOU10103 CA SER K 43 45213 45661 42598 545 -6412 -1689 C ATOM 10104 C SER K 43 76.397 14.109 34.495 1.00347.45 C ANISOU10104 C SER K 43 44873 44865 42274 259 -6395 -1733 C ATOM 10105 O SER K 43 77.612 13.996 34.254 1.00352.35 O ANISOU10105 O SER K 43 45528 45344 43001 31 -6380 -1721 O ATOM 10106 CB SER K 43 74.764 12.447 33.427 1.00354.84 C ANISOU10106 CB SER K 43 45314 46448 43059 481 -6531 -1822 C ATOM 10107 OG SER K 43 75.755 11.437 33.557 1.00360.64 O ANISOU10107 OG SER K 43 45913 47157 43955 168 -6582 -1886 O ATOM 10108 N LYS K 44 75.925 14.452 35.695 1.00335.87 N ANISOU10108 N LYS K 44 43483 43316 40815 275 -6397 -1792 N ATOM 10109 CA LYS K 44 76.820 14.784 36.806 1.00320.59 C ANISOU10109 CA LYS K 44 41681 41124 39004 28 -6375 -1851 C ATOM 10110 C LYS K 44 77.608 13.520 37.229 1.00320.07 C ANISOU10110 C LYS K 44 41385 41157 39067 -260 -6482 -1945 C ATOM 10111 O LYS K 44 78.789 13.583 37.612 1.00312.90 O ANISOU10111 O LYS K 44 40532 40094 38258 -504 -6469 -1974 O ATOM 10112 CB LYS K 44 76.022 15.408 37.960 1.00309.73 C ANISOU10112 CB LYS K 44 40421 39671 37590 136 -6353 -1896 C ATOM 10113 CG LYS K 44 76.538 16.748 38.439 1.00300.54 C ANISOU10113 CG LYS K 44 39577 38166 36447 94 -6210 -1876 C ATOM 10114 CD LYS K 44 76.035 17.874 37.577 1.00297.38 C ANISOU10114 CD LYS K 44 39415 37648 35925 383 -6057 -1737 C ATOM 10115 CE LYS K 44 74.713 18.390 38.129 1.00293.67 C ANISOU10115 CE LYS K 44 39016 37223 35339 663 -6034 -1724 C ATOM 10116 NZ LYS K 44 74.427 19.821 37.803 1.00293.59 N ANISOU10116 NZ LYS K 44 39344 36969 35236 906 -5824 -1600 N ATOM 10117 N GLN K 45 76.944 12.377 37.087 1.00326.80 N ANISOU10117 N GLN K 45 41978 42281 39907 -220 -6569 -1993 N ATOM 10118 CA GLN K 45 77.535 11.060 37.299 1.00334.16 C ANISOU10118 CA GLN K 45 42686 43330 40948 -440 -6639 -2060 C ATOM 10119 C GLN K 45 78.695 10.726 36.303 1.00345.56 C ANISOU10119 C GLN K 45 44096 44748 42453 -597 -6630 -2008 C ATOM 10120 O GLN K 45 79.669 10.049 36.677 1.00348.22 O ANISOU10120 O GLN K 45 44349 45064 42893 -822 -6658 -2040 O ATOM 10121 CB GLN K 45 76.417 9.995 37.283 1.00329.21 C ANISOU10121 CB GLN K 45 41812 42983 40288 -345 -6688 -2134 C ATOM 10122 CG GLN K 45 75.343 10.162 38.373 1.00324.30 C ANISOU10122 CG GLN K 45 41197 42399 39620 -223 -6703 -2199 C ATOM 10123 CD GLN K 45 74.323 11.256 38.075 1.00323.57 C ANISOU10123 CD GLN K 45 41245 42314 39381 59 -6669 -2150 C ATOM 10124 OE1 GLN K 45 74.258 11.774 36.958 1.00325.39 O ANISOU10124 OE1 GLN K 45 41538 42570 39525 201 -6630 -2066 O ATOM 10125 NE2 GLN K 45 73.530 11.618 39.080 1.00319.61 N ANISOU10125 NE2 GLN K 45 40798 41795 38842 160 -6674 -2194 N ATOM 10126 N THR K 46 78.595 11.211 35.056 1.00359.00 N ANISOU10126 N THR K 46 45861 46459 44080 -462 -6587 -1921 N ATOM 10127 CA THR K 46 79.658 11.062 34.021 1.00366.83 C ANISOU10127 CA THR K 46 46850 47409 45118 -587 -6567 -1860 C ATOM 10128 C THR K 46 80.928 11.828 34.390 1.00368.11 C ANISOU10128 C THR K 46 47215 47291 45356 -779 -6510 -1840 C ATOM 10129 O THR K 46 82.050 11.339 34.196 1.00374.77 O ANISOU10129 O THR K 46 47996 48112 46288 -995 -6527 -1847 O ATOM 10130 CB THR K 46 79.177 11.529 32.622 1.00370.24 C ANISOU10130 CB THR K 46 47322 47923 45428 -357 -6520 -1761 C ATOM 10131 OG1 THR K 46 78.157 10.646 32.148 1.00375.09 O ANISOU10131 OG1 THR K 46 47689 48858 45970 -228 -6577 -1814 O ATOM 10132 CG2 THR K 46 80.324 11.536 31.604 1.00368.53 C ANISOU10132 CG2 THR K 46 47140 47623 45258 -484 -6487 -1689 C ATOM 10133 N ILE K 47 80.735 13.031 34.919 1.00363.85 N ANISOU10133 N ILE K 47 46916 46551 44780 -702 -6430 -1827 N ATOM 10134 CA ILE K 47 81.832 13.835 35.411 1.00359.62 C ANISOU10134 CA ILE K 47 46573 45754 44311 -900 -6352 -1852 C ATOM 10135 C ILE K 47 82.592 13.077 36.501 1.00357.74 C ANISOU10135 C ILE K 47 46188 45568 44166 -1157 -6436 -1964 C ATOM 10136 O ILE K 47 83.824 13.017 36.465 1.00357.75 O ANISOU10136 O ILE K 47 46188 45503 44235 -1383 -6424 -1989 O ATOM 10137 CB ILE K 47 81.338 15.187 35.964 1.00359.24 C ANISOU10137 CB ILE K 47 46799 45487 44209 -774 -6233 -1846 C ATOM 10138 CG1 ILE K 47 80.320 15.861 35.013 1.00358.63 C ANISOU10138 CG1 ILE K 47 46849 45410 44002 -437 -6149 -1718 C ATOM 10139 CG2 ILE K 47 82.525 16.068 36.321 1.00363.60 C ANISOU10139 CG2 ILE K 47 47554 45763 44831 -1007 -6115 -1897 C ATOM 10140 CD1 ILE K 47 80.844 16.319 33.661 1.00354.85 C ANISOU10140 CD1 ILE K 47 46490 44837 43498 -382 -6044 -1596 C ATOM 10141 N ALA K 48 81.850 12.486 37.444 1.00355.80 N ANISOU10141 N ALA K 48 45814 45460 43914 -1106 -6513 -2026 N ATOM 10142 CA ALA K 48 82.422 11.680 38.540 1.00358.60 C ANISOU10142 CA ALA K 48 46015 45900 44333 -1292 -6585 -2115 C ATOM 10143 C ALA K 48 83.273 10.479 38.078 1.00365.13 C ANISOU10143 C ALA K 48 46637 46868 45227 -1442 -6638 -2101 C ATOM 10144 O ALA K 48 84.318 10.180 38.683 1.00363.89 O ANISOU10144 O ALA K 48 46423 46721 45116 -1635 -6657 -2147 O ATOM 10145 CB ALA K 48 81.328 11.230 39.509 1.00352.54 C ANISOU10145 CB ALA K 48 45153 45255 43539 -1170 -6638 -2165 C ATOM 10146 N ALA K 49 82.836 9.817 37.001 1.00375.95 N ANISOU10146 N ALA K 49 47893 48361 46589 -1347 -6653 -2043 N ATOM 10147 CA ALA K 49 83.469 8.577 36.474 1.00380.39 C ANISOU10147 CA ALA K 49 48254 49061 47214 -1465 -6686 -2028 C ATOM 10148 C ALA K 49 84.810 8.747 35.721 1.00382.02 C ANISOU10148 C ALA K 49 48502 49185 47463 -1633 -6664 -1985 C ATOM 10149 O ALA K 49 85.700 7.875 35.817 1.00376.21 O ANISOU10149 O ALA K 49 47629 48526 46785 -1787 -6689 -1991 O ATOM 10150 CB ALA K 49 82.475 7.813 35.606 1.00383.23 C ANISOU10150 CB ALA K 49 48464 49596 47546 -1322 -6695 -2013 C ATOM 10151 N ILE K 50 84.924 9.846 34.958 1.00386.21 N ANISOU10151 N ILE K 50 49224 49561 47958 -1588 -6603 -1935 N ATOM 10152 CA ILE K 50 86.172 10.260 34.267 1.00381.46 C ANISOU10152 CA ILE K 50 48707 48838 47391 -1748 -6557 -1901 C ATOM 10153 C ILE K 50 87.257 10.718 35.281 1.00380.19 C ANISOU10153 C ILE K 50 48613 48573 47267 -1968 -6538 -1987 C ATOM 10154 O ILE K 50 88.458 10.535 35.032 1.00377.79 O ANISOU10154 O ILE K 50 48270 48267 47006 -2159 -6535 -1998 O ATOM 10155 CB ILE K 50 85.924 11.357 33.172 1.00379.61 C ANISOU10155 CB ILE K 50 48681 48449 47102 -1612 -6461 -1815 C ATOM 10156 CG1 ILE K 50 84.833 10.929 32.174 1.00376.27 C ANISOU10156 CG1 ILE K 50 48163 48191 46609 -1375 -6485 -1744 C ATOM 10157 CG2 ILE K 50 87.207 11.718 32.418 1.00375.94 C ANISOU10157 CG2 ILE K 50 48301 47856 46681 -1785 -6399 -1783 C ATOM 10158 CD1 ILE K 50 84.377 12.028 31.229 1.00371.84 C ANISOU10158 CD1 ILE K 50 47806 47519 45957 -1166 -6384 -1643 C ATOM 10159 N SER K 51 86.832 11.303 36.416 1.00377.37 N ANISOU10159 N SER K 51 48344 48156 46884 -1943 -6526 -2061 N ATOM 10160 CA SER K 51 87.755 11.697 37.519 1.00371.15 C ANISOU10160 CA SER K 51 47585 47325 46111 -2149 -6512 -2177 C ATOM 10161 C SER K 51 88.346 10.486 38.261 1.00363.05 C ANISOU10161 C SER K 51 46314 46524 45104 -2256 -6608 -2216 C ATOM 10162 O SER K 51 89.565 10.431 38.508 1.00366.15 O ANISOU10162 O SER K 51 46652 46960 45507 -2454 -6609 -2273 O ATOM 10163 CB SER K 51 87.079 12.670 38.495 1.00373.77 C ANISOU10163 CB SER K 51 48077 47535 46402 -2084 -6463 -2249 C ATOM 10164 OG SER K 51 86.781 13.900 37.857 1.00374.47 O ANISOU10164 OG SER K 51 48424 47385 46471 -2005 -6333 -2211 O ATOM 10165 N GLU K 52 87.472 9.527 38.593 1.00347.30 N ANISOU10165 N GLU K 52 44175 44676 43105 -2114 -6671 -2185 N ATOM 10166 CA GLU K 52 87.856 8.212 39.130 1.00334.72 C ANISOU10166 CA GLU K 52 42358 43288 41532 -2156 -6728 -2183 C ATOM 10167 C GLU K 52 88.862 7.522 38.183 1.00342.95 C ANISOU10167 C GLU K 52 43297 44392 42617 -2269 -6730 -2124 C ATOM 10168 O GLU K 52 89.935 7.073 38.627 1.00354.53 O ANISOU10168 O GLU K 52 44656 45967 44081 -2400 -6747 -2145 O ATOM 10169 CB GLU K 52 86.613 7.341 39.425 1.00312.08 C ANISOU10169 CB GLU K 52 39385 40525 38666 -1978 -6750 -2157 C ATOM 10170 CG GLU K 52 85.742 7.866 40.570 1.00293.26 C ANISOU10170 CG GLU K 52 37071 38114 36237 -1879 -6758 -2221 C ATOM 10171 CD GLU K 52 84.583 6.956 40.907 1.00280.74 C ANISOU10171 CD GLU K 52 35370 36640 34656 -1725 -6768 -2210 C ATOM 10172 OE1 GLU K 52 84.778 5.728 40.828 1.00275.12 O ANISOU10172 OE1 GLU K 52 34492 36055 33984 -1741 -6760 -2178 O ATOM 10173 OE2 GLU K 52 83.502 7.473 41.262 1.00274.06 O ANISOU10173 OE2 GLU K 52 34603 35751 33774 -1592 -6768 -2239 O ATOM 10174 N LEU K 53 88.525 7.504 36.888 1.00342.91 N ANISOU10174 N LEU K 53 43323 44333 42634 -2207 -6710 -2051 N ATOM 10175 CA LEU K 53 89.438 7.126 35.789 1.00338.96 C ANISOU10175 CA LEU K 53 42769 43847 42172 -2312 -6702 -1994 C ATOM 10176 C LEU K 53 90.825 7.815 35.811 1.00339.27 C ANISOU10176 C LEU K 53 42880 43815 42212 -2518 -6679 -2036 C ATOM 10177 O LEU K 53 91.826 7.112 35.702 1.00344.99 O ANISOU10177 O LEU K 53 43473 44650 42956 -2637 -6699 -2024 O ATOM 10178 CB LEU K 53 88.747 7.309 34.415 1.00331.53 C ANISOU10178 CB LEU K 53 41885 42851 41230 -2191 -6677 -1922 C ATOM 10179 CG LEU K 53 89.500 7.215 33.072 1.00326.52 C ANISOU10179 CG LEU K 53 41244 42194 40624 -2266 -6657 -1856 C ATOM 10180 CD1 LEU K 53 89.716 5.773 32.623 1.00322.26 C ANISOU10180 CD1 LEU K 53 40487 41824 40132 -2295 -6682 -1822 C ATOM 10181 CD2 LEU K 53 88.766 7.974 31.978 1.00323.79 C ANISOU10181 CD2 LEU K 53 41031 41758 40235 -2114 -6615 -1797 C ATOM 10182 N THR K 54 90.879 9.151 35.962 1.00332.08 N ANISOU10182 N THR K 54 42171 42726 41277 -2560 -6622 -2093 N ATOM 10183 CA THR K 54 92.143 9.943 35.908 1.00323.11 C ANISOU10183 CA THR K 54 41122 41499 40145 -2780 -6566 -2165 C ATOM 10184 C THR K 54 93.049 9.665 37.091 1.00330.10 C ANISOU10184 C THR K 54 41874 42548 41000 -2938 -6605 -2276 C ATOM 10185 O THR K 54 94.254 9.497 36.925 1.00327.99 O ANISOU10185 O THR K 54 41526 42360 40732 -3111 -6606 -2310 O ATOM 10186 CB THR K 54 91.895 11.472 35.851 1.00314.89 C ANISOU10186 CB THR K 54 40353 40200 39091 -2788 -6449 -2214 C ATOM 10187 OG1 THR K 54 91.052 11.773 34.737 1.00307.83 O ANISOU10187 OG1 THR K 54 39584 39179 38198 -2602 -6403 -2095 O ATOM 10188 CG2 THR K 54 93.210 12.258 35.704 1.00311.97 C ANISOU10188 CG2 THR K 54 40073 39724 38736 -3043 -6357 -2309 C ATOM 10189 N PHE K 55 92.452 9.640 38.282 1.00341.51 N ANISOU10189 N PHE K 55 43291 44060 42405 -2864 -6637 -2334 N ATOM 10190 CA PHE K 55 93.140 9.304 39.531 1.00353.31 C ANISOU10190 CA PHE K 55 44637 45761 43844 -2960 -6681 -2433 C ATOM 10191 C PHE K 55 93.836 7.924 39.439 1.00351.57 C ANISOU10191 C PHE K 55 44182 45777 43619 -2962 -6741 -2357 C ATOM 10192 O PHE K 55 95.040 7.803 39.729 1.00353.12 O ANISOU10192 O PHE K 55 44268 46129 43770 -3113 -6751 -2419 O ATOM 10193 CB PHE K 55 92.126 9.379 40.699 1.00363.56 C ANISOU10193 CB PHE K 55 45946 47086 45103 -2823 -6706 -2474 C ATOM 10194 CG PHE K 55 92.700 9.049 42.063 1.00370.91 C ANISOU10194 CG PHE K 55 46721 48253 45955 -2880 -6750 -2570 C ATOM 10195 CD1 PHE K 55 93.403 10.002 42.795 1.00374.86 C ANISOU10195 CD1 PHE K 55 47260 48771 46395 -3059 -6717 -2744 C ATOM 10196 CD2 PHE K 55 92.488 7.793 42.632 1.00370.76 C ANISOU10196 CD2 PHE K 55 46516 48442 45911 -2745 -6805 -2492 C ATOM 10197 CE1 PHE K 55 93.907 9.687 44.049 1.00375.62 C ANISOU10197 CE1 PHE K 55 47189 49135 46394 -3091 -6763 -2839 C ATOM 10198 CE2 PHE K 55 92.991 7.470 43.880 1.00371.20 C ANISOU10198 CE2 PHE K 55 46427 48738 45873 -2756 -6838 -2560 C ATOM 10199 CZ PHE K 55 93.696 8.423 44.589 1.00373.69 C ANISOU10199 CZ PHE K 55 46759 49110 46113 -2923 -6828 -2735 C ATOM 10200 N ARG K 56 93.085 6.899 39.022 1.00346.97 N ANISOU10200 N ARG K 56 43524 45229 43079 -2797 -6763 -2232 N ATOM 10201 CA ARG K 56 93.628 5.537 38.941 1.00338.66 C ANISOU10201 CA ARG K 56 42272 44370 42032 -2776 -6783 -2147 C ATOM 10202 C ARG K 56 94.550 5.322 37.741 1.00340.70 C ANISOU10202 C ARG K 56 42503 44616 42330 -2890 -6770 -2094 C ATOM 10203 O ARG K 56 95.388 4.415 37.744 1.00337.39 O ANISOU10203 O ARG K 56 41928 44366 41898 -2922 -6777 -2047 O ATOM 10204 CB ARG K 56 92.535 4.474 39.131 1.00328.19 C ANISOU10204 CB ARG K 56 40868 43090 40735 -2582 -6776 -2065 C ATOM 10205 CG ARG K 56 92.415 4.163 40.623 1.00318.22 C ANISOU10205 CG ARG K 56 39526 41978 39405 -2510 -6789 -2103 C ATOM 10206 CD ARG K 56 91.151 3.477 41.120 1.00312.16 C ANISOU10206 CD ARG K 56 38731 41215 38658 -2326 -6764 -2063 C ATOM 10207 NE ARG K 56 90.211 4.382 41.807 1.00312.07 N ANISOU10207 NE ARG K 56 38840 41112 38621 -2266 -6786 -2143 N ATOM 10208 CZ ARG K 56 88.969 4.604 41.384 1.00313.01 C ANISOU10208 CZ ARG K 56 39046 41103 38779 -2161 -6775 -2135 C ATOM 10209 NH1 ARG K 56 88.544 3.973 40.302 1.00313.84 N ANISOU10209 NH1 ARG K 56 39115 41179 38947 -2117 -6745 -2069 N ATOM 10210 NH2 ARG K 56 88.140 5.423 42.040 1.00313.34 N ANISOU10210 NH2 ARG K 56 39197 41068 38789 -2095 -6790 -2201 N ATOM 10211 N GLN K 57 94.437 6.224 36.766 1.00345.16 N ANISOU10211 N GLN K 57 43227 44982 42933 -2944 -6741 -2099 N ATOM 10212 CA GLN K 57 95.342 6.275 35.612 1.00346.78 C ANISOU10212 CA GLN K 57 43440 45146 43173 -3069 -6721 -2062 C ATOM 10213 C GLN K 57 96.736 6.770 36.010 1.00347.53 C ANISOU10213 C GLN K 57 43506 45319 43220 -3283 -6715 -2168 C ATOM 10214 O GLN K 57 97.749 6.261 35.512 1.00350.03 O ANISOU10214 O GLN K 57 43714 45740 43539 -3382 -6722 -2138 O ATOM 10215 CB GLN K 57 94.765 7.179 34.514 1.00348.69 C ANISOU10215 CB GLN K 57 43879 45152 43455 -3036 -6672 -2031 C ATOM 10216 CG GLN K 57 95.479 7.095 33.173 1.00350.45 C ANISOU10216 CG GLN K 57 44108 45327 43719 -3120 -6648 -1965 C ATOM 10217 CD GLN K 57 95.303 5.751 32.486 1.00348.09 C ANISOU10217 CD GLN K 57 43645 45153 43459 -3034 -6681 -1857 C ATOM 10218 OE1 GLN K 57 94.272 5.084 32.633 1.00344.42 O ANISOU10218 OE1 GLN K 57 43118 44741 43004 -2878 -6695 -1821 O ATOM 10219 NE2 GLN K 57 96.315 5.349 31.724 1.00350.97 N ANISOU10219 NE2 GLN K 57 43939 45564 43849 -3148 -6678 -1817 N ATOM 10220 N CYS K 58 96.770 7.764 36.904 1.00343.64 N ANISOU10220 N CYS K 58 43101 44787 42679 -3361 -6693 -2306 N ATOM 10221 CA CYS K 58 98.019 8.323 37.403 1.00338.36 C ANISOU10221 CA CYS K 58 42390 44220 41949 -3584 -6673 -2456 C ATOM 10222 C CYS K 58 98.757 7.318 38.257 1.00335.08 C ANISOU10222 C CYS K 58 41724 44142 41449 -3580 -6741 -2465 C ATOM 10223 O CYS K 58 99.943 7.493 38.481 1.00339.58 O ANISOU10223 O CYS K 58 42195 44876 41953 -3753 -6739 -2571 O ATOM 10224 CB CYS K 58 97.795 9.612 38.192 1.00336.06 C ANISOU10224 CB CYS K 58 42250 43809 41626 -3673 -6612 -2624 C ATOM 10225 SG CYS K 58 97.318 11.009 37.164 1.00328.60 S ANISOU10225 SG CYS K 58 41629 42460 40762 -3714 -6475 -2627 S ATOM 10226 N GLU K 59 98.064 6.276 38.732 1.00324.65 N ANISOU10226 N GLU K 59 40298 42933 40120 -3375 -6785 -2356 N ATOM 10227 CA GLU K 59 98.726 5.128 39.382 1.00313.35 C ANISOU10227 CA GLU K 59 38637 41812 38608 -3312 -6822 -2308 C ATOM 10228 C GLU K 59 99.663 4.442 38.374 1.00309.01 C ANISOU10228 C GLU K 59 37994 41329 38085 -3373 -6816 -2217 C ATOM 10229 O GLU K 59 100.886 4.328 38.616 1.00314.53 O ANISOU10229 O GLU K 59 38554 42255 38696 -3483 -6830 -2273 O ATOM 10230 CB GLU K 59 97.703 4.141 39.999 1.00305.93 C ANISOU10230 CB GLU K 59 37640 40925 37674 -3071 -6827 -2197 C ATOM 10231 CG GLU K 59 98.301 2.928 40.721 1.00299.70 C ANISOU10231 CG GLU K 59 36640 40435 36797 -2960 -6827 -2120 C ATOM 10232 CD GLU K 59 97.457 2.402 41.881 1.00297.21 C ANISOU10232 CD GLU K 59 36283 40205 36438 -2760 -6816 -2085 C ATOM 10233 OE1 GLU K 59 96.216 2.563 41.885 1.00293.68 O ANISOU10233 OE1 GLU K 59 35953 39568 36065 -2672 -6805 -2074 O ATOM 10234 OE2 GLU K 59 98.065 1.821 42.810 1.00298.35 O ANISOU10234 OE2 GLU K 59 36270 40627 36460 -2679 -6814 -2068 O ATOM 10235 N ASN K 60 99.103 4.032 37.238 1.00297.46 N ANISOU10235 N ASN K 60 36600 39688 36733 -3308 -6795 -2093 N ATOM 10236 CA ASN K 60 99.917 3.399 36.221 1.00287.47 C ANISOU10236 CA ASN K 60 35259 38463 35502 -3365 -6785 -2006 C ATOM 10237 C ASN K 60 100.875 4.370 35.585 1.00288.83 C ANISOU10237 C ASN K 60 35498 38570 35674 -3590 -6776 -2102 C ATOM 10238 O ASN K 60 101.992 4.003 35.341 1.00289.98 O ANISOU10238 O ASN K 60 35523 38872 35781 -3684 -6782 -2097 O ATOM 10239 CB ASN K 60 99.085 2.666 35.187 1.00278.11 C ANISOU10239 CB ASN K 60 34107 37136 34426 -3246 -6758 -1868 C ATOM 10240 CG ASN K 60 98.286 1.540 35.792 1.00273.95 C ANISOU10240 CG ASN K 60 33492 36690 33906 -3050 -6733 -1785 C ATOM 10241 OD1 ASN K 60 98.776 0.783 36.628 1.00271.56 O ANISOU10241 OD1 ASN K 60 33053 36594 33534 -2986 -6720 -1753 O ATOM 10242 ND2 ASN K 60 97.040 1.432 35.380 1.00272.53 N ANISOU10242 ND2 ASN K 60 33390 36358 33800 -2945 -6711 -1752 N ATOM 10243 N PHE K 61 100.468 5.614 35.364 1.00289.87 N ANISOU10243 N PHE K 61 35824 38473 35840 -3673 -6744 -2191 N ATOM 10244 CA PHE K 61 101.416 6.654 34.950 1.00290.56 C ANISOU10244 CA PHE K 61 35993 38485 35921 -3909 -6697 -2314 C ATOM 10245 C PHE K 61 102.662 6.786 35.826 1.00294.77 C ANISOU10245 C PHE K 61 36368 39292 36338 -4079 -6711 -2469 C ATOM 10246 O PHE K 61 103.784 6.680 35.339 1.00291.79 O ANISOU10246 O PHE K 61 35904 39022 35940 -4224 -6705 -2495 O ATOM 10247 CB PHE K 61 100.735 8.014 34.883 1.00289.87 C ANISOU10247 CB PHE K 61 36153 38112 35871 -3952 -6623 -2399 C ATOM 10248 CG PHE K 61 99.950 8.231 33.633 1.00289.32 C ANISOU10248 CG PHE K 61 36255 37777 35895 -3851 -6581 -2272 C ATOM 10249 CD1 PHE K 61 100.128 7.399 32.527 1.00288.32 C ANISOU10249 CD1 PHE K 61 36058 37672 35818 -3803 -6605 -2132 C ATOM 10250 CD2 PHE K 61 99.051 9.286 33.543 1.00290.69 C ANISOU10250 CD2 PHE K 61 36658 37694 36094 -3795 -6508 -2294 C ATOM 10251 CE1 PHE K 61 99.406 7.605 31.361 1.00290.25 C ANISOU10251 CE1 PHE K 61 36439 37714 36125 -3700 -6569 -2024 C ATOM 10252 CE2 PHE K 61 98.328 9.503 32.376 1.00292.06 C ANISOU10252 CE2 PHE K 61 36979 37665 36325 -3669 -6466 -2169 C ATOM 10253 CZ PHE K 61 98.505 8.660 31.285 1.00291.87 C ANISOU10253 CZ PHE K 61 36864 37693 36340 -3623 -6502 -2039 C ATOM 10254 N ALA K 62 102.446 7.034 37.118 1.00302.79 N ANISOU10254 N ALA K 62 37337 40438 37267 -4057 -6730 -2581 N ATOM 10255 CA ALA K 62 103.529 7.326 38.078 1.00310.59 C ANISOU10255 CA ALA K 62 38168 41723 38118 -4219 -6739 -2772 C ATOM 10256 C ALA K 62 104.448 6.140 38.346 1.00314.27 C ANISOU10256 C ALA K 62 38364 42565 38478 -4154 -6802 -2702 C ATOM 10257 O ALA K 62 105.680 6.266 38.378 1.00313.92 O ANISOU10257 O ALA K 62 38181 42748 38343 -4325 -6801 -2818 O ATOM 10258 CB ALA K 62 102.950 7.819 39.393 1.00312.86 C ANISOU10258 CB ALA K 62 38466 42071 38333 -4181 -6745 -2898 C ATOM 10259 N LYS K 63 103.840 4.986 38.565 1.00319.47 N ANISOU10259 N LYS K 63 38946 43295 39140 -3901 -6839 -2517 N ATOM 10260 CA LYS K 63 104.629 3.806 38.832 1.00323.43 C ANISOU10260 CA LYS K 63 39216 44131 39539 -3793 -6868 -2419 C ATOM 10261 C LYS K 63 105.261 3.254 37.519 1.00327.48 C ANISOU10261 C LYS K 63 39712 44587 40127 -3841 -6852 -2298 C ATOM 10262 O LYS K 63 106.400 2.783 37.553 1.00326.99 O ANISOU10262 O LYS K 63 39469 44808 39963 -3878 -6865 -2299 O ATOM 10263 CB LYS K 63 103.859 2.825 39.736 1.00319.74 C ANISOU10263 CB LYS K 63 38675 43781 39030 -3513 -6876 -2288 C ATOM 10264 CG LYS K 63 103.506 3.479 41.080 1.00314.30 C ANISOU10264 CG LYS K 63 37974 43207 38238 -3502 -6899 -2439 C ATOM 10265 CD LYS K 63 102.567 2.604 41.914 1.00308.01 C ANISOU10265 CD LYS K 63 37146 42461 37421 -3221 -6891 -2305 C ATOM 10266 CE LYS K 63 102.035 3.327 43.144 1.00304.70 C ANISOU10266 CE LYS K 63 36748 42098 36923 -3209 -6916 -2450 C ATOM 10267 NZ LYS K 63 100.753 4.041 42.878 1.00302.06 N ANISOU10267 NZ LYS K 63 36646 41389 36731 -3219 -6903 -2470 N ATOM 10268 N ASP K 64 104.581 3.411 36.369 1.00331.03 N ANISOU10268 N ASP K 64 40341 44697 40737 -3851 -6824 -2213 N ATOM 10269 CA ASP K 64 105.244 3.243 35.040 1.00331.05 C ANISOU10269 CA ASP K 64 40356 44614 40812 -3956 -6806 -2147 C ATOM 10270 C ASP K 64 106.397 4.256 34.827 1.00333.47 C ANISOU10270 C ASP K 64 40662 44969 41072 -4235 -6792 -2330 C ATOM 10271 O ASP K 64 107.482 3.856 34.372 1.00339.64 O ANISOU10271 O ASP K 64 41316 45918 41813 -4318 -6798 -2315 O ATOM 10272 CB ASP K 64 104.263 3.314 33.844 1.00324.25 C ANISOU10272 CB ASP K 64 39681 43405 40111 -3906 -6777 -2037 C ATOM 10273 CG ASP K 64 103.329 2.101 33.741 1.00315.83 C ANISOU10273 CG ASP K 64 38578 42318 39103 -3671 -6770 -1863 C ATOM 10274 OD1 ASP K 64 103.422 1.166 34.562 1.00314.29 O ANISOU10274 OD1 ASP K 64 38238 42337 38839 -3534 -6769 -1804 O ATOM 10275 OD2 ASP K 64 102.482 2.101 32.823 1.00305.19 O ANISOU10275 OD2 ASP K 64 37348 40743 37864 -3621 -6749 -1793 O ATOM 10276 N LEU K 65 106.158 5.542 35.143 1.00327.96 N ANISOU10276 N LEU K 65 40109 44118 40381 -4382 -6755 -2505 N ATOM 10277 CA LEU K 65 107.212 6.588 35.154 1.00324.21 C ANISOU10277 CA LEU K 65 39636 43692 39855 -4675 -6705 -2729 C ATOM 10278 C LEU K 65 108.410 6.233 36.081 1.00331.53 C ANISOU10278 C LEU K 65 40282 45086 40596 -4747 -6750 -2857 C ATOM 10279 O LEU K 65 109.564 6.445 35.713 1.00337.24 O ANISOU10279 O LEU K 65 40914 45950 41272 -4946 -6729 -2963 O ATOM 10280 CB LEU K 65 106.642 7.993 35.472 1.00313.59 C ANISOU10280 CB LEU K 65 38510 42089 38550 -4803 -6622 -2901 C ATOM 10281 CG LEU K 65 105.746 8.710 34.456 1.00304.27 C ANISOU10281 CG LEU K 65 37624 40459 37523 -4784 -6540 -2821 C ATOM 10282 CD1 LEU K 65 105.010 9.891 35.069 1.00303.36 C ANISOU10282 CD1 LEU K 65 37707 40131 37423 -4828 -6457 -2958 C ATOM 10283 CD2 LEU K 65 106.573 9.154 33.270 1.00300.87 C ANISOU10283 CD2 LEU K 65 37274 39887 37154 -4977 -6460 -2839 C ATOM 10284 N GLU K 66 108.139 5.672 37.259 1.00333.48 N ANISOU10284 N GLU K 66 40384 45594 40728 -4571 -6807 -2843 N ATOM 10285 CA GLU K 66 109.194 5.208 38.179 1.00335.91 C ANISOU10285 CA GLU K 66 40402 46399 40827 -4569 -6853 -2932 C ATOM 10286 C GLU K 66 110.181 4.167 37.590 1.00329.46 C ANISOU10286 C GLU K 66 39403 45819 39956 -4511 -6879 -2794 C ATOM 10287 O GLU K 66 111.402 4.346 37.636 1.00332.46 O ANISOU10287 O GLU K 66 39614 46493 40213 -4677 -6883 -2937 O ATOM 10288 CB GLU K 66 108.543 4.646 39.439 1.00344.69 C ANISOU10288 CB GLU K 66 41420 47708 41837 -4319 -6898 -2876 C ATOM 10289 CG GLU K 66 109.522 4.034 40.419 1.00358.60 C ANISOU10289 CG GLU K 66 42875 50016 43359 -4237 -6942 -2923 C ATOM 10290 CD GLU K 66 109.126 2.638 40.845 1.00365.13 C ANISOU10290 CD GLU K 66 43603 50993 44135 -3879 -6958 -2663 C ATOM 10291 OE1 GLU K 66 107.921 2.382 41.055 1.00369.35 O ANISOU10291 OE1 GLU K 66 44274 51291 44768 -3705 -6945 -2541 O ATOM 10292 OE2 GLU K 66 110.031 1.791 40.973 1.00367.98 O ANISOU10292 OE2 GLU K 66 43750 51711 44352 -3767 -6967 -2580 O ATOM 10293 N MET K 67 109.650 3.076 37.051 1.00315.78 N ANISOU10293 N MET K 67 37701 43969 38312 -4280 -6884 -2529 N ATOM 10294 CA MET K 67 110.483 2.027 36.465 1.00305.76 C ANISOU10294 CA MET K 67 36284 42884 37006 -4202 -6888 -2376 C ATOM 10295 C MET K 67 111.172 2.461 35.177 1.00308.82 C ANISOU10295 C MET K 67 36739 43111 37487 -4434 -6866 -2414 C ATOM 10296 O MET K 67 112.139 1.832 34.767 1.00305.99 O ANISOU10296 O MET K 67 36231 42964 37067 -4435 -6873 -2352 O ATOM 10297 CB MET K 67 109.660 0.775 36.196 1.00292.92 C ANISOU10297 CB MET K 67 34696 41131 35469 -3917 -6864 -2102 C ATOM 10298 CG MET K 67 109.093 0.109 37.439 1.00286.53 C ANISOU10298 CG MET K 67 33803 40505 34559 -3654 -6860 -2027 C ATOM 10299 SD MET K 67 107.946 -1.209 37.001 1.00279.01 S ANISOU10299 SD MET K 67 32948 39303 33758 -3375 -6785 -1745 S ATOM 10300 CE MET K 67 106.555 -0.275 36.396 1.00277.37 C ANISOU10300 CE MET K 67 33012 38620 33755 -3480 -6793 -1806 C ATOM 10301 N PHE K 68 110.648 3.508 34.528 1.00315.44 N ANISOU10301 N PHE K 68 37809 43572 38471 -4606 -6829 -2498 N ATOM 10302 CA PHE K 68 111.326 4.164 33.390 1.00317.90 C ANISOU10302 CA PHE K 68 38207 43717 38862 -4853 -6785 -2570 C ATOM 10303 C PHE K 68 112.551 4.964 33.846 1.00317.51 C ANISOU10303 C PHE K 68 38026 43934 38677 -5127 -6765 -2843 C ATOM 10304 O PHE K 68 113.620 4.863 33.232 1.00314.32 O ANISOU10304 O PHE K 68 37522 43662 38242 -5267 -6757 -2875 O ATOM 10305 CB PHE K 68 110.421 5.157 32.631 1.00322.35 C ANISOU10305 CB PHE K 68 39071 43807 39599 -4940 -6719 -2585 C ATOM 10306 CG PHE K 68 109.336 4.537 31.795 1.00321.66 C ANISOU10306 CG PHE K 68 39117 43441 39654 -4733 -6725 -2349 C ATOM 10307 CD1 PHE K 68 109.511 3.305 31.182 1.00320.38 C ANISOU10307 CD1 PHE K 68 38849 43363 39516 -4592 -6754 -2154 C ATOM 10308 CD2 PHE K 68 108.146 5.236 31.579 1.00321.72 C ANISOU10308 CD2 PHE K 68 39360 43110 39769 -4687 -6687 -2337 C ATOM 10309 CE1 PHE K 68 108.500 2.761 30.404 1.00319.12 C ANISOU10309 CE1 PHE K 68 38799 42966 39484 -4429 -6746 -1975 C ATOM 10310 CE2 PHE K 68 107.133 4.698 30.808 1.00319.17 C ANISOU10310 CE2 PHE K 68 39135 42577 39557 -4503 -6692 -2148 C ATOM 10311 CZ PHE K 68 107.315 3.461 30.215 1.00318.26 C ANISOU10311 CZ PHE K 68 38898 42560 39466 -4387 -6721 -1980 C ATOM 10312 N ALA K 69 112.373 5.796 34.883 1.00316.79 N ANISOU10312 N ALA K 69 37939 43915 38510 -5221 -6748 -3055 N ATOM 10313 CA ALA K 69 113.460 6.591 35.440 1.00315.59 C ANISOU10313 CA ALA K 69 37644 44045 38218 -5499 -6714 -3362 C ATOM 10314 C ALA K 69 114.482 5.630 36.021 1.00317.82 C ANISOU10314 C ALA K 69 37586 44885 38286 -5399 -6795 -3350 C ATOM 10315 O ALA K 69 115.671 5.873 35.882 1.00320.08 O ANISOU10315 O ALA K 69 37714 45430 38470 -5610 -6779 -3520 O ATOM 10316 CB ALA K 69 112.960 7.582 36.485 1.00311.96 C ANISOU10316 CB ALA K 69 37252 43558 37719 -5597 -6672 -3588 C ATOM 10317 N ARG K 70 114.016 4.531 36.626 1.00319.42 N ANISOU10317 N ARG K 70 37683 45264 38418 -5069 -6866 -3143 N ATOM 10318 CA ARG K 70 114.898 3.421 37.036 1.00322.48 C ANISOU10318 CA ARG K 70 37773 46147 38607 -4889 -6922 -3048 C ATOM 10319 C ARG K 70 115.450 2.584 35.866 1.00322.89 C ANISOU10319 C ARG K 70 37804 46155 38725 -4838 -6919 -2844 C ATOM 10320 O ARG K 70 116.572 2.086 35.944 1.00329.48 O ANISOU10320 O ARG K 70 38399 47394 39393 -4826 -6942 -2856 O ATOM 10321 CB ARG K 70 114.237 2.500 38.079 1.00320.98 C ANISOU10321 CB ARG K 70 37495 46145 38317 -4533 -6960 -2879 C ATOM 10322 CG ARG K 70 115.080 1.279 38.462 1.00322.05 C ANISOU10322 CG ARG K 70 37353 46764 38246 -4287 -6986 -2731 C ATOM 10323 CD ARG K 70 115.712 1.326 39.862 1.00329.12 C ANISOU10323 CD ARG K 70 37963 48243 38841 -4218 -7025 -2895 C ATOM 10324 NE ARG K 70 116.333 2.605 40.262 1.00334.55 N ANISOU10324 NE ARG K 70 38563 49117 39431 -4563 -7035 -3276 N ATOM 10325 CZ ARG K 70 117.552 3.024 39.912 1.00334.94 C ANISOU10325 CZ ARG K 70 38453 49426 39381 -4819 -7033 -3480 C ATOM 10326 NH1 ARG K 70 118.318 2.287 39.118 1.00334.39 N ANISOU10326 NH1 ARG K 70 38293 49462 39295 -4763 -7036 -3329 N ATOM 10327 NH2 ARG K 70 118.008 4.196 40.346 1.00333.73 N ANISOU10327 NH2 ARG K 70 38231 49421 39149 -5146 -7012 -3850 N ATOM 10328 N HIS K 71 114.674 2.420 34.798 1.00318.57 N ANISOU10328 N HIS K 71 37492 45145 38404 -4800 -6890 -2662 N ATOM 10329 CA HIS K 71 115.171 1.791 33.553 1.00315.43 C ANISOU10329 CA HIS K 71 37101 44654 38093 -4802 -6878 -2499 C ATOM 10330 C HIS K 71 116.265 2.609 32.804 1.00315.44 C ANISOU10330 C HIS K 71 37086 44671 38096 -5135 -6851 -2689 C ATOM 10331 O HIS K 71 117.188 2.032 32.197 1.00312.78 O ANISOU10331 O HIS K 71 36620 44504 37716 -5147 -6859 -2619 O ATOM 10332 CB HIS K 71 113.980 1.399 32.648 1.00313.82 C ANISOU10332 CB HIS K 71 37134 43985 38115 -4668 -6851 -2275 C ATOM 10333 CG HIS K 71 114.192 1.657 31.186 1.00315.51 C ANISOU10333 CG HIS K 71 37486 43909 38485 -4828 -6819 -2234 C ATOM 10334 ND1 HIS K 71 115.164 1.016 30.448 1.00316.45 N ANISOU10334 ND1 HIS K 71 37484 44171 38579 -4850 -6821 -2151 N ATOM 10335 CD2 HIS K 71 113.534 2.466 30.321 1.00316.66 C ANISOU10335 CD2 HIS K 71 37878 43634 38802 -4949 -6779 -2252 C ATOM 10336 CE1 HIS K 71 115.110 1.433 29.195 1.00317.54 C ANISOU10336 CE1 HIS K 71 37786 43989 38872 -4993 -6788 -2129 C ATOM 10337 NE2 HIS K 71 114.130 2.313 29.091 1.00318.54 N ANISOU10337 NE2 HIS K 71 38138 43777 39115 -5046 -6759 -2185 N ATOM 10338 N ALA K 72 116.173 3.940 32.878 1.00317.26 N ANISOU10338 N ALA K 72 37448 44723 38373 -5404 -6802 -2932 N ATOM 10339 CA ALA K 72 117.160 4.831 32.255 1.00321.76 C ANISOU10339 CA ALA K 72 38023 45278 38950 -5746 -6739 -3146 C ATOM 10340 C ALA K 72 118.250 5.209 33.270 1.00328.55 C ANISOU10340 C ALA K 72 38610 46648 39575 -5918 -6748 -3440 C ATOM 10341 O ALA K 72 119.083 6.100 33.033 1.00330.77 O ANISOU10341 O ALA K 72 38869 46971 39835 -6247 -6675 -3699 O ATOM 10342 CB ALA K 72 116.474 6.067 31.692 1.00320.28 C ANISOU10342 CB ALA K 72 38154 44587 38951 -5941 -6636 -3242 C ATOM 10343 N LYS K 73 118.205 4.514 34.408 1.00333.33 N ANISOU10343 N LYS K 73 39004 47648 39998 -5685 -6825 -3401 N ATOM 10344 CA LYS K 73 119.153 4.631 35.530 1.00338.61 C ANISOU10344 CA LYS K 73 39355 48908 40391 -5754 -6856 -3645 C ATOM 10345 C LYS K 73 119.384 6.078 36.056 1.00346.63 C ANISOU10345 C LYS K 73 40390 49939 41372 -6121 -6777 -4048 C ATOM 10346 O LYS K 73 120.514 6.550 36.223 1.00353.20 O ANISOU10346 O LYS K 73 41020 51122 42058 -6382 -6747 -4332 O ATOM 10347 CB LYS K 73 120.423 3.779 35.257 1.00331.28 C ANISOU10347 CB LYS K 73 38145 48431 39294 -5696 -6900 -3586 C ATOM 10348 CG LYS K 73 120.120 2.274 35.173 1.00319.50 C ANISOU10348 CG LYS K 73 36602 47007 37784 -5278 -6954 -3204 C ATOM 10349 CD LYS K 73 121.270 1.437 34.601 1.00310.66 C ANISOU10349 CD LYS K 73 35280 46202 36555 -5216 -6972 -3095 C ATOM 10350 CE LYS K 73 121.013 1.019 33.158 1.00303.53 C ANISOU10350 CE LYS K 73 34589 44842 35894 -5209 -6941 -2860 C ATOM 10351 NZ LYS K 73 120.121 -0.168 33.078 1.00297.98 N ANISOU10351 NZ LYS K 73 33979 43961 35278 -4841 -6940 -2512 N ATOM 10352 N ARG K 74 118.269 6.763 36.319 1.00349.41 N ANISOU10352 N ARG K 74 40990 49906 41862 -6136 -6731 -4077 N ATOM 10353 CA ARG K 74 118.250 8.114 36.883 1.00355.05 C ANISOU10353 CA ARG K 74 41774 50557 42571 -6449 -6629 -4433 C ATOM 10354 C ARG K 74 117.274 8.215 38.037 1.00361.29 C ANISOU10354 C ARG K 74 42592 51363 43316 -6282 -6663 -4445 C ATOM 10355 O ARG K 74 116.444 7.340 38.230 1.00355.22 O ANISOU10355 O ARG K 74 41858 50534 42573 -5937 -6748 -4159 O ATOM 10356 CB ARG K 74 117.776 9.095 35.841 1.00351.48 C ANISOU10356 CB ARG K 74 41685 49481 42377 -6668 -6488 -4456 C ATOM 10357 CG ARG K 74 118.835 9.621 34.911 1.00350.05 C ANISOU10357 CG ARG K 74 41510 49257 42237 -6993 -6384 -4615 C ATOM 10358 CD ARG K 74 118.172 10.599 33.965 1.00350.75 C ANISOU10358 CD ARG K 74 41997 48691 42579 -7144 -6223 -4598 C ATOM 10359 NE ARG K 74 117.364 9.928 32.937 1.00352.52 N ANISOU10359 NE ARG K 74 42421 48542 42976 -6873 -6278 -4214 N ATOM 10360 CZ ARG K 74 116.036 9.771 32.953 1.00353.59 C ANISOU10360 CZ ARG K 74 42760 48362 43225 -6619 -6310 -3998 C ATOM 10361 NH1 ARG K 74 115.304 10.227 33.958 1.00355.12 N ANISOU10361 NH1 ARG K 74 43005 48534 43389 -6579 -6298 -4100 N ATOM 10362 NH2 ARG K 74 115.425 9.154 31.947 1.00352.96 N ANISOU10362 NH2 ARG K 74 42824 48000 43285 -6407 -6350 -3688 N ATOM 10363 N THR K 75 117.353 9.305 38.792 1.00375.40 N ANISOU10363 N THR K 75 44374 53213 45045 -6540 -6580 -4789 N ATOM 10364 CA THR K 75 116.336 9.564 39.812 1.00383.45 C ANISOU10364 CA THR K 75 45468 54171 46053 -6412 -6595 -4814 C ATOM 10365 C THR K 75 115.269 10.551 39.334 1.00379.51 C ANISOU10365 C THR K 75 45372 53016 45805 -6518 -6469 -4811 C ATOM 10366 O THR K 75 114.123 10.466 39.769 1.00384.02 O ANISOU10366 O THR K 75 46084 53385 46439 -6303 -6503 -4673 O ATOM 10367 CB THR K 75 116.917 10.020 41.184 1.00393.26 C ANISOU10367 CB THR K 75 46429 55950 47042 -6556 -6596 -5175 C ATOM 10368 OG1 THR K 75 117.694 11.219 41.040 1.00397.69 O ANISOU10368 OG1 THR K 75 46993 56506 47604 -7013 -6441 -5573 O ATOM 10369 CG2 THR K 75 117.766 8.915 41.824 1.00398.33 C ANISOU10369 CG2 THR K 75 46663 57288 47397 -6335 -6736 -5119 C ATOM 10370 N THR K 76 115.644 11.458 38.425 1.00369.54 N ANISOU10370 N THR K 76 44297 51429 44681 -6828 -6315 -4951 N ATOM 10371 CA THR K 76 114.784 12.591 38.032 1.00356.73 C ANISOU10371 CA THR K 76 43058 49216 43268 -6960 -6147 -4999 C ATOM 10372 C THR K 76 114.171 12.450 36.615 1.00353.16 C ANISOU10372 C THR K 76 42905 48237 43043 -6835 -6114 -4687 C ATOM 10373 O THR K 76 114.898 12.375 35.625 1.00353.70 O ANISOU10373 O THR K 76 42978 48251 43161 -6956 -6075 -4655 O ATOM 10374 CB THR K 76 115.537 13.939 38.165 1.00350.39 C ANISOU10374 CB THR K 76 42295 48379 42456 -7418 -5932 -5425 C ATOM 10375 OG1 THR K 76 116.491 14.063 37.106 1.00341.94 O ANISOU10375 OG1 THR K 76 41230 47252 41437 -7635 -5847 -5466 O ATOM 10376 CG2 THR K 76 116.268 14.035 39.499 1.00348.28 C ANISOU10376 CG2 THR K 76 41681 48711 41938 -7564 -5968 -5766 C ATOM 10377 N ILE K 77 112.836 12.420 36.537 1.00346.13 N ANISOU10377 N ILE K 77 42249 46986 42276 -6590 -6131 -4468 N ATOM 10378 CA ILE K 77 112.103 12.168 35.283 1.00333.89 C ANISOU10378 CA ILE K 77 40948 45003 40911 -6411 -6125 -4158 C ATOM 10379 C ILE K 77 112.093 13.393 34.382 1.00341.41 C ANISOU10379 C ILE K 77 42218 45486 42016 -6639 -5903 -4247 C ATOM 10380 O ILE K 77 111.834 14.517 34.813 1.00343.48 O ANISOU10380 O ILE K 77 42655 45542 42309 -6808 -5739 -4454 O ATOM 10381 CB ILE K 77 110.649 11.699 35.540 1.00320.38 C ANISOU10381 CB ILE K 77 39354 43115 39258 -6065 -6216 -3911 C ATOM 10382 CG1 ILE K 77 110.639 10.346 36.253 1.00312.73 C ANISOU10382 CG1 ILE K 77 38099 42562 38159 -5805 -6408 -3768 C ATOM 10383 CG2 ILE K 77 109.852 11.618 34.241 1.00311.93 C ANISOU10383 CG2 ILE K 77 38541 41612 38365 -5907 -6186 -3641 C ATOM 10384 CD1 ILE K 77 109.371 10.085 37.035 1.00309.91 C ANISOU10384 CD1 ILE K 77 37799 42143 37807 -5542 -6472 -3656 C ATOM 10385 N ASN K 78 112.374 13.149 33.116 1.00348.50 N ANISOU10385 N ASN K 78 43196 46208 43008 -6631 -5883 -4082 N ATOM 10386 CA ASN K 78 112.402 14.196 32.127 1.00358.11 C ANISOU10386 CA ASN K 78 44718 46979 44366 -6805 -5664 -4118 C ATOM 10387 C ASN K 78 111.433 13.841 31.001 1.00360.14 C ANISOU10387 C ASN K 78 45189 46890 44757 -6518 -5694 -3771 C ATOM 10388 O ASN K 78 110.605 12.933 31.153 1.00358.45 O ANISOU10388 O ASN K 78 44906 46754 44534 -6214 -5864 -3551 O ATOM 10389 CB ASN K 78 113.832 14.383 31.616 1.00364.79 C ANISOU10389 CB ASN K 78 45449 47969 45183 -7119 -5580 -4296 C ATOM 10390 CG ASN K 78 114.487 13.069 31.221 1.00369.45 C ANISOU10390 CG ASN K 78 45761 48909 45704 -6997 -5780 -4128 C ATOM 10391 OD1 ASN K 78 113.896 12.243 30.502 1.00372.89 O ANISOU10391 OD1 ASN K 78 46237 49235 46207 -6721 -5892 -3815 O ATOM 10392 ND2 ASN K 78 115.720 12.870 31.677 1.00373.48 N ANISOU10392 ND2 ASN K 78 45980 49854 46070 -7205 -5812 -4345 N ATOM 10393 N THR K 79 111.549 14.546 29.876 1.00366.22 N ANISOU10393 N THR K 79 46208 47296 45641 -6616 -5518 -3734 N ATOM 10394 CA THR K 79 110.637 14.412 28.721 1.00370.87 C ANISOU10394 CA THR K 79 47021 47547 46344 -6356 -5510 -3430 C ATOM 10395 C THR K 79 110.593 13.034 27.993 1.00372.97 C ANISOU10395 C THR K 79 47110 47989 46610 -6128 -5717 -3161 C ATOM 10396 O THR K 79 109.536 12.651 27.464 1.00374.95 O ANISOU10396 O THR K 79 47462 48084 46916 -5846 -5777 -2922 O ATOM 10397 CB THR K 79 110.864 15.550 27.682 1.00371.62 C ANISOU10397 CB THR K 79 47430 47222 46546 -6510 -5242 -3456 C ATOM 10398 OG1 THR K 79 112.045 15.301 26.908 1.00369.27 O ANISOU10398 OG1 THR K 79 47026 47026 46253 -6698 -5226 -3486 O ATOM 10399 CG2 THR K 79 111.003 16.908 28.370 1.00374.19 C ANISOU10399 CG2 THR K 79 47941 47352 46882 -6768 -4990 -3743 C ATOM 10400 N GLU K 80 111.720 12.306 27.979 1.00374.01 N ANISOU10400 N GLU K 80 46976 48455 46675 -6252 -5813 -3212 N ATOM 10401 CA GLU K 80 111.870 11.059 27.191 1.00369.14 C ANISOU10401 CA GLU K 80 46205 47985 46067 -6082 -5967 -2979 C ATOM 10402 C GLU K 80 111.066 9.875 27.739 1.00364.98 C ANISOU10402 C GLU K 80 45519 47658 45499 -5784 -6155 -2806 C ATOM 10403 O GLU K 80 110.492 9.081 26.975 1.00357.08 O ANISOU10403 O GLU K 80 44524 46593 44554 -5567 -6230 -2573 O ATOM 10404 CB GLU K 80 113.354 10.685 27.025 1.00369.99 C ANISOU10404 CB GLU K 80 46085 48387 46106 -6302 -5991 -3088 C ATOM 10405 CG GLU K 80 114.204 11.765 26.362 1.00376.10 C ANISOU10405 CG GLU K 80 47008 48960 46930 -6612 -5790 -3257 C ATOM 10406 CD GLU K 80 113.545 12.394 25.137 1.00379.91 C ANISOU10406 CD GLU K 80 47822 48971 47555 -6532 -5648 -3095 C ATOM 10407 OE1 GLU K 80 113.543 13.642 25.030 1.00384.46 O ANISOU10407 OE1 GLU K 80 48647 49244 48186 -6701 -5424 -3233 O ATOM 10408 OE2 GLU K 80 113.026 11.649 24.277 1.00379.30 O ANISOU10408 OE2 GLU K 80 47757 48831 47526 -6294 -5744 -2833 O ATOM 10409 N ASP K 81 111.041 9.768 29.063 1.00368.22 N ANISOU10409 N ASP K 81 45784 48314 45807 -5782 -6215 -2935 N ATOM 10410 CA ASP K 81 110.238 8.772 29.764 1.00367.13 C ANISOU10410 CA ASP K 81 45519 48346 45626 -5509 -6358 -2798 C ATOM 10411 C ASP K 81 108.738 8.957 29.466 1.00367.81 C ANISOU10411 C ASP K 81 45830 48111 45811 -5285 -6342 -2645 C ATOM 10412 O ASP K 81 108.030 7.996 29.141 1.00364.83 O ANISOU10412 O ASP K 81 45407 47745 45466 -5048 -6431 -2442 O ATOM 10413 CB ASP K 81 110.507 8.877 31.269 1.00364.95 C ANISOU10413 CB ASP K 81 45077 48374 45213 -5569 -6394 -2994 C ATOM 10414 CG ASP K 81 111.955 8.550 31.642 1.00360.92 C ANISOU10414 CG ASP K 81 44292 48275 44566 -5744 -6430 -3141 C ATOM 10415 OD1 ASP K 81 112.600 7.744 30.929 1.00354.11 O ANISOU10415 OD1 ASP K 81 43307 47537 43700 -5715 -6481 -3017 O ATOM 10416 OD2 ASP K 81 112.437 9.084 32.669 1.00359.76 O ANISOU10416 OD2 ASP K 81 44038 48350 44302 -5904 -6406 -3387 O ATOM 10417 N VAL K 82 108.290 10.215 29.550 1.00369.86 N ANISOU10417 N VAL K 82 46329 48087 46112 -5370 -6210 -2753 N ATOM 10418 CA VAL K 82 106.876 10.608 29.377 1.00365.28 C ANISOU10418 CA VAL K 82 45974 47214 45600 -5161 -6174 -2638 C ATOM 10419 C VAL K 82 106.370 10.378 27.952 1.00358.55 C ANISOU10419 C VAL K 82 45246 46148 44836 -5007 -6161 -2419 C ATOM 10420 O VAL K 82 105.253 9.872 27.760 1.00359.41 O ANISOU10420 O VAL K 82 45377 46213 44969 -4754 -6227 -2260 O ATOM 10421 CB VAL K 82 106.621 12.096 29.762 1.00368.81 C ANISOU10421 CB VAL K 82 46672 47393 46066 -5293 -5998 -2808 C ATOM 10422 CG1 VAL K 82 105.137 12.431 29.666 1.00369.39 C ANISOU10422 CG1 VAL K 82 46955 47209 46186 -5040 -5971 -2676 C ATOM 10423 CG2 VAL K 82 107.137 12.425 31.160 1.00368.66 C ANISOU10423 CG2 VAL K 82 46526 47594 45953 -5475 -5995 -3062 C ATOM 10424 N LYS K 83 107.185 10.774 26.968 1.00348.18 N ANISOU10424 N LYS K 83 44008 44720 43564 -5165 -6067 -2427 N ATOM 10425 CA LYS K 83 106.887 10.547 25.554 1.00336.59 C ANISOU10425 CA LYS K 83 42633 43090 42163 -5036 -6052 -2229 C ATOM 10426 C LYS K 83 106.709 9.063 25.307 1.00329.91 C ANISOU10426 C LYS K 83 41560 42479 41311 -4867 -6222 -2072 C ATOM 10427 O LYS K 83 105.874 8.663 24.487 1.00328.87 O ANISOU10427 O LYS K 83 41473 42263 41219 -4664 -6249 -1903 O ATOM 10428 CB LYS K 83 107.997 11.078 24.648 1.00333.84 C ANISOU10428 CB LYS K 83 42359 42634 41850 -5258 -5932 -2277 C ATOM 10429 CG LYS K 83 108.012 12.586 24.526 1.00334.81 C ANISOU10429 CG LYS K 83 42777 42427 42008 -5391 -5702 -2389 C ATOM 10430 CD LYS K 83 108.439 13.001 23.135 1.00333.70 C ANISOU10430 CD LYS K 83 42795 42065 41927 -5437 -5570 -2299 C ATOM 10431 CE LYS K 83 109.939 13.243 23.037 1.00336.46 C ANISOU10431 CE LYS K 83 43072 42488 42277 -5774 -5491 -2473 C ATOM 10432 NZ LYS K 83 110.180 14.141 21.875 1.00338.40 N ANISOU10432 NZ LYS K 83 43584 42400 42593 -5835 -5272 -2425 N ATOM 10433 N LEU K 84 107.482 8.248 26.028 1.00324.32 N ANISOU10433 N LEU K 84 40604 42077 40543 -4945 -6319 -2133 N ATOM 10434 CA LEU K 84 107.383 6.798 25.872 1.00317.48 C ANISOU10434 CA LEU K 84 39530 41424 39672 -4789 -6443 -1986 C ATOM 10435 C LEU K 84 106.202 6.174 26.662 1.00308.36 C ANISOU10435 C LEU K 84 38324 40334 38502 -4560 -6516 -1924 C ATOM 10436 O LEU K 84 105.729 5.076 26.313 1.00309.23 O ANISOU10436 O LEU K 84 38332 40520 38638 -4395 -6574 -1784 O ATOM 10437 CB LEU K 84 108.735 6.103 26.116 1.00322.94 C ANISOU10437 CB LEU K 84 39988 42413 40300 -4928 -6495 -2035 C ATOM 10438 CG LEU K 84 109.144 5.146 24.989 1.00326.67 C ANISOU10438 CG LEU K 84 40367 42936 40816 -4886 -6529 -1881 C ATOM 10439 CD1 LEU K 84 109.338 5.858 23.653 1.00326.86 C ANISOU10439 CD1 LEU K 84 40565 42711 40916 -4978 -6445 -1848 C ATOM 10440 CD2 LEU K 84 110.404 4.387 25.372 1.00332.96 C ANISOU10440 CD2 LEU K 84 40921 44055 41530 -4979 -6579 -1915 C ATOM 10441 N LEU K 85 105.698 6.908 27.663 1.00296.34 N ANISOU10441 N LEU K 85 36886 38762 36945 -4558 -6493 -2035 N ATOM 10442 CA LEU K 85 104.522 6.515 28.455 1.00281.22 C ANISOU10442 CA LEU K 85 34954 36877 35017 -4352 -6545 -1994 C ATOM 10443 C LEU K 85 103.173 6.573 27.701 1.00276.00 C ANISOU10443 C LEU K 85 34437 36009 34420 -4149 -6530 -1868 C ATOM 10444 O LEU K 85 102.272 5.790 27.979 1.00275.63 O ANISOU10444 O LEU K 85 34316 36033 34378 -3966 -6584 -1794 O ATOM 10445 CB LEU K 85 104.473 7.349 29.733 1.00273.61 C ANISOU10445 CB LEU K 85 34036 35931 33992 -4429 -6521 -2164 C ATOM 10446 CG LEU K 85 103.316 7.166 30.710 1.00265.59 C ANISOU10446 CG LEU K 85 33022 34935 32953 -4244 -6564 -2154 C ATOM 10447 CD1 LEU K 85 103.329 5.789 31.362 1.00261.98 C ANISOU10447 CD1 LEU K 85 32331 34758 32452 -4114 -6656 -2081 C ATOM 10448 CD2 LEU K 85 103.399 8.282 31.729 1.00262.33 C ANISOU10448 CD2 LEU K 85 32699 34484 32490 -4369 -6510 -2344 C ATOM 10449 N ALA K 86 103.024 7.503 26.764 1.00269.80 N ANISOU10449 N ALA K 86 33854 34983 33674 -4172 -6443 -1848 N ATOM 10450 CA ALA K 86 101.856 7.487 25.881 1.00262.23 C ANISOU10450 CA ALA K 86 32998 33889 32749 -3961 -6431 -1718 C ATOM 10451 C ALA K 86 102.243 6.999 24.475 1.00260.98 C ANISOU10451 C ALA K 86 32799 33729 32629 -3960 -6430 -1605 C ATOM 10452 O ALA K 86 101.904 7.645 23.470 1.00255.76 O ANISOU10452 O ALA K 86 32300 32894 31983 -3894 -6359 -1538 O ATOM 10453 CB ALA K 86 101.215 8.865 25.816 1.00260.45 C ANISOU10453 CB ALA K 86 33038 33403 32518 -3914 -6320 -1746 C ATOM 10454 N ARG K 87 102.945 5.858 24.401 1.00266.31 N ANISOU10454 N ARG K 87 33265 34606 33315 -4016 -6499 -1576 N ATOM 10455 CA ARG K 87 103.525 5.353 23.118 1.00273.31 C ANISOU10455 CA ARG K 87 34095 35509 34238 -4053 -6498 -1485 C ATOM 10456 C ARG K 87 102.499 4.621 22.257 1.00279.68 C ANISOU10456 C ARG K 87 34856 36337 35070 -3855 -6523 -1370 C ATOM 10457 O ARG K 87 102.746 4.291 21.087 1.00279.62 O ANISOU10457 O ARG K 87 34820 36331 35089 -3855 -6514 -1293 O ATOM 10458 CB ARG K 87 104.746 4.444 23.362 1.00271.09 C ANISOU10458 CB ARG K 87 33611 35439 33951 -4190 -6545 -1499 C ATOM 10459 CG ARG K 87 104.440 2.955 23.451 1.00266.89 C ANISOU10459 CG ARG K 87 32882 35090 33432 -4068 -6601 -1416 C ATOM 10460 CD ARG K 87 105.579 2.170 24.082 1.00263.86 C ANISOU10460 CD ARG K 87 32314 34929 33012 -4163 -6630 -1434 C ATOM 10461 NE ARG K 87 105.563 2.210 25.545 1.00262.35 N ANISOU10461 NE ARG K 87 32068 34860 32752 -4148 -6654 -1515 N ATOM 10462 CZ ARG K 87 104.798 1.448 26.331 1.00259.43 C ANISOU10462 CZ ARG K 87 31621 34577 32370 -3990 -6669 -1483 C ATOM 10463 NH1 ARG K 87 103.925 0.580 25.830 1.00257.10 N ANISOU10463 NH1 ARG K 87 31294 34254 32135 -3845 -6653 -1388 N ATOM 10464 NH2 ARG K 87 104.880 1.576 27.644 1.00258.36 N ANISOU10464 NH2 ARG K 87 31439 34563 32160 -3980 -6689 -1559 N ATOM 10465 N ARG K 88 101.333 4.421 22.857 1.00289.56 N ANISOU10465 N ARG K 88 36098 37616 36306 -3695 -6547 -1375 N ATOM 10466 CA ARG K 88 100.365 3.409 22.451 1.00299.19 C ANISOU10466 CA ARG K 88 37197 38939 37541 -3533 -6575 -1316 C ATOM 10467 C ARG K 88 99.466 3.705 21.207 1.00309.16 C ANISOU10467 C ARG K 88 38531 40144 38791 -3382 -6550 -1253 C ATOM 10468 O ARG K 88 99.341 2.822 20.349 1.00314.24 O ANISOU10468 O ARG K 88 39046 40894 39456 -3347 -6560 -1208 O ATOM 10469 CB ARG K 88 99.571 2.966 23.696 1.00295.64 C ANISOU10469 CB ARG K 88 36681 38571 37077 -3440 -6603 -1365 C ATOM 10470 CG ARG K 88 100.449 2.325 24.775 1.00292.48 C ANISOU10470 CG ARG K 88 36154 38300 36673 -3544 -6626 -1400 C ATOM 10471 CD ARG K 88 100.306 2.972 26.148 1.00292.44 C ANISOU10471 CD ARG K 88 36209 38282 36619 -3550 -6639 -1487 C ATOM 10472 NE ARG K 88 101.180 2.327 27.127 1.00291.14 N ANISOU10472 NE ARG K 88 35902 38292 36425 -3623 -6661 -1514 N ATOM 10473 CZ ARG K 88 100.744 1.570 28.131 1.00290.58 C ANISOU10473 CZ ARG K 88 35730 38340 36334 -3521 -6669 -1513 C ATOM 10474 NH1 ARG K 88 99.446 1.370 28.307 1.00293.88 N ANISOU10474 NH1 ARG K 88 36173 38714 36772 -3370 -6660 -1505 N ATOM 10475 NH2 ARG K 88 101.602 1.013 28.978 1.00287.26 N ANISOU10475 NH2 ARG K 88 35180 38101 35863 -3559 -6679 -1521 N ATOM 10476 N SER K 89 98.868 4.914 21.106 1.00317.40 N ANISOU10476 N SER K 89 39771 41036 39789 -3285 -6506 -1249 N ATOM 10477 CA SER K 89 98.025 5.359 19.919 1.00318.78 C ANISOU10477 CA SER K 89 40028 41176 39915 -3099 -6470 -1174 C ATOM 10478 C SER K 89 98.678 6.434 18.992 1.00317.85 C ANISOU10478 C SER K 89 40106 40878 39783 -3133 -6382 -1110 C ATOM 10479 O SER K 89 99.286 7.385 19.488 1.00321.47 O ANISOU10479 O SER K 89 40732 41158 40252 -3248 -6315 -1147 O ATOM 10480 CB SER K 89 96.565 5.748 20.327 1.00319.54 C ANISOU10480 CB SER K 89 40183 41281 39945 -2877 -6468 -1188 C ATOM 10481 OG SER K 89 96.361 7.128 20.636 1.00322.64 O ANISOU10481 OG SER K 89 40820 41471 40295 -2817 -6392 -1181 O ATOM 10482 N ASN K 90 98.544 6.289 17.669 1.00311.57 N ANISOU10482 N ASN K 90 39288 40130 38962 -3038 -6367 -1025 N ATOM 10483 CA ASN K 90 99.264 7.167 16.739 1.00307.27 C ANISOU10483 CA ASN K 90 38916 39420 38410 -3075 -6272 -953 C ATOM 10484 C ASN K 90 98.866 8.653 16.662 1.00309.58 C ANISOU10484 C ASN K 90 39499 39481 38644 -2943 -6137 -906 C ATOM 10485 O ASN K 90 99.753 9.486 16.487 1.00311.10 O ANISOU10485 O ASN K 90 39869 39467 38865 -3073 -6026 -898 O ATOM 10486 CB ASN K 90 99.392 6.525 15.368 1.00303.49 C ANISOU10486 CB ASN K 90 38318 39071 37920 -3027 -6292 -875 C ATOM 10487 CG ASN K 90 100.208 5.270 15.428 1.00300.84 C ANISOU10487 CG ASN K 90 37760 38880 37665 -3219 -6373 -916 C ATOM 10488 OD1 ASN K 90 99.692 4.202 15.731 1.00299.69 O ANISOU10488 OD1 ASN K 90 37419 38914 37533 -3190 -6442 -959 O ATOM 10489 ND2 ASN K 90 101.500 5.402 15.202 1.00299.50 N ANISOU10489 ND2 ASN K 90 37622 38626 37546 -3417 -6346 -910 N ATOM 10490 N SER K 91 97.574 8.983 16.824 1.00310.54 N ANISOU10490 N SER K 91 39672 39632 38683 -2693 -6129 -881 N ATOM 10491 CA SER K 91 97.097 10.398 16.872 1.00314.48 C ANISOU10491 CA SER K 91 40464 39903 39118 -2534 -5980 -827 C ATOM 10492 C SER K 91 97.669 11.173 18.069 1.00321.41 C ANISOU10492 C SER K 91 41506 40555 40058 -2730 -5904 -929 C ATOM 10493 O SER K 91 98.042 12.352 17.962 1.00320.78 O ANISOU10493 O SER K 91 41691 40208 39980 -2756 -5729 -908 O ATOM 10494 CB SER K 91 95.555 10.492 16.873 1.00310.09 C ANISOU10494 CB SER K 91 39897 39473 38447 -2211 -6001 -786 C ATOM 10495 OG SER K 91 94.980 10.116 18.118 1.00301.50 O ANISOU10495 OG SER K 91 38717 38459 37378 -2235 -6088 -891 O ATOM 10496 N LEU K 92 97.733 10.464 19.193 1.00331.02 N ANISOU10496 N LEU K 92 42557 41892 41323 -2866 -6023 -1046 N ATOM 10497 CA LEU K 92 98.239 10.939 20.474 1.00343.88 C ANISOU10497 CA LEU K 92 44259 43400 42996 -3062 -5992 -1174 C ATOM 10498 C LEU K 92 99.759 11.205 20.443 1.00346.68 C ANISOU10498 C LEU K 92 44651 43649 43419 -3365 -5927 -1243 C ATOM 10499 O LEU K 92 100.234 12.222 20.955 1.00350.47 O ANISOU10499 O LEU K 92 45321 43923 43918 -3504 -5794 -1328 O ATOM 10500 CB LEU K 92 97.922 9.849 21.496 1.00350.01 C ANISOU10500 CB LEU K 92 44795 44401 43788 -3093 -6152 -1255 C ATOM 10501 CG LEU K 92 97.736 10.001 22.996 1.00354.58 C ANISOU10501 CG LEU K 92 45373 44977 44372 -3158 -6178 -1374 C ATOM 10502 CD1 LEU K 92 97.889 8.608 23.576 1.00354.68 C ANISOU10502 CD1 LEU K 92 45106 45242 44413 -3224 -6325 -1416 C ATOM 10503 CD2 LEU K 92 98.742 10.947 23.627 1.00354.70 C ANISOU10503 CD2 LEU K 92 45537 44816 44417 -3395 -6073 -1486 C ATOM 10504 N LEU K 93 100.501 10.270 19.846 1.00344.56 N ANISOU10504 N LEU K 93 44195 43535 43185 -3472 -6013 -1220 N ATOM 10505 CA LEU K 93 101.961 10.298 19.734 1.00341.06 C ANISOU10505 CA LEU K 93 43730 43061 42796 -3753 -5980 -1284 C ATOM 10506 C LEU K 93 102.456 11.464 18.871 1.00347.60 C ANISOU10506 C LEU K 93 44816 43621 43632 -3798 -5786 -1244 C ATOM 10507 O LEU K 93 103.425 12.157 19.232 1.00350.12 O ANISOU10507 O LEU K 93 45239 43802 43988 -4041 -5674 -1358 O ATOM 10508 CB LEU K 93 102.407 8.969 19.140 1.00329.69 C ANISOU10508 CB LEU K 93 42035 41851 41380 -3788 -6111 -1233 C ATOM 10509 CG LEU K 93 103.876 8.645 19.024 1.00325.71 C ANISOU10509 CG LEU K 93 41431 41402 40919 -4052 -6120 -1288 C ATOM 10510 CD1 LEU K 93 104.538 8.779 20.382 1.00326.52 C ANISOU10510 CD1 LEU K 93 41482 41558 41022 -4254 -6134 -1449 C ATOM 10511 CD2 LEU K 93 103.965 7.229 18.507 1.00321.18 C ANISOU10511 CD2 LEU K 93 40611 41060 40361 -4014 -6247 -1218 C ATOM 10512 N LYS K 94 101.772 11.667 17.738 1.00353.47 N ANISOU10512 N LYS K 94 45657 44310 44334 -3557 -5735 -1088 N ATOM 10513 CA LYS K 94 101.982 12.809 16.833 1.00360.24 C ANISOU10513 CA LYS K 94 46794 44898 45180 -3509 -5522 -1005 C ATOM 10514 C LYS K 94 101.766 14.129 17.572 1.00363.85 C ANISOU10514 C LYS K 94 47534 45074 45635 -3523 -5327 -1072 C ATOM 10515 O LYS K 94 102.581 15.047 17.465 1.00365.96 O ANISOU10515 O LYS K 94 48007 45095 45946 -3702 -5128 -1126 O ATOM 10516 CB LYS K 94 101.025 12.729 15.632 1.00363.53 C ANISOU10516 CB LYS K 94 47238 45372 45513 -3171 -5518 -817 C ATOM 10517 CG LYS K 94 101.683 12.965 14.277 1.00366.39 C ANISOU10517 CG LYS K 94 47685 45648 45875 -3169 -5414 -706 C ATOM 10518 CD LYS K 94 100.755 12.600 13.115 1.00365.27 C ANISOU10518 CD LYS K 94 47479 45675 45631 -2836 -5461 -539 C ATOM 10519 CE LYS K 94 101.517 11.995 11.943 1.00361.38 C ANISOU10519 CE LYS K 94 46866 45283 45157 -2905 -5500 -474 C ATOM 10520 NZ LYS K 94 101.791 12.938 10.817 1.00360.31 N ANISOU10520 NZ LYS K 94 46977 44942 44980 -2789 -5294 -334 N ATOM 10521 N TYR K 95 100.668 14.195 18.326 1.00366.54 N ANISOU10521 N TYR K 95 47884 45454 45930 -3345 -5375 -1079 N ATOM 10522 CA TYR K 95 100.296 15.345 19.163 1.00375.78 C ANISOU10522 CA TYR K 95 49304 46382 47094 -3335 -5207 -1148 C ATOM 10523 C TYR K 95 101.329 15.787 20.237 1.00389.61 C ANISOU10523 C TYR K 95 51086 48027 48918 -3701 -5133 -1369 C ATOM 10524 O TYR K 95 101.638 16.989 20.359 1.00401.07 O ANISOU10524 O TYR K 95 52814 49177 50395 -3801 -4884 -1431 O ATOM 10525 CB TYR K 95 98.949 15.059 19.828 1.00367.60 C ANISOU10525 CB TYR K 95 48196 45480 45992 -3089 -5325 -1126 C ATOM 10526 CG TYR K 95 98.173 16.299 20.163 1.00368.29 C ANISOU10526 CG TYR K 95 48585 45312 46036 -2918 -5128 -1099 C ATOM 10527 CD1 TYR K 95 98.494 17.054 21.291 1.00372.28 C ANISOU10527 CD1 TYR K 95 49227 45632 46588 -3119 -5012 -1263 C ATOM 10528 CD2 TYR K 95 97.119 16.724 19.354 1.00366.62 C ANISOU10528 CD2 TYR K 95 48516 45057 45724 -2545 -5045 -914 C ATOM 10529 CE1 TYR K 95 97.783 18.203 21.606 1.00375.01 C ANISOU10529 CE1 TYR K 95 49866 45721 46900 -2963 -4808 -1239 C ATOM 10530 CE2 TYR K 95 96.396 17.869 19.660 1.00370.20 C ANISOU10530 CE2 TYR K 95 49259 45273 46128 -2358 -4846 -872 C ATOM 10531 CZ TYR K 95 96.730 18.605 20.786 1.00373.89 C ANISOU10531 CZ TYR K 95 49878 45522 46659 -2573 -4722 -1033 C ATOM 10532 OH TYR K 95 96.015 19.745 21.100 1.00374.90 O ANISOU10532 OH TYR K 95 50306 45393 46743 -2390 -4503 -993 O ATOM 10533 N ILE K 96 101.848 14.824 21.007 1.00398.38 N ANISOU10533 N ILE K 96 51915 49396 50054 -3892 -5331 -1493 N ATOM 10534 CA ILE K 96 102.786 15.088 22.132 1.00408.70 C ANISOU10534 CA ILE K 96 53182 50707 51398 -4222 -5301 -1722 C ATOM 10535 C ILE K 96 104.139 15.722 21.711 1.00421.22 C ANISOU10535 C ILE K 96 54869 52138 53035 -4524 -5124 -1825 C ATOM 10536 O ILE K 96 104.607 16.695 22.337 1.00422.19 O ANISOU10536 O ILE K 96 55150 52080 53183 -4739 -4938 -2002 O ATOM 10537 CB ILE K 96 103.003 13.805 23.002 1.00404.07 C ANISOU10537 CB ILE K 96 52249 50479 50798 -4300 -5555 -1799 C ATOM 10538 CG1 ILE K 96 101.712 13.398 23.733 1.00400.41 C ANISOU10538 CG1 ILE K 96 51720 50124 50292 -4061 -5679 -1757 C ATOM 10539 CG2 ILE K 96 104.145 13.970 24.003 1.00404.59 C ANISOU10539 CG2 ILE K 96 52222 50629 50873 -4635 -5539 -2030 C ATOM 10540 CD1 ILE K 96 101.155 14.426 24.701 1.00399.89 C ANISOU10540 CD1 ILE K 96 51847 49882 50210 -4051 -5560 -1859 C ATOM 10541 N THR K 97 104.741 15.173 20.649 1.00435.39 N ANISOU10541 N THR K 97 56574 54005 54848 -4546 -5170 -1728 N ATOM 10542 CA THR K 97 106.052 15.608 20.126 1.00453.97 C ANISOU10542 CA THR K 97 58989 56247 57250 -4827 -5023 -1814 C ATOM 10543 C THR K 97 106.047 17.050 19.621 1.00471.91 C ANISOU10543 C THR K 97 61641 58110 59552 -4837 -4692 -1804 C ATOM 10544 O THR K 97 107.009 17.797 19.814 1.00487.64 O ANISOU10544 O THR K 97 63742 59946 61589 -5140 -4497 -1982 O ATOM 10545 CB THR K 97 106.558 14.683 18.990 1.00449.97 C ANISOU10545 CB THR K 97 58316 55898 56753 -4801 -5144 -1679 C ATOM 10546 OG1 THR K 97 105.578 14.598 17.936 1.00448.49 O ANISOU10546 OG1 THR K 97 58223 55645 56536 -4465 -5145 -1445 O ATOM 10547 CG2 THR K 97 106.874 13.288 19.537 1.00442.73 C ANISOU10547 CG2 THR K 97 57035 55362 55818 -4859 -5416 -1718 C ATOM 10548 N ASP K 98 104.947 17.426 18.975 1.00478.05 N ANISOU10548 N ASP K 98 62615 58725 60294 -4497 -4615 -1600 N ATOM 10549 CA ASP K 98 104.747 18.788 18.471 1.00470.18 C ANISOU10549 CA ASP K 98 62011 57325 59309 -4418 -4276 -1541 C ATOM 10550 C ASP K 98 104.704 19.831 19.616 1.00444.63 C ANISOU10550 C ASP K 98 58972 53866 56100 -4580 -4072 -1740 C ATOM 10551 O ASP K 98 105.396 20.866 19.582 1.00442.14 O ANISOU10551 O ASP K 98 58898 53250 55842 -4805 -3768 -1862 O ATOM 10552 CB ASP K 98 103.445 18.859 17.637 1.00490.18 C ANISOU10552 CB ASP K 98 64671 59813 61762 -3957 -4268 -1267 C ATOM 10553 CG ASP K 98 103.533 18.151 16.263 1.00495.73 C ANISOU10553 CG ASP K 98 65261 60660 62434 -3796 -4372 -1072 C ATOM 10554 OD1 ASP K 98 104.569 17.522 15.932 1.00500.79 O ANISOU10554 OD1 ASP K 98 65720 61431 63124 -4030 -4466 -1130 O ATOM 10555 OD2 ASP K 98 102.525 18.239 15.514 1.00497.17 O ANISOU10555 OD2 ASP K 98 65530 60841 62529 -3420 -4355 -861 O ATOM 10556 N LYS K 99 103.881 19.547 20.625 1.00410.38 N ANISOU10556 N LYS K 99 54529 49673 51723 -4473 -4227 -1781 N ATOM 10557 CA LYS K 99 103.774 20.414 21.786 1.00385.27 C ANISOU10557 CA LYS K 99 51497 46328 48560 -4618 -4069 -1977 C ATOM 10558 C LYS K 99 105.068 20.466 22.609 1.00389.90 C ANISOU10558 C LYS K 99 51945 47003 49195 -5079 -4047 -2286 C ATOM 10559 O LYS K 99 105.268 21.413 23.376 1.00393.14 O ANISOU10559 O LYS K 99 52522 47219 49633 -5282 -3828 -2491 O ATOM 10560 CB LYS K 99 102.564 20.034 22.631 1.00364.55 C ANISOU10560 CB LYS K 99 48776 43859 45875 -4378 -4255 -1936 C ATOM 10561 CG LYS K 99 101.499 21.114 22.651 1.00348.76 C ANISOU10561 CG LYS K 99 47118 41547 43847 -4116 -4022 -1837 C ATOM 10562 CD LYS K 99 100.607 21.117 21.425 1.00340.29 C ANISOU10562 CD LYS K 99 46171 40415 42708 -3698 -3995 -1535 C ATOM 10563 CE LYS K 99 99.262 21.752 21.735 1.00333.44 C ANISOU10563 CE LYS K 99 45509 39412 41769 -3360 -3899 -1425 C ATOM 10564 NZ LYS K 99 99.361 23.140 22.258 1.00331.02 N ANISOU10564 NZ LYS K 99 45559 38705 41506 -3470 -3540 -1536 N ATOM 10565 N SER K 100 105.942 19.468 22.427 1.00394.12 N ANISOU10565 N SER K 100 52176 47841 49730 -5239 -4260 -2325 N ATOM 10566 CA SER K 100 107.308 19.492 22.986 1.00401.20 C ANISOU10566 CA SER K 100 52920 48865 50650 -5667 -4232 -2607 C ATOM 10567 C SER K 100 108.154 20.654 22.435 1.00407.46 C ANISOU10567 C SER K 100 53990 49312 51513 -5925 -3867 -2725 C ATOM 10568 O SER K 100 109.002 21.212 23.153 1.00412.99 O ANISOU10568 O SER K 100 54682 50000 52233 -6290 -3720 -3024 O ATOM 10569 CB SER K 100 108.025 18.140 22.804 1.00399.49 C ANISOU10569 CB SER K 100 52329 49053 50406 -5733 -4528 -2585 C ATOM 10570 OG SER K 100 108.617 18.000 21.525 1.00401.27 O ANISOU10570 OG SER K 100 52589 49208 50667 -5748 -4477 -2463 O ATOM 10571 N GLU K 101 107.908 21.033 21.178 1.00409.13 N ANISOU10571 N GLU K 101 54444 49250 51754 -5733 -3705 -2502 N ATOM 10572 CA GLU K 101 108.491 22.269 20.610 1.00413.99 C ANISOU10572 CA GLU K 101 55403 49453 52441 -5913 -3293 -2573 C ATOM 10573 C GLU K 101 107.913 23.605 21.132 1.00423.06 C ANISOU10573 C GLU K 101 56920 50203 53618 -5901 -2945 -2654 C ATOM 10574 O GLU K 101 108.640 24.606 21.186 1.00431.98 O ANISOU10574 O GLU K 101 58268 51047 54816 -6204 -2594 -2856 O ATOM 10575 CB GLU K 101 108.438 22.259 19.076 1.00407.55 C ANISOU10575 CB GLU K 101 54739 48474 51637 -5689 -3210 -2293 C ATOM 10576 CG GLU K 101 109.687 21.753 18.395 1.00399.67 C ANISOU10576 CG GLU K 101 53568 47617 50671 -5936 -3265 -2346 C ATOM 10577 CD GLU K 101 109.365 21.059 17.078 1.00395.28 C ANISOU10577 CD GLU K 101 52969 47134 50085 -5622 -3407 -2030 C ATOM 10578 OE1 GLU K 101 108.673 21.672 16.240 1.00394.31 O ANISOU10578 OE1 GLU K 101 53138 46729 49950 -5328 -3211 -1806 O ATOM 10579 OE2 GLU K 101 109.768 19.891 16.898 1.00392.95 O ANISOU10579 OE2 GLU K 101 52342 47191 49768 -5653 -3709 -2003 O ATOM 10580 N GLU K 102 106.626 23.641 21.496 1.00422.67 N ANISOU10580 N GLU K 102 56949 50126 53518 -5563 -3016 -2505 N ATOM 10581 CA GLU K 102 106.034 24.853 22.084 1.00424.41 C ANISOU10581 CA GLU K 102 57508 49988 53759 -5536 -2697 -2580 C ATOM 10582 C GLU K 102 106.442 25.073 23.555 1.00437.06 C ANISOU10582 C GLU K 102 58985 51702 55376 -5893 -2698 -2942 C ATOM 10583 O GLU K 102 106.661 26.209 23.975 1.00440.56 O ANISOU10583 O GLU K 102 59693 51824 55874 -6107 -2339 -3140 O ATOM 10584 CB GLU K 102 104.518 24.848 21.923 1.00408.31 C ANISOU10584 CB GLU K 102 55596 47894 51648 -5037 -2764 -2293 C ATOM 10585 CG GLU K 102 103.832 26.100 22.420 1.00401.05 C ANISOU10585 CG GLU K 102 55052 46587 50742 -4951 -2421 -2325 C ATOM 10586 CD GLU K 102 102.478 25.770 22.982 1.00395.88 C ANISOU10586 CD GLU K 102 54334 46079 50002 -4594 -2633 -2189 C ATOM 10587 OE1 GLU K 102 102.180 26.194 24.115 1.00400.18 O ANISOU10587 OE1 GLU K 102 54920 46576 50553 -4695 -2579 -2367 O ATOM 10588 OE2 GLU K 102 101.704 25.056 22.296 1.00386.78 O ANISOU10588 OE2 GLU K 102 53073 45113 48770 -4219 -2858 -1917 O ATOM 10589 N ILE K 103 106.547 23.980 24.317 1.00446.86 N ANISOU10589 N ILE K 103 59822 53401 56560 -5950 -3084 -3027 N ATOM 10590 CA ILE K 103 107.135 23.962 25.672 1.00452.22 C ANISOU10590 CA ILE K 103 60290 54308 57225 -6301 -3144 -3378 C ATOM 10591 C ILE K 103 108.609 24.400 25.661 1.00470.13 C ANISOU10591 C ILE K 103 62525 56562 59541 -6783 -2941 -3685 C ATOM 10592 O ILE K 103 109.076 25.125 26.561 1.00474.65 O ANISOU10592 O ILE K 103 63130 57085 60127 -7116 -2746 -4017 O ATOM 10593 CB ILE K 103 106.996 22.553 26.298 1.00437.02 C ANISOU10593 CB ILE K 103 57928 52901 55215 -6206 -3603 -3347 C ATOM 10594 CG1 ILE K 103 105.586 22.365 26.850 1.00428.78 C ANISOU10594 CG1 ILE K 103 56914 51877 54126 -5854 -3745 -3192 C ATOM 10595 CG2 ILE K 103 108.035 22.308 27.381 1.00428.40 C ANISOU10595 CG2 ILE K 103 56539 52148 54085 -6595 -3693 -3694 C ATOM 10596 CD1 ILE K 103 105.092 20.945 26.759 1.00420.95 C ANISOU10596 CD1 ILE K 103 55611 51256 53072 -5589 -4141 -2988 C ATOM 10597 N ALA K 104 109.342 23.953 24.643 1.00485.67 N ANISOU10597 N ALA K 104 64413 58589 61528 -6830 -2985 -3588 N ATOM 10598 CA ALA K 104 110.701 24.444 24.393 1.00497.17 C ANISOU10598 CA ALA K 104 65882 59981 63036 -7261 -2751 -3847 C ATOM 10599 C ALA K 104 110.733 25.969 24.069 1.00503.63 C ANISOU10599 C ALA K 104 67171 60232 63952 -7397 -2221 -3939 C ATOM 10600 O ALA K 104 111.765 26.641 24.271 1.00511.67 O ANISOU10600 O ALA K 104 68231 61159 65019 -7832 -1949 -4265 O ATOM 10601 CB ALA K 104 111.371 23.619 23.297 1.00496.81 C ANISOU10601 CB ALA K 104 65671 60101 62990 -7235 -2914 -3684 C ATOM 10602 N GLN K 105 109.611 26.510 23.575 1.00498.17 N ANISOU10602 N GLN K 105 66828 59169 63282 -7023 -2058 -3660 N ATOM 10603 CA GLN K 105 109.459 27.966 23.408 1.00492.01 C ANISOU10603 CA GLN K 105 66523 57830 62585 -7087 -1534 -3719 C ATOM 10604 C GLN K 105 109.394 28.702 24.755 1.00493.77 C ANISOU10604 C GLN K 105 66801 57987 62821 -7349 -1359 -4059 C ATOM 10605 O GLN K 105 109.891 29.823 24.868 1.00499.52 O ANISOU10605 O GLN K 105 67804 58359 63631 -7655 -910 -4301 O ATOM 10606 CB GLN K 105 108.248 28.308 22.551 1.00480.55 C ANISOU10606 CB GLN K 105 65414 56048 61124 -6569 -1414 -3312 C ATOM 10607 CG GLN K 105 108.376 27.839 21.122 1.00469.83 C ANISOU10607 CG GLN K 105 64069 54686 59758 -6340 -1482 -3006 C ATOM 10608 CD GLN K 105 107.147 28.170 20.326 1.00463.71 C ANISOU10608 CD GLN K 105 63598 53650 58940 -5804 -1374 -2615 C ATOM 10609 OE1 GLN K 105 106.339 28.983 20.738 1.00458.88 O ANISOU10609 OE1 GLN K 105 63269 52761 58324 -5641 -1145 -2583 O ATOM 10610 NE2 GLN K 105 106.999 27.540 19.176 1.00464.10 N ANISOU10610 NE2 GLN K 105 63582 53808 58943 -5519 -1536 -2319 N ATOM 10611 N ALA K 106 108.800 28.080 25.774 1.00487.29 N ANISOU10611 N ALA K 106 65722 57504 61921 -7241 -1693 -4090 N ATOM 10612 CA ALA K 106 108.904 28.606 27.139 1.00484.87 C ANISOU10612 CA ALA K 106 65374 57245 61607 -7536 -1590 -4455 C ATOM 10613 C ALA K 106 110.359 28.589 27.661 1.00486.20 C ANISOU10613 C ALA K 106 65274 57684 61776 -8093 -1556 -4891 C ATOM 10614 O ALA K 106 110.720 29.468 28.444 1.00493.77 O ANISOU10614 O ALA K 106 66327 58517 62765 -8444 -1263 -5253 O ATOM 10615 CB ALA K 106 107.952 27.890 28.089 1.00477.82 C ANISOU10615 CB ALA K 106 64253 56674 60623 -7279 -1966 -4376 C ATOM 10616 N ASN K 107 111.186 27.621 27.220 1.00476.35 N ANISOU10616 N ASN K 107 63696 56809 60487 -8175 -1834 -4870 N ATOM 10617 CA ASN K 107 112.661 27.646 27.464 1.00465.34 C ANISOU10617 CA ASN K 107 62062 55661 59082 -8689 -1766 -5261 C ATOM 10618 C ASN K 107 113.396 28.732 26.689 1.00463.80 C ANISOU10618 C ASN K 107 62199 55016 59006 -8987 -1268 -5405 C ATOM 10619 O ASN K 107 114.460 29.186 27.115 1.00464.38 O ANISOU10619 O ASN K 107 62176 55177 59089 -9475 -1067 -5822 O ATOM 10620 CB ASN K 107 113.356 26.334 27.089 1.00453.44 C ANISOU10620 CB ASN K 107 60140 54647 57498 -8668 -2171 -5167 C ATOM 10621 CG ASN K 107 112.833 25.148 27.842 1.00445.95 C ANISOU10621 CG ASN K 107 58829 54180 56429 -8415 -2648 -5050 C ATOM 10622 OD1 ASN K 107 112.194 25.275 28.886 1.00448.46 O ANISOU10622 OD1 ASN K 107 59117 54573 56703 -8359 -2705 -5139 O ATOM 10623 ND2 ASN K 107 113.111 23.970 27.316 1.00437.60 N ANISOU10623 ND2 ASN K 107 57496 53448 55321 -8262 -2981 -4848 N ATOM 10624 N LEU K 108 112.871 29.086 25.514 1.00458.35 N ANISOU10624 N LEU K 108 61876 53880 58395 -8691 -1074 -5060 N ATOM 10625 CA LEU K 108 113.381 30.228 24.742 1.00453.90 C ANISOU10625 CA LEU K 108 61714 52794 57954 -8905 -535 -5143 C ATOM 10626 C LEU K 108 113.073 31.552 25.481 1.00450.25 C ANISOU10626 C LEU K 108 61596 51916 57560 -9095 -67 -5399 C ATOM 10627 O LEU K 108 113.871 32.499 25.454 1.00449.24 O ANISOU10627 O LEU K 108 61661 51506 57521 -9516 388 -5717 O ATOM 10628 CB LEU K 108 112.854 30.214 23.291 1.00456.10 C ANISOU10628 CB LEU K 108 62284 52738 58274 -8483 -461 -4676 C ATOM 10629 CG LEU K 108 113.525 29.274 22.271 1.00450.18 C ANISOU10629 CG LEU K 108 61302 52242 57503 -8439 -720 -4502 C ATOM 10630 CD1 LEU K 108 112.619 29.027 21.072 1.00447.36 C ANISOU10630 CD1 LEU K 108 61153 51682 57138 -7898 -781 -3997 C ATOM 10631 CD2 LEU K 108 114.886 29.797 21.820 1.00449.14 C ANISOU10631 CD2 LEU K 108 61221 51981 57449 -8909 -395 -4781 C ATOM 10632 N GLU K 109 111.933 31.595 26.166 1.00443.38 N ANISOU10632 N GLU K 109 60793 51019 56650 -8803 -173 -5279 N ATOM 10633 CA GLU K 109 111.667 32.653 27.127 1.00440.59 C ANISOU10633 CA GLU K 109 60663 50399 56339 -9010 179 -5569 C ATOM 10634 C GLU K 109 112.720 32.561 28.234 1.00438.48 C ANISOU10634 C GLU K 109 60021 50552 56027 -9562 116 -6103 C ATOM 10635 O GLU K 109 113.234 33.584 28.691 1.00440.44 O ANISOU10635 O GLU K 109 60439 50564 56345 -9986 554 -6497 O ATOM 10636 CB GLU K 109 110.244 32.553 27.686 1.00439.37 C ANISOU10636 CB GLU K 109 60589 50220 56131 -8571 3 -5328 C ATOM 10637 CG GLU K 109 109.133 32.736 26.652 1.00439.45 C ANISOU10637 CG GLU K 109 60969 49842 56159 -8009 93 -4822 C ATOM 10638 CD GLU K 109 109.081 34.131 26.026 1.00443.82 C ANISOU10638 CD GLU K 109 62095 49706 56829 -8031 745 -4797 C ATOM 10639 OE1 GLU K 109 109.745 35.062 26.537 1.00445.70 O ANISOU10639 OE1 GLU K 109 62486 49706 57150 -8487 1166 -5192 O ATOM 10640 OE2 GLU K 109 108.379 34.294 25.007 1.00444.91 O ANISOU10640 OE2 GLU K 109 62529 49546 56967 -7583 853 -4382 O ATOM 10641 N ARG K 110 113.058 31.332 28.639 1.00432.47 N ANISOU10641 N ARG K 110 58749 50424 55143 -9555 -409 -6122 N ATOM 10642 CA ARG K 110 114.211 31.107 29.535 1.00426.91 C ANISOU10642 CA ARG K 110 57631 50212 54361 -10052 -504 -6605 C ATOM 10643 C ARG K 110 115.542 31.577 28.894 1.00429.80 C ANISOU10643 C ARG K 110 58029 50480 54795 -10510 -181 -6880 C ATOM 10644 O ARG K 110 116.476 31.871 29.634 1.00435.36 O ANISOU10644 O ARG K 110 58517 51439 55461 -11002 -63 -7368 O ATOM 10645 CB ARG K 110 114.294 29.652 30.101 1.00414.24 C ANISOU10645 CB ARG K 110 55478 49320 52593 -9901 -1122 -6536 C ATOM 10646 CG ARG K 110 115.023 29.521 31.460 1.00399.48 C ANISOU10646 CG ARG K 110 53199 47987 50598 -10292 -1238 -7018 C ATOM 10647 CD ARG K 110 114.543 28.351 32.349 1.00380.83 C ANISOU10647 CD ARG K 110 50432 46187 48077 -10013 -1769 -6898 C ATOM 10648 NE ARG K 110 114.659 28.651 33.790 1.00365.89 N ANISOU10648 NE ARG K 110 48338 44596 46087 -10270 -1761 -7305 N ATOM 10649 CZ ARG K 110 114.153 27.918 34.792 1.00354.77 C ANISOU10649 CZ ARG K 110 46640 43609 44544 -10065 -2124 -7266 C ATOM 10650 NH1 ARG K 110 113.468 26.804 34.553 1.00346.70 N ANISOU10650 NH1 ARG K 110 45495 42757 43478 -9603 -2525 -6844 N ATOM 10651 NH2 ARG K 110 114.331 28.308 36.050 1.00350.98 N ANISOU10651 NH2 ARG K 110 45995 43386 43975 -10329 -2069 -7664 N ATOM 10652 N LYS K 111 115.622 31.670 27.552 1.00424.87 N ANISOU10652 N LYS K 111 57664 49505 54262 -10355 -28 -6587 N ATOM 10653 CA LYS K 111 116.743 32.355 26.841 1.00423.99 C ANISOU10653 CA LYS K 111 57705 49142 54248 -10770 392 -6823 C ATOM 10654 C LYS K 111 116.723 33.876 27.060 1.00432.15 C ANISOU10654 C LYS K 111 59193 49591 55412 -11069 1049 -7107 C ATOM 10655 O LYS K 111 117.779 34.506 27.226 1.00441.56 O ANISOU10655 O LYS K 111 60369 50753 56650 -11612 1394 -7561 O ATOM 10656 CB LYS K 111 116.765 32.032 25.332 1.00414.72 C ANISOU10656 CB LYS K 111 56700 47742 53131 -10484 378 -6402 C ATOM 10657 CG LYS K 111 117.594 30.822 24.941 1.00404.62 C ANISOU10657 CG LYS K 111 54970 47003 51763 -10517 -55 -6354 C ATOM 10658 CD LYS K 111 119.078 31.158 25.049 1.00406.42 C ANISOU10658 CD LYS K 111 55027 47394 52001 -11123 168 -6837 C ATOM 10659 CE LYS K 111 119.886 29.985 25.583 1.00404.65 C ANISOU10659 CE LYS K 111 54197 47936 51616 -11262 -320 -7002 C ATOM 10660 NZ LYS K 111 120.936 30.395 26.570 1.00409.10 N ANISOU10660 NZ LYS K 111 54493 48828 52115 -11846 -169 -7609 N ATOM 10661 N ALA K 112 115.520 34.452 27.072 1.00430.27 N ANISOU10661 N ALA K 112 59352 48901 55229 -10715 1231 -6850 N ATOM 10662 CA ALA K 112 115.320 35.851 27.454 1.00434.28 C ANISOU10662 CA ALA K 112 60294 48859 55850 -10942 1839 -7098 C ATOM 10663 C ALA K 112 115.678 36.111 28.935 1.00440.16 C ANISOU10663 C ALA K 112 60776 49923 56539 -11391 1856 -7646 C ATOM 10664 O ALA K 112 116.231 37.163 29.265 1.00447.63 O ANISOU10664 O ALA K 112 61915 50590 57573 -11863 2375 -8076 O ATOM 10665 CB ALA K 112 113.893 36.286 27.149 1.00428.09 C ANISOU10665 CB ALA K 112 59958 47588 55108 -10395 1974 -6657 C ATOM 10666 N GLN K 113 115.383 35.145 29.811 1.00439.64 N ANISOU10666 N GLN K 113 60268 50450 56323 -11249 1303 -7638 N ATOM 10667 CA GLN K 113 115.648 35.249 31.270 1.00441.64 C ANISOU10667 CA GLN K 113 60216 51100 56487 -11607 1240 -8122 C ATOM 10668 C GLN K 113 117.134 35.179 31.702 1.00443.80 C ANISOU10668 C GLN K 113 60086 51842 56693 -12222 1266 -8679 C ATOM 10669 O GLN K 113 117.615 36.075 32.414 1.00450.02 O ANISOU10669 O GLN K 113 60915 52561 57509 -12710 1654 -9192 O ATOM 10670 CB GLN K 113 114.857 34.181 32.053 1.00436.53 C ANISOU10670 CB GLN K 113 59217 50955 55687 -11224 636 -7909 C ATOM 10671 CG GLN K 113 113.337 34.298 31.976 1.00433.74 C ANISOU10671 CG GLN K 113 59195 50235 55371 -10674 599 -7468 C ATOM 10672 CD GLN K 113 112.613 33.250 32.812 1.00428.12 C ANISOU10672 CD GLN K 113 58122 50031 54512 -10346 29 -7306 C ATOM 10673 OE1 GLN K 113 113.102 32.820 33.858 1.00425.50 O ANISOU10673 OE1 GLN K 113 57370 50240 54058 -10590 -209 -7631 O ATOM 10674 NE2 GLN K 113 111.430 32.845 32.360 1.00424.87 N ANISOU10674 NE2 GLN K 113 57870 49456 54103 -9785 -175 -6808 N ATOM 10675 N LYS K 114 117.824 34.110 31.271 1.00436.43 N ANISOU10675 N LYS K 114 58761 51396 55663 -12185 859 -8578 N ATOM 10676 CA LYS K 114 119.178 33.696 31.744 1.00426.92 C ANISOU10676 CA LYS K 114 57048 50829 54331 -12658 716 -9038 C ATOM 10677 C LYS K 114 120.282 34.672 31.336 1.00429.55 C ANISOU10677 C LYS K 114 57539 50900 54770 -13234 1268 -9469 C ATOM 10678 O LYS K 114 120.262 35.215 30.222 1.00438.10 O ANISOU10678 O LYS K 114 59046 51397 56015 -13185 1623 -9267 O ATOM 10679 CB LYS K 114 119.504 32.236 31.281 1.00409.62 C ANISOU10679 CB LYS K 114 54441 49181 52012 -12376 134 -8727 C ATOM 10680 CG LYS K 114 120.934 31.703 31.490 1.00394.89 C ANISOU10680 CG LYS K 114 52067 47965 50007 -12779 -28 -9103 C ATOM 10681 CD LYS K 114 121.162 30.392 30.734 1.00376.27 C ANISOU10681 CD LYS K 114 49440 45952 47572 -12450 -501 -8709 C ATOM 10682 CE LYS K 114 122.346 29.637 31.306 1.00368.65 C ANISOU10682 CE LYS K 114 47880 45786 46402 -12727 -791 -9040 C ATOM 10683 NZ LYS K 114 122.404 28.251 30.779 1.00357.96 N ANISOU10683 NZ LYS K 114 46247 44806 44956 -12342 -1292 -8631 N ATOM 10684 N LYS K 115 121.224 34.891 32.252 1.00419.94 N ANISOU10684 N LYS K 115 55975 50130 53451 -13771 1347 -10070 N ATOM 10685 CA LYS K 115 122.324 35.811 32.023 1.00410.12 C ANISOU10685 CA LYS K 115 54823 48712 52292 -14386 1878 -10570 C ATOM 10686 C LYS K 115 123.349 35.200 31.065 1.00408.22 C ANISOU10686 C LYS K 115 54372 48706 52027 -14479 1742 -10509 C ATOM 10687 O LYS K 115 123.873 34.110 31.322 1.00405.93 O ANISOU10687 O LYS K 115 53557 49128 51548 -14424 1237 -10511 O ATOM 10688 CB LYS K 115 122.946 36.266 33.357 1.00403.58 C ANISOU10688 CB LYS K 115 53671 48323 51347 -14936 2014 -11265 C ATOM 10689 CG LYS K 115 123.302 35.174 34.359 1.00391.73 C ANISOU10689 CG LYS K 115 51495 47770 49572 -14906 1418 -11413 C ATOM 10690 CD LYS K 115 124.742 34.740 34.164 1.00384.26 C ANISOU10690 CD LYS K 115 50101 47400 48498 -15289 1323 -11746 C ATOM 10691 CE LYS K 115 125.221 33.855 35.289 1.00377.63 C ANISOU10691 CE LYS K 115 48591 47526 47363 -15334 838 -12000 C ATOM 10692 NZ LYS K 115 126.623 33.434 35.045 1.00374.05 N ANISOU10692 NZ LYS K 115 47704 47645 46772 -15677 752 -12305 N ATOM 10693 N LYS K 116 123.562 35.891 29.942 1.00408.14 N ANISOU10693 N LYS K 116 54798 48070 52205 -14571 2197 -10414 N ATOM 10694 CA LYS K 116 124.637 35.600 28.983 1.00406.79 C ANISOU10694 CA LYS K 116 54507 48007 52047 -14766 2218 -10441 C ATOM 10695 C LYS K 116 125.543 36.843 28.943 1.00414.89 C ANISOU10695 C LYS K 116 55734 48709 53193 -15438 2907 -11017 C ATOM 10696 O LYS K 116 125.067 37.961 28.707 1.00420.01 O ANISOU10696 O LYS K 116 56932 48621 54030 -15500 3474 -11026 O ATOM 10697 CB LYS K 116 124.087 35.229 27.590 1.00399.91 C ANISOU10697 CB LYS K 116 53965 46696 51287 -14247 2131 -9782 C ATOM 10698 CG LYS K 116 123.151 34.014 27.534 1.00390.65 C ANISOU10698 CG LYS K 116 52619 45798 50010 -13591 1492 -9215 C ATOM 10699 CD LYS K 116 123.780 32.696 27.997 1.00384.13 C ANISOU10699 CD LYS K 116 51140 45845 48967 -13576 882 -9272 C ATOM 10700 CE LYS K 116 124.740 32.086 26.983 1.00381.77 C ANISOU10700 CE LYS K 116 50665 45735 48653 -13637 756 -9176 C ATOM 10701 NZ LYS K 116 125.017 30.646 27.275 1.00376.17 N ANISOU10701 NZ LYS K 116 49399 45787 47740 -13419 114 -9038 N ATOM 10702 N LYS K 117 126.838 36.608 29.155 1.00416.58 N ANISOU10702 N LYS K 117 55502 49487 53292 -15920 2858 -11484 N ATOM 10703 CA LYS K 117 127.785 37.574 29.734 1.00420.23 C ANISOU10703 CA LYS K 117 55895 50004 53768 -16657 3365 -12231 C ATOM 10704 C LYS K 117 128.105 38.872 28.975 1.00422.73 C ANISOU10704 C LYS K 117 56764 49520 54332 -17037 4158 -12430 C ATOM 10705 O LYS K 117 128.178 39.929 29.605 1.00427.95 O ANISOU10705 O LYS K 117 57605 49924 55070 -17477 4677 -12913 O ATOM 10706 CB LYS K 117 129.054 36.826 30.181 1.00418.75 C ANISOU10706 CB LYS K 117 55012 50747 53345 -17009 3022 -12648 C ATOM 10707 CG LYS K 117 128.802 35.918 31.388 1.00411.47 C ANISOU10707 CG LYS K 117 53551 50624 52162 -16804 2424 -12683 C ATOM 10708 CD LYS K 117 129.737 34.720 31.469 1.00404.50 C ANISOU10708 CD LYS K 117 52023 50636 51031 -16796 1887 -12731 C ATOM 10709 CE LYS K 117 129.464 33.921 32.736 1.00398.58 C ANISOU10709 CE LYS K 117 50776 50646 50020 -16594 1366 -12784 C ATOM 10710 NZ LYS K 117 129.860 32.495 32.608 1.00393.63 N ANISOU10710 NZ LYS K 117 49659 50722 49180 -16262 741 -12499 N ATOM 10711 N SER K 118 128.265 38.791 27.654 1.00417.49 N ANISOU10711 N SER K 118 56373 48460 53792 -16859 4263 -12059 N ATOM 10712 CA SER K 118 128.661 39.925 26.776 1.00417.70 C ANISOU10712 CA SER K 118 56924 47730 54050 -17185 5013 -12195 C ATOM 10713 C SER K 118 127.769 41.176 26.816 1.00417.27 C ANISOU10713 C SER K 118 57537 46803 54203 -17147 5648 -12152 C ATOM 10714 O SER K 118 128.218 42.296 26.511 1.00418.35 O ANISOU10714 O SER K 118 58054 46383 54514 -17587 6373 -12482 O ATOM 10715 CB SER K 118 128.785 39.453 25.328 1.00416.37 C ANISOU10715 CB SER K 118 56929 47315 53955 -16847 4912 -11675 C ATOM 10716 OG SER K 118 127.518 39.327 24.692 1.00414.27 O ANISOU10716 OG SER K 118 57086 46545 53773 -16157 4808 -10975 O TER 10717 SER K 118 ATOM 10718 N SER L 8 92.810 27.093 27.237 1.00325.86 N ANISOU10718 N SER L 8 32357 44380 47072 -1957 -6867 6955 N ATOM 10719 CA SER L 8 92.666 26.204 28.427 1.00315.77 C ANISOU10719 CA SER L 8 31621 42748 45608 -1411 -6229 5842 C ATOM 10720 C SER L 8 93.951 25.402 28.664 1.00319.39 C ANISOU10720 C SER L 8 32689 43581 45084 -1375 -5824 5123 C ATOM 10721 O SER L 8 94.182 24.368 28.020 1.00322.31 O ANISOU10721 O SER L 8 33289 44733 44441 -1726 -5684 4937 O ATOM 10722 CB SER L 8 91.473 25.271 28.247 1.00306.47 C ANISOU10722 CB SER L 8 30439 41867 44137 -1496 -6094 5720 C ATOM 10723 OG SER L 8 90.971 24.860 29.499 1.00291.39 O ANISOU10723 OG SER L 8 28799 39361 42555 -918 -5620 4927 O ATOM 10724 N GLY L 9 94.775 25.899 29.586 1.00325.61 N ANISOU10724 N GLY L 9 33688 43794 46233 -963 -5643 4706 N ATOM 10725 CA GLY L 9 96.112 25.358 29.848 1.00334.12 C ANISOU10725 CA GLY L 9 35275 45124 46549 -915 -5327 4135 C ATOM 10726 C GLY L 9 96.249 24.749 31.232 1.00341.60 C ANISOU10726 C GLY L 9 36684 45637 47470 -358 -4768 3176 C ATOM 10727 O GLY L 9 95.722 25.269 32.216 1.00346.86 O ANISOU10727 O GLY L 9 37253 45619 48917 74 -4663 2930 O ATOM 10728 N PHE L 10 96.938 23.617 31.305 1.00348.69 N ANISOU10728 N PHE L 10 38037 46967 47481 -399 -4405 2631 N ATOM 10729 CA PHE L 10 96.982 22.866 32.559 1.00358.60 C ANISOU10729 CA PHE L 10 39689 47925 48635 58 -3892 1820 C ATOM 10730 C PHE L 10 98.121 23.394 33.456 1.00363.65 C ANISOU10730 C PHE L 10 40556 48181 49434 370 -3757 1469 C ATOM 10731 O PHE L 10 99.059 23.989 32.943 1.00372.16 O ANISOU10731 O PHE L 10 41592 49366 50445 174 -3994 1768 O ATOM 10732 CB PHE L 10 97.054 21.353 32.269 1.00354.36 C ANISOU10732 CB PHE L 10 39451 47947 47243 -117 -3574 1427 C ATOM 10733 CG PHE L 10 95.742 20.749 31.799 1.00353.68 C ANISOU10733 CG PHE L 10 39171 48088 47121 -282 -3599 1567 C ATOM 10734 CD1 PHE L 10 94.956 21.386 30.840 1.00354.24 C ANISOU10734 CD1 PHE L 10 38802 48335 47457 -617 -4040 2271 C ATOM 10735 CD2 PHE L 10 95.290 19.541 32.320 1.00352.17 C ANISOU10735 CD2 PHE L 10 39204 47938 46666 -119 -3201 1040 C ATOM 10736 CE1 PHE L 10 93.756 20.843 30.425 1.00351.62 C ANISOU10736 CE1 PHE L 10 38284 48222 47094 -777 -4073 2404 C ATOM 10737 CE2 PHE L 10 94.089 18.994 31.900 1.00348.82 C ANISOU10737 CE2 PHE L 10 38593 47704 46237 -268 -3226 1156 C ATOM 10738 CZ PHE L 10 93.331 19.642 30.947 1.00348.24 C ANISOU10738 CZ PHE L 10 38109 47820 46386 -599 -3658 1817 C ATOM 10739 N ARG L 11 98.029 23.205 34.778 1.00358.56 N ANISOU10739 N ARG L 11 40116 47136 48982 822 -3394 864 N ATOM 10740 CA ARG L 11 98.952 23.874 35.725 1.00341.52 C ANISOU10740 CA ARG L 11 38092 44586 47083 1121 -3295 529 C ATOM 10741 C ARG L 11 100.216 23.108 36.122 1.00321.62 C ANISOU10741 C ARG L 11 36023 42316 43862 1159 -3003 99 C ATOM 10742 O ARG L 11 100.149 21.922 36.483 1.00316.93 O ANISOU10742 O ARG L 11 35691 41954 42773 1216 -2665 -266 O ATOM 10743 CB ARG L 11 98.250 24.270 37.022 1.00341.32 C ANISOU10743 CB ARG L 11 37972 44038 47674 1557 -3075 81 C ATOM 10744 CG ARG L 11 96.763 24.526 36.933 1.00340.68 C ANISOU10744 CG ARG L 11 37513 43729 48200 1606 -3170 278 C ATOM 10745 CD ARG L 11 96.350 25.414 38.088 1.00334.32 C ANISOU10745 CD ARG L 11 36480 42327 48217 1991 -3046 -134 C ATOM 10746 NE ARG L 11 97.030 25.074 39.337 1.00320.49 N ANISOU10746 NE ARG L 11 35065 40594 46112 2263 -2640 -844 N ATOM 10747 CZ ARG L 11 96.553 24.233 40.245 1.00312.46 C ANISOU10747 CZ ARG L 11 34222 39730 44766 2453 -2238 -1324 C ATOM 10748 NH1 ARG L 11 95.396 23.616 40.043 1.00311.07 N ANISOU10748 NH1 ARG L 11 33945 39662 44584 2427 -2168 -1211 N ATOM 10749 NH2 ARG L 11 97.236 24.005 41.354 1.00304.14 N ANISOU10749 NH2 ARG L 11 33419 38757 43382 2644 -1921 -1875 N ATOM 10750 N LYS L 12 101.336 23.840 36.115 1.00300.03 N ANISOU10750 N LYS L 12 33329 39470 41198 1143 -3148 166 N ATOM 10751 CA LYS L 12 102.667 23.372 36.515 1.00279.44 C ANISOU10751 CA LYS L 12 31094 37014 38066 1188 -2932 -180 C ATOM 10752 C LYS L 12 102.643 22.800 37.948 1.00272.14 C ANISOU10752 C LYS L 12 30414 35932 37052 1560 -2513 -808 C ATOM 10753 O LYS L 12 103.039 21.644 38.158 1.00266.92 O ANISOU10753 O LYS L 12 30032 35554 35827 1548 -2233 -1064 O ATOM 10754 CB LYS L 12 103.693 24.522 36.323 1.00272.60 C ANISOU10754 CB LYS L 12 30138 35951 37487 1137 -3216 55 C ATOM 10755 CG LYS L 12 103.827 24.980 34.864 1.00272.39 C ANISOU10755 CG LYS L 12 29851 36219 37425 697 -3636 759 C ATOM 10756 CD LYS L 12 103.707 26.489 34.619 1.00273.73 C ANISOU10756 CD LYS L 12 29594 35960 38450 678 -4070 1268 C ATOM 10757 CE LYS L 12 105.053 27.192 34.618 1.00274.20 C ANISOU10757 CE LYS L 12 29707 35915 38560 648 -4213 1348 C ATOM 10758 NZ LYS L 12 105.909 26.732 33.492 1.00277.34 N ANISOU10758 NZ LYS L 12 30207 36964 38204 211 -4321 1686 N ATOM 10759 N GLU L 13 102.114 23.579 38.899 1.00271.04 N ANISOU10759 N GLU L 13 30110 35371 37498 1857 -2473 -1042 N ATOM 10760 CA GLU L 13 101.977 23.157 40.304 1.00267.64 C ANISOU10760 CA GLU L 13 29832 34884 36973 2165 -2091 -1618 C ATOM 10761 C GLU L 13 101.088 21.927 40.511 1.00264.08 C ANISOU10761 C GLU L 13 29466 34684 36188 2189 -1817 -1735 C ATOM 10762 O GLU L 13 101.420 21.040 41.308 1.00264.06 O ANISOU10762 O GLU L 13 29697 34876 35757 2291 -1509 -2043 O ATOM 10763 CB GLU L 13 101.454 24.308 41.166 1.00268.99 C ANISOU10763 CB GLU L 13 29714 34605 37882 2423 -2100 -1898 C ATOM 10764 CG GLU L 13 101.817 24.162 42.634 1.00266.83 C ANISOU10764 CG GLU L 13 29592 34373 37416 2668 -1752 -2524 C ATOM 10765 CD GLU L 13 100.657 23.765 43.529 1.00264.18 C ANISOU10765 CD GLU L 13 29142 34090 37143 2847 -1450 -2878 C ATOM 10766 OE1 GLU L 13 100.522 24.398 44.593 1.00264.08 O ANISOU10766 OE1 GLU L 13 28973 33936 37427 3038 -1290 -3377 O ATOM 10767 OE2 GLU L 13 99.885 22.842 43.195 1.00259.97 O ANISOU10767 OE2 GLU L 13 28649 33760 36367 2784 -1361 -2696 O ATOM 10768 N LEU L 14 99.961 21.884 39.805 1.00260.41 N ANISOU10768 N LEU L 14 28775 34210 35957 2083 -1948 -1446 N ATOM 10769 CA LEU L 14 99.007 20.777 39.932 1.00254.49 C ANISOU10769 CA LEU L 14 28056 33660 34977 2097 -1718 -1528 C ATOM 10770 C LEU L 14 99.679 19.463 39.593 1.00256.10 C ANISOU10770 C LEU L 14 28547 34246 34513 1928 -1556 -1559 C ATOM 10771 O LEU L 14 99.704 18.549 40.418 1.00257.93 O ANISOU10771 O LEU L 14 28934 34584 34483 2061 -1245 -1838 O ATOM 10772 CB LEU L 14 97.773 20.976 39.038 1.00246.54 C ANISOU10772 CB LEU L 14 26743 32610 34317 1950 -1944 -1145 C ATOM 10773 CG LEU L 14 96.752 19.823 38.959 1.00238.39 C ANISOU10773 CG LEU L 14 25716 31795 33062 1914 -1753 -1173 C ATOM 10774 CD1 LEU L 14 96.092 19.562 40.304 1.00235.96 C ANISOU10774 CD1 LEU L 14 25403 31360 32889 2236 -1414 -1582 C ATOM 10775 CD2 LEU L 14 95.686 20.107 37.913 1.00238.03 C ANISOU10775 CD2 LEU L 14 25356 31756 33326 1703 -2046 -721 C ATOM 10776 N VAL L 15 100.224 19.389 38.377 1.00261.04 N ANISOU10776 N VAL L 15 29189 35088 34905 1613 -1771 -1266 N ATOM 10777 CA VAL L 15 100.903 18.198 37.868 1.00266.37 C ANISOU10777 CA VAL L 15 30061 36114 35033 1403 -1627 -1347 C ATOM 10778 C VAL L 15 102.056 17.815 38.781 1.00277.71 C ANISOU10778 C VAL L 15 31758 37516 36241 1570 -1393 -1654 C ATOM 10779 O VAL L 15 102.260 16.638 39.039 1.00284.20 O ANISOU10779 O VAL L 15 32701 38474 36805 1570 -1140 -1840 O ATOM 10780 CB VAL L 15 101.397 18.390 36.418 1.00262.57 C ANISOU10780 CB VAL L 15 29501 35938 34323 998 -1901 -1030 C ATOM 10781 CG1 VAL L 15 102.136 17.160 35.921 1.00258.67 C ANISOU10781 CG1 VAL L 15 29161 35797 33323 777 -1703 -1245 C ATOM 10782 CG2 VAL L 15 100.214 18.650 35.503 1.00262.56 C ANISOU10782 CG2 VAL L 15 29205 36062 34492 777 -2148 -663 C ATOM 10783 N SER L 16 102.777 18.818 39.284 1.00290.34 N ANISOU10783 N SER L 16 33401 38915 37998 1705 -1493 -1688 N ATOM 10784 CA SER L 16 103.884 18.615 40.225 1.00300.40 C ANISOU10784 CA SER L 16 34896 40168 39072 1857 -1310 -1949 C ATOM 10785 C SER L 16 103.511 17.811 41.475 1.00308.22 C ANISOU10785 C SER L 16 35949 41186 39972 2078 -987 -2214 C ATOM 10786 O SER L 16 104.117 16.764 41.732 1.00314.87 O ANISOU10786 O SER L 16 36929 42176 40530 2049 -796 -2288 O ATOM 10787 CB SER L 16 104.516 19.953 40.632 1.00300.72 C ANISOU10787 CB SER L 16 34915 39966 39377 1975 -1483 -1978 C ATOM 10788 OG SER L 16 105.716 19.728 41.356 1.00299.62 O ANISOU10788 OG SER L 16 34991 39875 38976 2052 -1346 -2182 O ATOM 10789 N ARG L 17 102.523 18.289 42.239 1.00310.30 N ANISOU10789 N ARG L 17 36066 41321 40512 2275 -928 -2338 N ATOM 10790 CA ARG L 17 102.122 17.625 43.496 1.00309.15 C ANISOU10790 CA ARG L 17 35931 41292 40240 2453 -626 -2562 C ATOM 10791 C ARG L 17 101.419 16.285 43.245 1.00318.15 C ANISOU10791 C ARG L 17 37048 42586 41246 2377 -466 -2453 C ATOM 10792 O ARG L 17 101.586 15.334 44.024 1.00314.76 O ANISOU10792 O ARG L 17 36670 42312 40610 2427 -239 -2504 O ATOM 10793 CB ARG L 17 101.303 18.568 44.399 1.00299.82 C ANISOU10793 CB ARG L 17 34554 39981 39383 2659 -578 -2810 C ATOM 10794 CG ARG L 17 101.967 19.929 44.568 1.00297.46 C ANISOU10794 CG ARG L 17 34213 39459 39347 2722 -748 -2963 C ATOM 10795 CD ARG L 17 101.720 20.568 45.921 1.00300.21 C ANISOU10795 CD ARG L 17 34423 39815 39828 2917 -568 -3417 C ATOM 10796 NE ARG L 17 102.384 21.880 46.029 1.00309.24 N ANISOU10796 NE ARG L 17 35488 40693 41316 2967 -738 -3613 N ATOM 10797 CZ ARG L 17 103.694 22.075 46.224 1.00309.37 C ANISOU10797 CZ ARG L 17 35686 40763 41098 2929 -792 -3666 C ATOM 10798 NH1 ARG L 17 104.529 21.045 46.317 1.00307.25 N ANISOU10798 NH1 ARG L 17 35683 40793 40263 2839 -696 -3520 N ATOM 10799 NH2 ARG L 17 104.181 23.311 46.309 1.00312.90 N ANISOU10799 NH2 ARG L 17 36012 40924 41950 2977 -955 -3856 N ATOM 10800 N LEU L 18 100.678 16.217 42.135 1.00331.14 N ANISOU10800 N LEU L 18 38585 44198 43033 2228 -608 -2271 N ATOM 10801 CA LEU L 18 100.023 14.990 41.662 1.00336.51 C ANISOU10801 CA LEU L 18 39215 45008 43633 2109 -492 -2193 C ATOM 10802 C LEU L 18 101.024 13.852 41.428 1.00343.90 C ANISOU10802 C LEU L 18 40284 46071 44312 1972 -368 -2224 C ATOM 10803 O LEU L 18 100.787 12.722 41.846 1.00337.88 O ANISOU10803 O LEU L 18 39485 45359 43534 1997 -157 -2252 O ATOM 10804 CB LEU L 18 99.225 15.244 40.363 1.00327.00 C ANISOU10804 CB LEU L 18 37857 43815 42571 1902 -718 -1988 C ATOM 10805 CG LEU L 18 97.961 16.121 40.244 1.00317.32 C ANISOU10805 CG LEU L 18 36399 42435 41730 1969 -874 -1856 C ATOM 10806 CD1 LEU L 18 97.499 16.193 38.794 1.00308.64 C ANISOU10806 CD1 LEU L 18 35154 41462 40653 1661 -1138 -1560 C ATOM 10807 CD2 LEU L 18 96.818 15.651 41.131 1.00314.54 C ANISOU10807 CD2 LEU L 18 35937 42047 41524 2166 -644 -1975 C ATOM 10808 N LEU L 19 102.132 14.159 40.750 1.00354.83 N ANISOU10808 N LEU L 19 41776 47485 45559 1821 -503 -2210 N ATOM 10809 CA LEU L 19 103.183 13.171 40.452 1.00354.84 C ANISOU10809 CA LEU L 19 41859 47570 45392 1680 -384 -2290 C ATOM 10810 C LEU L 19 103.889 12.692 41.724 1.00346.70 C ANISOU10810 C LEU L 19 40914 46490 44325 1865 -192 -2343 C ATOM 10811 O LEU L 19 104.188 11.496 41.889 1.00351.16 O ANISOU10811 O LEU L 19 41433 47058 44933 1825 -13 -2362 O ATOM 10812 CB LEU L 19 104.228 13.735 39.465 1.00358.58 C ANISOU10812 CB LEU L 19 42405 48126 45710 1466 -571 -2267 C ATOM 10813 CG LEU L 19 103.827 14.061 38.015 1.00359.87 C ANISOU10813 CG LEU L 19 42444 48488 45799 1159 -783 -2151 C ATOM 10814 CD1 LEU L 19 104.903 14.890 37.325 1.00350.95 C ANISOU10814 CD1 LEU L 19 41372 47462 44508 984 -993 -2052 C ATOM 10815 CD2 LEU L 19 103.476 12.829 37.189 1.00365.58 C ANISOU10815 CD2 LEU L 19 43042 49417 46445 908 -645 -2300 C ATOM 10816 N HIS L 20 104.144 13.628 42.632 1.00332.22 N ANISOU10816 N HIS L 20 39157 44619 42452 2045 -238 -2361 N ATOM 10817 CA HIS L 20 104.906 13.310 43.837 1.00318.08 C ANISOU10817 CA HIS L 20 37429 42881 40543 2167 -98 -2377 C ATOM 10818 C HIS L 20 104.073 12.446 44.845 1.00319.89 C ANISOU10818 C HIS L 20 37522 43221 40800 2272 115 -2312 C ATOM 10819 O HIS L 20 104.565 12.099 45.925 1.00331.84 O ANISOU10819 O HIS L 20 39026 44869 42189 2335 226 -2245 O ATOM 10820 CB HIS L 20 105.570 14.590 44.433 1.00300.58 C ANISOU10820 CB HIS L 20 35316 40648 38240 2275 -217 -2478 C ATOM 10821 CG HIS L 20 106.953 14.913 43.883 1.00278.56 C ANISOU10821 CG HIS L 20 32670 37802 35365 2168 -349 -2464 C ATOM 10822 ND1 HIS L 20 108.036 15.159 44.705 1.00269.40 N ANISOU10822 ND1 HIS L 20 31611 36685 34063 2230 -340 -2503 N ATOM 10823 CD2 HIS L 20 107.415 15.060 42.614 1.00266.66 C ANISOU10823 CD2 HIS L 20 31200 36248 33868 1983 -495 -2413 C ATOM 10824 CE1 HIS L 20 109.102 15.429 43.970 1.00259.92 C ANISOU10824 CE1 HIS L 20 30514 35411 32832 2115 -469 -2476 C ATOM 10825 NE2 HIS L 20 108.756 15.362 42.696 1.00257.59 N ANISOU10825 NE2 HIS L 20 30176 35082 32611 1956 -556 -2424 N ATOM 10826 N LEU L 21 102.843 12.069 44.449 1.00309.88 N ANISOU10826 N LEU L 21 36122 41932 39685 2256 157 -2286 N ATOM 10827 CA LEU L 21 101.987 11.092 45.172 1.00300.80 C ANISOU10827 CA LEU L 21 34805 40874 38608 2314 351 -2175 C ATOM 10828 C LEU L 21 102.502 9.643 45.157 1.00304.67 C ANISOU10828 C LEU L 21 35206 41326 39228 2215 477 -2021 C ATOM 10829 O LEU L 21 102.565 9.006 46.213 1.00310.65 O ANISOU10829 O LEU L 21 35851 42204 39975 2268 605 -1829 O ATOM 10830 CB LEU L 21 100.538 11.083 44.635 1.00288.99 C ANISOU10830 CB LEU L 21 33179 39332 37290 2312 344 -2187 C ATOM 10831 CG LEU L 21 99.290 11.414 45.472 1.00283.15 C ANISOU10831 CG LEU L 21 32299 38694 36591 2465 438 -2206 C ATOM 10832 CD1 LEU L 21 98.057 11.188 44.614 1.00278.00 C ANISOU10832 CD1 LEU L 21 31519 37940 36166 2408 399 -2170 C ATOM 10833 CD2 LEU L 21 99.177 10.595 46.751 1.00285.96 C ANISOU10833 CD2 LEU L 21 32535 39277 36840 2527 653 -2071 C ATOM 10834 N HIS L 22 102.849 9.119 43.978 1.00302.37 N ANISOU10834 N HIS L 22 34909 40886 39089 2048 443 -2102 N ATOM 10835 CA HIS L 22 103.134 7.684 43.838 1.00297.48 C ANISOU10835 CA HIS L 22 34113 40144 38772 1949 584 -2036 C ATOM 10836 C HIS L 22 104.599 7.322 43.626 1.00293.47 C ANISOU10836 C HIS L 22 33635 39527 38342 1858 590 -2074 C ATOM 10837 O HIS L 22 104.920 6.178 43.302 1.00285.55 O ANISOU10837 O HIS L 22 32439 38351 37707 1752 703 -2098 O ATOM 10838 CB HIS L 22 102.236 7.059 42.772 1.00298.27 C ANISOU10838 CB HIS L 22 34066 40167 39095 1806 614 -2178 C ATOM 10839 CG HIS L 22 100.771 7.170 43.079 1.00300.48 C ANISOU10839 CG HIS L 22 34259 40516 39391 1900 633 -2087 C ATOM 10840 ND1 HIS L 22 100.261 7.045 44.355 1.00302.97 N ANISOU10840 ND1 HIS L 22 34494 40925 39695 2069 730 -1862 N ATOM 10841 CD2 HIS L 22 99.704 7.376 42.270 1.00301.22 C ANISOU10841 CD2 HIS L 22 34303 40637 39509 1825 567 -2181 C ATOM 10842 CE1 HIS L 22 98.946 7.177 44.319 1.00304.17 C ANISOU10842 CE1 HIS L 22 34559 41123 39889 2115 742 -1854 C ATOM 10843 NE2 HIS L 22 98.583 7.381 43.066 1.00302.31 N ANISOU10843 NE2 HIS L 22 34343 40822 39697 1978 633 -2030 N ATOM 10844 N PHE L 23 105.475 8.300 43.829 1.00295.18 N ANISOU10844 N PHE L 23 34060 39817 38277 1901 475 -2097 N ATOM 10845 CA PHE L 23 106.898 8.032 43.940 1.00297.09 C ANISOU10845 CA PHE L 23 34328 39976 38574 1854 482 -2069 C ATOM 10846 C PHE L 23 107.180 7.196 45.186 1.00301.41 C ANISOU10846 C PHE L 23 34704 40523 39293 1929 584 -1738 C ATOM 10847 O PHE L 23 106.696 7.516 46.272 1.00294.79 O ANISOU10847 O PHE L 23 33863 39902 38238 2044 586 -1546 O ATOM 10848 CB PHE L 23 107.713 9.341 44.011 1.00295.20 C ANISOU10848 CB PHE L 23 34340 39829 37991 1895 321 -2133 C ATOM 10849 CG PHE L 23 107.691 10.164 42.738 1.00295.52 C ANISOU10849 CG PHE L 23 34499 39881 37901 1773 177 -2346 C ATOM 10850 CD1 PHE L 23 107.433 9.567 41.501 1.00299.52 C ANISOU10850 CD1 PHE L 23 34894 40371 38537 1567 215 -2516 C ATOM 10851 CD2 PHE L 23 107.968 11.539 42.772 1.00292.52 C ANISOU10851 CD2 PHE L 23 34298 39559 37286 1829 -5 -2366 C ATOM 10852 CE1 PHE L 23 107.420 10.325 40.334 1.00303.90 C ANISOU10852 CE1 PHE L 23 35513 41052 38903 1393 59 -2635 C ATOM 10853 CE2 PHE L 23 107.953 12.299 41.603 1.00293.65 C ANISOU10853 CE2 PHE L 23 34491 39735 37344 1684 -175 -2445 C ATOM 10854 CZ PHE L 23 107.669 11.695 40.387 1.00301.35 C ANISOU10854 CZ PHE L 23 35354 40779 38365 1452 -150 -2546 C ATOM 10855 N LYS L 24 107.951 6.120 45.007 1.00313.34 N ANISOU10855 N LYS L 24 36021 41811 41223 1836 667 -1672 N ATOM 10856 CA LYS L 24 108.565 5.389 46.128 1.00326.75 C ANISOU10856 CA LYS L 24 37518 43489 43140 1865 703 -1258 C ATOM 10857 C LYS L 24 109.968 5.958 46.435 1.00337.71 C ANISOU10857 C LYS L 24 39058 44920 44333 1864 604 -1209 C ATOM 10858 O LYS L 24 110.470 5.760 47.537 1.00349.34 O ANISOU10858 O LYS L 24 40429 46524 45778 1885 574 -825 O ATOM 10859 CB LYS L 24 108.644 3.868 45.877 1.00322.65 C ANISOU10859 CB LYS L 24 36612 42623 43355 1774 832 -1145 C ATOM 10860 CG LYS L 24 107.320 3.150 45.628 1.00318.61 C ANISOU10860 CG LYS L 24 35894 42031 43132 1762 933 -1167 C ATOM 10861 CD LYS L 24 106.454 3.045 46.878 1.00318.49 C ANISOU10861 CD LYS L 24 35769 42272 42970 1858 931 -706 C ATOM 10862 CE LYS L 24 105.033 2.602 46.539 1.00315.28 C ANISOU10862 CE LYS L 24 35229 41823 42738 1861 1014 -783 C ATOM 10863 NZ LYS L 24 104.924 1.152 46.199 1.00319.46 N ANISOU10863 NZ LYS L 24 35343 41955 44081 1769 1123 -706 N ATOM 10864 N ASP L 25 110.597 6.634 45.461 1.00340.37 N ANISOU10864 N ASP L 25 39607 45186 44530 1810 544 -1559 N ATOM 10865 CA ASP L 25 111.795 7.464 45.738 1.00335.06 C ANISOU10865 CA ASP L 25 39134 44593 43577 1826 423 -1546 C ATOM 10866 C ASP L 25 111.528 8.965 45.581 1.00338.38 C ANISOU10866 C ASP L 25 39863 45214 43490 1890 283 -1758 C ATOM 10867 O ASP L 25 111.158 9.448 44.507 1.00336.46 O ANISOU10867 O ASP L 25 39720 44935 43182 1832 240 -2023 O ATOM 10868 CB ASP L 25 113.057 7.049 44.942 1.00320.68 C ANISOU10868 CB ASP L 25 37255 42520 42066 1704 451 -1696 C ATOM 10869 CG ASP L 25 114.344 7.683 45.514 1.00305.55 C ANISOU10869 CG ASP L 25 35480 40671 39941 1731 330 -1556 C ATOM 10870 OD1 ASP L 25 114.227 8.478 46.477 1.00299.61 O ANISOU10870 OD1 ASP L 25 34874 40184 38780 1828 225 -1397 O ATOM 10871 OD2 ASP L 25 115.459 7.396 45.020 1.00295.12 O ANISOU10871 OD2 ASP L 25 34102 39159 38871 1644 350 -1641 O ATOM 10872 N ASP L 26 111.737 9.689 46.682 1.00344.86 N ANISOU10872 N ASP L 26 40781 46261 43988 1986 206 -1625 N ATOM 10873 CA ASP L 26 111.485 11.133 46.768 1.00350.49 C ANISOU10873 CA ASP L 26 41711 47118 44340 2067 81 -1836 C ATOM 10874 C ASP L 26 112.520 11.972 46.030 1.00354.80 C ANISOU10874 C ASP L 26 42443 47550 44814 2017 -61 -2001 C ATOM 10875 O ASP L 26 112.254 13.143 45.728 1.00367.22 O ANISOU10875 O ASP L 26 44147 49134 46243 2057 -189 -2177 O ATOM 10876 CB ASP L 26 111.396 11.598 48.229 1.00348.71 C ANISOU10876 CB ASP L 26 41470 47217 43806 2150 77 -1739 C ATOM 10877 CG ASP L 26 110.032 11.328 48.854 1.00344.83 C ANISOU10877 CG ASP L 26 40830 46930 43260 2207 194 -1689 C ATOM 10878 OD1 ASP L 26 109.039 11.128 48.119 1.00337.86 O ANISOU10878 OD1 ASP L 26 39913 45900 42557 2223 238 -1783 O ATOM 10879 OD2 ASP L 26 109.946 11.308 50.099 1.00347.94 O ANISOU10879 OD2 ASP L 26 41117 47683 43401 2211 242 -1550 O ATOM 10880 N LYS L 27 113.690 11.380 45.754 1.00344.40 N ANISOU10880 N LYS L 27 41095 46103 43657 1926 -45 -1923 N ATOM 10881 CA LYS L 27 114.780 12.047 45.010 1.00328.82 C ANISOU10881 CA LYS L 27 39268 44040 41626 1852 -163 -2055 C ATOM 10882 C LYS L 27 114.359 12.350 43.573 1.00327.46 C ANISOU10882 C LYS L 27 39131 43817 41471 1733 -203 -2268 C ATOM 10883 O LYS L 27 115.006 13.147 42.879 1.00321.55 O ANISOU10883 O LYS L 27 38496 43068 40610 1653 -336 -2352 O ATOM 10884 CB LYS L 27 116.081 11.225 45.059 1.00314.38 C ANISOU10884 CB LYS L 27 37342 42079 40027 1774 -105 -1933 C ATOM 10885 CG LYS L 27 116.609 11.054 46.475 1.00303.98 C ANISOU10885 CG LYS L 27 35969 40884 38644 1843 -126 -1632 C ATOM 10886 CD LYS L 27 117.570 9.892 46.650 1.00299.08 C ANISOU10886 CD LYS L 27 35124 40086 38426 1768 -50 -1386 C ATOM 10887 CE LYS L 27 117.219 9.162 47.939 1.00296.64 C ANISOU10887 CE LYS L 27 34594 39939 38175 1796 -17 -968 C ATOM 10888 NZ LYS L 27 117.807 7.800 48.055 1.00294.25 N ANISOU10888 NZ LYS L 27 33950 39384 38467 1719 62 -644 N ATOM 10889 N THR L 28 113.256 11.718 43.163 1.00327.81 N ANISOU10889 N THR L 28 39051 43861 41640 1699 -100 -2318 N ATOM 10890 CA THR L 28 112.650 11.932 41.866 1.00323.74 C ANISOU10890 CA THR L 28 38519 43394 41093 1548 -145 -2482 C ATOM 10891 C THR L 28 112.135 13.364 41.765 1.00316.50 C ANISOU10891 C THR L 28 37730 42549 39975 1605 -361 -2455 C ATOM 10892 O THR L 28 111.261 13.797 42.507 1.00306.46 O ANISOU10892 O THR L 28 36464 41285 38691 1767 -383 -2411 O ATOM 10893 CB THR L 28 111.540 10.899 41.568 1.00326.76 C ANISOU10893 CB THR L 28 38715 43765 41674 1499 10 -2540 C ATOM 10894 OG1 THR L 28 112.027 9.575 41.838 1.00324.38 O ANISOU10894 OG1 THR L 28 38229 43311 41708 1474 203 -2534 O ATOM 10895 CG2 THR L 28 111.155 10.965 40.120 1.00332.17 C ANISOU10895 CG2 THR L 28 39342 44576 42290 1261 -27 -2731 C ATOM 10896 N LYS L 29 112.744 14.097 40.848 1.00312.96 N ANISOU10896 N LYS L 29 37342 42149 39419 1456 -518 -2479 N ATOM 10897 CA LYS L 29 112.396 15.474 40.581 1.00312.49 C ANISOU10897 CA LYS L 29 37333 42101 39297 1471 -763 -2394 C ATOM 10898 C LYS L 29 111.753 15.463 39.204 1.00322.98 C ANISOU10898 C LYS L 29 38541 43598 40578 1219 -845 -2367 C ATOM 10899 O LYS L 29 111.920 14.510 38.455 1.00337.69 O ANISOU10899 O LYS L 29 40316 45600 42389 1015 -707 -2495 O ATOM 10900 CB LYS L 29 113.662 16.337 40.556 1.00303.56 C ANISOU10900 CB LYS L 29 36313 40929 38095 1450 -919 -2349 C ATOM 10901 CG LYS L 29 114.682 16.039 41.655 1.00300.71 C ANISOU10901 CG LYS L 29 36048 40486 37720 1590 -819 -2382 C ATOM 10902 CD LYS L 29 114.610 17.024 42.810 1.00305.71 C ANISOU10902 CD LYS L 29 36751 41048 38355 1802 -917 -2396 C ATOM 10903 CE LYS L 29 115.835 16.948 43.725 1.00313.22 C ANISOU10903 CE LYS L 29 37788 41998 39221 1866 -888 -2394 C ATOM 10904 NZ LYS L 29 116.027 18.201 44.514 1.00317.50 N ANISOU10904 NZ LYS L 29 38384 42501 39748 1992 -1035 -2487 N ATOM 10905 N VAL L 30 111.009 16.505 38.862 1.00323.59 N ANISOU10905 N VAL L 30 38567 43678 40703 1208 -1071 -2208 N ATOM 10906 CA VAL L 30 110.444 16.614 37.524 1.00318.89 C ANISOU10906 CA VAL L 30 37821 43323 40020 915 -1208 -2086 C ATOM 10907 C VAL L 30 110.993 17.882 36.864 1.00325.87 C ANISOU10907 C VAL L 30 38671 44263 40880 768 -1521 -1825 C ATOM 10908 O VAL L 30 110.676 18.992 37.296 1.00333.97 O ANISOU10908 O VAL L 30 39672 45061 42161 929 -1721 -1658 O ATOM 10909 CB VAL L 30 108.900 16.623 37.553 1.00305.96 C ANISOU10909 CB VAL L 30 36057 41659 38534 975 -1234 -2011 C ATOM 10910 CG1 VAL L 30 108.356 16.355 36.166 1.00295.77 C ANISOU10910 CG1 VAL L 30 34588 40712 37080 614 -1324 -1917 C ATOM 10911 CG2 VAL L 30 108.368 15.583 38.528 1.00297.01 C ANISOU10911 CG2 VAL L 30 34956 40406 37489 1191 -950 -2207 C ATOM 10912 N SER L 31 111.834 17.717 35.840 1.00323.24 N ANISOU10912 N SER L 31 38299 44232 40285 452 -1554 -1806 N ATOM 10913 CA SER L 31 112.470 18.856 35.153 1.00317.64 C ANISOU10913 CA SER L 31 37525 43635 39527 263 -1859 -1494 C ATOM 10914 C SER L 31 111.429 19.823 34.574 1.00319.39 C ANISOU10914 C SER L 31 37530 43902 39920 149 -2185 -1083 C ATOM 10915 O SER L 31 110.279 19.432 34.377 1.00318.86 O ANISOU10915 O SER L 31 37354 43916 39881 114 -2153 -1074 O ATOM 10916 CB SER L 31 113.441 18.368 34.067 1.00313.00 C ANISOU10916 CB SER L 31 36880 43485 38559 -118 -1798 -1573 C ATOM 10917 OG SER L 31 112.761 17.773 32.974 1.00307.61 O ANISOU10917 OG SER L 31 35999 43261 37616 -475 -1765 -1606 O ATOM 10918 N GLY L 32 111.829 21.075 34.320 1.00323.08 N ANISOU10918 N GLY L 32 37901 44287 40567 91 -2509 -715 N ATOM 10919 CA GLY L 32 110.918 22.128 33.830 1.00333.68 C ANISOU10919 CA GLY L 32 38965 45578 42240 -6 -2873 -228 C ATOM 10920 C GLY L 32 110.099 21.734 32.609 1.00345.45 C ANISOU10920 C GLY L 32 40222 47586 43447 -412 -2972 20 C ATOM 10921 O GLY L 32 108.868 21.924 32.567 1.00350.68 O ANISOU10921 O GLY L 32 40711 48157 44371 -380 -3087 210 O ATOM 10922 N ASP L 33 110.778 21.170 31.618 1.00351.61 N ANISOU10922 N ASP L 33 40970 48941 43683 -814 -2915 -12 N ATOM 10923 CA ASP L 33 110.108 20.699 30.410 1.00355.53 C ANISOU10923 CA ASP L 33 41225 50071 43788 -1276 -2977 135 C ATOM 10924 C ASP L 33 109.344 19.402 30.544 1.00356.04 C ANISOU10924 C ASP L 33 41356 50224 43699 -1233 -2642 -339 C ATOM 10925 O ASP L 33 108.286 19.285 29.935 1.00357.07 O ANISOU10925 O ASP L 33 41274 50634 43759 -1453 -2755 -150 O ATOM 10926 CB ASP L 33 111.060 20.609 29.230 1.00353.15 C ANISOU10926 CB ASP L 33 40790 50467 42922 -1793 -3031 225 C ATOM 10927 CG ASP L 33 111.137 21.890 28.466 1.00352.89 C ANISOU10927 CG ASP L 33 40460 50667 42952 -2099 -3513 990 C ATOM 10928 OD1 ASP L 33 110.709 22.937 29.016 1.00352.33 O ANISOU10928 OD1 ASP L 33 40320 50043 43505 -1823 -3793 1397 O ATOM 10929 OD2 ASP L 33 111.706 21.881 27.360 1.00352.38 O ANISOU10929 OD2 ASP L 33 40202 51324 42361 -2616 -3607 1174 O ATOM 10930 N ALA L 34 109.874 18.435 31.305 1.00355.46 N ANISOU10930 N ALA L 34 41533 49919 43605 -977 -2255 -902 N ATOM 10931 CA ALA L 34 109.134 17.208 31.634 1.00357.61 C ANISOU10931 CA ALA L 34 41849 50134 43891 -866 -1937 -1325 C ATOM 10932 C ALA L 34 107.801 17.521 32.319 1.00366.09 C ANISOU10932 C ALA L 34 42903 50833 45360 -567 -2023 -1147 C ATOM 10933 O ALA L 34 106.810 16.826 32.063 1.00371.82 O ANISOU10933 O ALA L 34 43522 51703 46047 -654 -1930 -1253 O ATOM 10934 CB ALA L 34 109.962 16.281 32.503 1.00345.25 C ANISOU10934 CB ALA L 34 40506 48274 42398 -598 -1570 -1815 C ATOM 10935 N LEU L 35 107.788 18.563 33.172 1.00373.54 N ANISOU10935 N LEU L 35 43918 51306 46702 -233 -2187 -922 N ATOM 10936 CA LEU L 35 106.557 19.072 33.865 1.00374.01 C ANISOU10936 CA LEU L 35 43905 50980 47219 57 -2277 -775 C ATOM 10937 C LEU L 35 105.519 19.717 32.892 1.00378.14 C ANISOU10937 C LEU L 35 44101 51717 47856 -222 -2624 -273 C ATOM 10938 O LEU L 35 104.299 19.445 32.980 1.00405.25 O ANISOU10938 O LEU L 35 47424 55093 51459 -162 -2600 -253 O ATOM 10939 CB LEU L 35 106.906 20.021 35.053 1.00357.10 C ANISOU10939 CB LEU L 35 41872 48302 45505 461 -2323 -792 C ATOM 10940 CG LEU L 35 105.843 20.339 36.131 1.00342.00 C ANISOU10940 CG LEU L 35 39921 45965 44057 835 -2263 -893 C ATOM 10941 CD1 LEU L 35 105.399 19.066 36.840 1.00331.48 C ANISOU10941 CD1 LEU L 35 38734 44653 42557 1003 -1890 -1276 C ATOM 10942 CD2 LEU L 35 106.297 21.407 37.121 1.00332.45 C ANISOU10942 CD2 LEU L 35 38744 44324 43246 1136 -2331 -969 C ATOM 10943 N GLN L 36 106.019 20.545 31.968 1.00358.82 N ANISOU10943 N GLN L 36 41473 49540 45320 -549 -2956 175 N ATOM 10944 CA AGLN L 36 105.190 21.196 30.952 0.50346.07 C ANISOU10944 CA AGLN L 36 39487 48210 43792 -896 -3345 783 C ATOM 10945 CA BGLN L 36 105.188 21.195 30.953 0.50346.09 C ANISOU10945 CA BGLN L 36 39490 48212 43795 -896 -3344 782 C ATOM 10946 C GLN L 36 104.655 20.216 29.892 1.00341.43 C ANISOU10946 C GLN L 36 38766 48310 42649 -1343 -3280 732 C ATOM 10947 O GLN L 36 103.617 20.461 29.273 1.00337.92 O ANISOU10947 O GLN L 36 38030 48076 42287 -1570 -3529 1145 O ATOM 10948 CB AGLN L 36 105.973 22.343 30.313 0.50341.09 C ANISOU10948 CB AGLN L 36 38665 47704 43229 -1144 -3729 1338 C ATOM 10949 CB BGLN L 36 105.964 22.348 30.316 0.50341.16 C ANISOU10949 CB BGLN L 36 38672 47710 43242 -1142 -3731 1340 C ATOM 10950 CG AGLN L 36 105.819 23.670 31.034 0.50339.32 C ANISOU10950 CG AGLN L 36 38315 46784 43826 -807 -3986 1648 C ATOM 10951 CG BGLN L 36 105.749 23.683 31.004 0.50339.56 C ANISOU10951 CG BGLN L 36 38327 46819 43870 -816 -4000 1672 C ATOM 10952 CD AGLN L 36 104.600 24.434 30.556 0.50341.53 C ANISOU10952 CD AGLN L 36 38161 46977 44626 -936 -4370 2277 C ATOM 10953 CD BGLN L 36 104.491 24.370 30.516 0.50341.76 C ANISOU10953 CD BGLN L 36 38179 47034 44638 -950 -4366 2280 C ATOM 10954 OE1AGLN L 36 103.831 24.964 31.354 0.50341.83 O ANISOU10954 OE1AGLN L 36 38100 46397 45381 -570 -4395 2246 O ATOM 10955 OE1BGLN L 36 103.730 24.934 31.296 0.50342.11 O ANISOU10955 OE1BGLN L 36 38115 46458 45410 -590 -4405 2272 O ATOM 10956 NE2AGLN L 36 104.411 24.479 29.244 0.50343.58 N ANISOU10956 NE2AGLN L 36 38118 47896 44528 -1486 -4667 2846 N ATOM 10957 NE2BGLN L 36 104.259 24.308 29.212 0.50343.84 N ANISOU10957 NE2BGLN L 36 38159 47981 44501 -1499 -4633 2802 N ATOM 10958 N LEU L 37 105.363 19.105 29.696 1.00339.48 N ANISOU10958 N LEU L 37 38696 48402 41886 -1478 -2945 201 N ATOM 10959 CA LEU L 37 104.914 18.037 28.800 1.00340.52 C ANISOU10959 CA LEU L 37 38696 49154 41529 -1882 -2801 -45 C ATOM 10960 C LEU L 37 103.866 17.101 29.390 1.00333.46 C ANISOU10960 C LEU L 37 37873 47995 40831 -1628 -2535 -412 C ATOM 10961 O LEU L 37 103.006 16.636 28.655 1.00328.91 O ANISOU10961 O LEU L 37 37086 47835 40048 -1941 -2574 -386 O ATOM 10962 CB LEU L 37 106.086 17.223 28.268 1.00351.08 C ANISOU10962 CB LEU L 37 40103 50955 42333 -2167 -2536 -527 C ATOM 10963 CG LEU L 37 106.474 17.615 26.844 1.00363.90 C ANISOU10963 CG LEU L 37 41427 53439 43396 -2822 -2794 -192 C ATOM 10964 CD1 LEU L 37 107.885 17.161 26.557 1.00372.00 C ANISOU10964 CD1 LEU L 37 42543 54764 44033 -3000 -2549 -633 C ATOM 10965 CD2 LEU L 37 105.496 17.071 25.809 1.00369.58 C ANISOU10965 CD2 LEU L 37 41841 54862 43719 -3318 -2848 -182 C ATOM 10966 N MET L 38 103.938 16.800 30.690 1.00329.68 N ANISOU10966 N MET L 38 37660 46886 40714 -1104 -2272 -738 N ATOM 10967 CA MET L 38 102.873 16.009 31.342 1.00323.92 C ANISOU10967 CA MET L 38 36966 45885 40223 -846 -2049 -989 C ATOM 10968 C MET L 38 101.564 16.803 31.423 1.00324.71 C ANISOU10968 C MET L 38 36876 45795 40701 -753 -2323 -535 C ATOM 10969 O MET L 38 100.491 16.208 31.493 1.00327.13 O ANISOU10969 O MET L 38 37102 46087 41103 -719 -2229 -622 O ATOM 10970 CB MET L 38 103.278 15.484 32.731 1.00315.62 C ANISOU10970 CB MET L 38 36195 44304 39422 -360 -1716 -1379 C ATOM 10971 CG MET L 38 103.867 14.077 32.770 1.00304.83 C ANISOU10971 CG MET L 38 34912 43032 37874 -412 -1343 -1910 C ATOM 10972 SD MET L 38 102.726 12.687 32.609 1.00291.89 S ANISOU10972 SD MET L 38 33125 41482 36296 -490 -1098 -2226 S ATOM 10973 CE MET L 38 101.553 12.998 33.932 1.00286.52 C ANISOU10973 CE MET L 38 32513 40275 36074 4 -1091 -2021 C ATOM 10974 N VAL L 39 101.676 18.136 31.410 1.00320.32 N ANISOU10974 N VAL L 39 36216 45061 40429 -713 -2661 -53 N ATOM 10975 CA VAL L 39 100.557 19.057 31.168 1.00312.79 C ANISOU10975 CA VAL L 39 34960 43984 39902 -744 -3012 494 C ATOM 10976 C VAL L 39 99.847 18.667 29.867 1.00309.67 C ANISOU10976 C VAL L 39 34280 44244 39135 -1271 -3191 763 C ATOM 10977 O VAL L 39 98.624 18.542 29.844 1.00308.60 O ANISOU10977 O VAL L 39 33976 44051 39227 -1252 -3249 901 O ATOM 10978 CB VAL L 39 101.049 20.538 31.127 1.00314.26 C ANISOU10978 CB VAL L 39 34997 43924 40480 -721 -3383 1000 C ATOM 10979 CG1 VAL L 39 100.117 21.453 30.334 1.00314.12 C ANISOU10979 CG1 VAL L 39 34533 43995 40822 -983 -3849 1740 C ATOM 10980 CG2 VAL L 39 101.266 21.080 32.534 1.00316.89 C ANISOU10980 CG2 VAL L 39 35507 43537 41357 -167 -3239 733 C ATOM 10981 N GLU L 40 100.627 18.463 28.801 1.00305.97 N ANISOU10981 N GLU L 40 33742 44442 38070 -1761 -3266 808 N ATOM 10982 CA GLU L 40 100.114 18.002 27.508 1.00306.79 C ANISOU10982 CA GLU L 40 33559 45342 37661 -2354 -3400 963 C ATOM 10983 C GLU L 40 99.514 16.585 27.550 1.00302.04 C ANISOU10983 C GLU L 40 33033 44884 36844 -2366 -3030 347 C ATOM 10984 O GLU L 40 98.443 16.370 26.990 1.00308.07 O ANISOU10984 O GLU L 40 33553 45950 37549 -2616 -3161 532 O ATOM 10985 CB GLU L 40 101.193 18.108 26.416 1.00309.63 C ANISOU10985 CB GLU L 40 33807 46459 37378 -2900 -3517 1064 C ATOM 10986 CG GLU L 40 101.834 19.488 26.297 1.00313.91 C ANISOU10986 CG GLU L 40 34233 46892 38145 -2933 -3906 1730 C ATOM 10987 CD GLU L 40 100.941 20.518 25.609 1.00320.12 C ANISOU10987 CD GLU L 40 34568 47865 39197 -3229 -4450 2661 C ATOM 10988 OE1 GLU L 40 101.257 21.727 25.671 1.00326.85 O ANISOU10988 OE1 GLU L 40 35266 48427 40495 -3171 -4800 3272 O ATOM 10989 OE2 GLU L 40 99.935 20.132 24.972 1.00320.49 O ANISOU10989 OE2 GLU L 40 34370 48351 39048 -3547 -4553 2820 O ATOM 10990 N LEU L 41 100.183 15.637 28.217 1.00291.67 N ANISOU10990 N LEU L 41 32015 43328 35478 -2105 -2594 -338 N ATOM 10991 CA LEU L 41 99.729 14.232 28.280 1.00284.39 C ANISOU10991 CA LEU L 41 31121 42473 34459 -2114 -2231 -939 C ATOM 10992 C LEU L 41 98.375 14.081 28.957 1.00281.06 C ANISOU10992 C LEU L 41 30676 41616 34494 -1791 -2210 -845 C ATOM 10993 O LEU L 41 97.484 13.419 28.427 1.00278.59 O ANISOU10993 O LEU L 41 30179 41605 34066 -2032 -2186 -945 O ATOM 10994 CB LEU L 41 100.774 13.326 28.952 1.00279.48 C ANISOU10994 CB LEU L 41 30763 41573 33852 -1868 -1805 -1585 C ATOM 10995 CG LEU L 41 100.495 11.820 29.111 1.00277.40 C ANISOU10995 CG LEU L 41 30491 41260 33648 -1845 -1408 -2224 C ATOM 10996 CD1 LEU L 41 100.079 11.138 27.813 1.00279.67 C ANISOU10996 CD1 LEU L 41 30470 42277 33513 -2433 -1400 -2483 C ATOM 10997 CD2 LEU L 41 101.703 11.115 29.679 1.00275.18 C ANISOU10997 CD2 LEU L 41 30395 40705 33455 -1651 -1066 -2719 C ATOM 10998 N LEU L 42 98.229 14.700 30.123 1.00279.34 N ANISOU10998 N LEU L 42 30623 40728 34783 -1268 -2210 -687 N ATOM 10999 CA LEU L 42 96.967 14.692 30.840 1.00279.85 C ANISOU10999 CA LEU L 42 30644 40379 35305 -946 -2185 -590 C ATOM 11000 C LEU L 42 95.862 15.416 30.065 1.00284.60 C ANISOU11000 C LEU L 42 30907 41200 36027 -1209 -2580 -8 C ATOM 11001 O LEU L 42 94.741 14.942 30.031 1.00280.40 O ANISOU11001 O LEU L 42 30243 40672 35622 -1217 -2548 -13 O ATOM 11002 CB LEU L 42 97.137 15.254 32.260 1.00278.66 C ANISOU11002 CB LEU L 42 30700 39555 35624 -377 -2076 -620 C ATOM 11003 CG LEU L 42 97.842 14.352 33.298 1.00273.55 C ANISOU11003 CG LEU L 42 30342 38640 34955 -58 -1662 -1140 C ATOM 11004 CD1 LEU L 42 98.167 15.082 34.603 1.00270.15 C ANISOU11004 CD1 LEU L 42 30079 37706 34858 403 -1604 -1143 C ATOM 11005 CD2 LEU L 42 97.039 13.089 33.590 1.00272.72 C ANISOU11005 CD2 LEU L 42 30210 38501 34909 9 -1381 -1440 C ATOM 11006 N LYS L 43 96.195 16.542 29.435 1.00293.74 N ANISOU11006 N LYS L 43 31893 42541 37174 -1442 -2967 530 N ATOM 11007 CA LYS L 43 95.269 17.296 28.576 1.00307.10 C ANISOU11007 CA LYS L 43 33186 44498 38998 -1772 -3414 1221 C ATOM 11008 C LYS L 43 94.706 16.397 27.482 1.00311.79 C ANISOU11008 C LYS L 43 33582 45834 39049 -2301 -3428 1147 C ATOM 11009 O LYS L 43 93.490 16.317 27.296 1.00308.96 O ANISOU11009 O LYS L 43 33000 45501 38890 -2368 -3556 1383 O ATOM 11010 CB LYS L 43 95.989 18.538 28.005 1.00319.71 C ANISOU11010 CB LYS L 43 34607 46246 40620 -2005 -3822 1828 C ATOM 11011 CG LYS L 43 95.258 19.453 27.016 1.00339.45 C ANISOU11011 CG LYS L 43 36618 49076 43280 -2425 -4370 2715 C ATOM 11012 CD LYS L 43 95.990 20.786 26.870 1.00352.96 C ANISOU11012 CD LYS L 43 38167 50632 45309 -2467 -4740 3317 C ATOM 11013 CE LYS L 43 95.607 21.555 25.602 1.00365.10 C ANISOU11013 CE LYS L 43 39171 52759 46792 -3072 -5318 4284 C ATOM 11014 NZ LYS L 43 94.422 22.454 25.736 1.00373.69 N ANISOU11014 NZ LYS L 43 39849 53349 48788 -2941 -5688 4969 N ATOM 11015 N VAL L 44 95.603 15.698 26.792 1.00321.32 N ANISOU11015 N VAL L 44 34853 47641 39593 -2678 -3273 758 N ATOM 11016 CA VAL L 44 95.222 14.822 25.691 1.00336.78 C ANISOU11016 CA VAL L 44 36588 50403 40969 -3250 -3251 552 C ATOM 11017 C VAL L 44 94.452 13.626 26.230 1.00339.19 C ANISOU11017 C VAL L 44 36994 50426 41456 -3008 -2886 -23 C ATOM 11018 O VAL L 44 93.489 13.172 25.614 1.00343.54 O ANISOU11018 O VAL L 44 37300 51363 41864 -3320 -2962 5 O ATOM 11019 CB VAL L 44 96.437 14.333 24.871 1.00342.47 C ANISOU11019 CB VAL L 44 37317 51830 40976 -3710 -3108 132 C ATOM 11020 CG1 VAL L 44 95.990 13.353 23.796 1.00350.26 C ANISOU11020 CG1 VAL L 44 38035 53660 41385 -4309 -3027 -240 C ATOM 11021 CG2 VAL L 44 97.161 15.499 24.217 1.00349.34 C ANISOU11021 CG2 VAL L 44 38030 53097 41603 -4032 -3500 775 C ATOM 11022 N PHE L 45 94.869 13.121 27.383 1.00341.91 N ANISOU11022 N PHE L 45 37668 50116 42123 -2475 -2508 -503 N ATOM 11023 CA PHE L 45 94.160 12.012 27.987 1.00355.59 C ANISOU11023 CA PHE L 45 39468 51533 44107 -2223 -2177 -963 C ATOM 11024 C PHE L 45 92.708 12.376 28.323 1.00358.86 C ANISOU11024 C PHE L 45 39736 51649 44963 -2029 -2352 -542 C ATOM 11025 O PHE L 45 91.798 11.622 27.971 1.00364.32 O ANISOU11025 O PHE L 45 40261 52541 45620 -2206 -2298 -687 O ATOM 11026 CB PHE L 45 94.900 11.481 29.210 1.00363.57 C ANISOU11026 CB PHE L 45 40809 51932 45399 -1711 -1787 -1417 C ATOM 11027 CG PHE L 45 94.122 10.459 29.978 1.00381.05 C ANISOU11027 CG PHE L 45 43057 53757 47966 -1412 -1487 -1739 C ATOM 11028 CD1 PHE L 45 93.969 9.168 29.490 1.00386.93 C ANISOU11028 CD1 PHE L 45 43670 54754 48590 -1669 -1251 -2252 C ATOM 11029 CD2 PHE L 45 93.513 10.791 31.178 1.00386.92 C ANISOU11029 CD2 PHE L 45 43914 53904 49190 -900 -1438 -1541 C ATOM 11030 CE1 PHE L 45 93.240 8.219 30.193 1.00395.18 C ANISOU11030 CE1 PHE L 45 44704 55417 50027 -1404 -996 -2489 C ATOM 11031 CE2 PHE L 45 92.782 9.849 31.891 1.00393.12 C ANISOU11031 CE2 PHE L 45 44699 54387 50280 -652 -1172 -1775 C ATOM 11032 CZ PHE L 45 92.642 8.559 31.397 1.00396.48 C ANISOU11032 CZ PHE L 45 44998 55024 50623 -898 -965 -2209 C ATOM 11033 N VAL L 46 92.499 13.522 28.985 1.00356.52 N ANISOU11033 N VAL L 46 39469 50870 45121 -1680 -2553 -63 N ATOM 11034 CA VAL L 46 91.143 13.990 29.362 1.00356.58 C ANISOU11034 CA VAL L 46 39295 50529 45657 -1466 -2713 329 C ATOM 11035 C VAL L 46 90.284 14.339 28.144 1.00362.04 C ANISOU11035 C VAL L 46 39587 51765 46204 -1983 -3126 871 C ATOM 11036 O VAL L 46 89.121 13.932 28.076 1.00360.35 O ANISOU11036 O VAL L 46 39204 51551 46159 -2009 -3137 925 O ATOM 11037 CB VAL L 46 91.144 15.188 30.345 1.00351.98 C ANISOU11037 CB VAL L 46 38763 49287 45685 -990 -2814 630 C ATOM 11038 CG1 VAL L 46 89.715 15.587 30.690 1.00353.65 C ANISOU11038 CG1 VAL L 46 38731 49151 46488 -793 -2938 949 C ATOM 11039 CG2 VAL L 46 91.901 14.847 31.621 1.00343.79 C ANISOU11039 CG2 VAL L 46 38089 47785 44749 -506 -2416 119 C ATOM 11040 N VAL L 47 90.855 15.091 27.199 1.00364.46 N ANISOU11040 N VAL L 47 39719 52561 46197 -2410 -3478 1314 N ATOM 11041 CA VAL L 47 90.192 15.379 25.915 1.00368.22 C ANISOU11041 CA VAL L 47 39769 53742 46393 -3025 -3905 1891 C ATOM 11042 C VAL L 47 89.826 14.076 25.175 1.00374.31 C ANISOU11042 C VAL L 47 40462 55176 46582 -3455 -3719 1400 C ATOM 11043 O VAL L 47 88.708 13.965 24.676 1.00373.67 O ANISOU11043 O VAL L 47 40088 55359 46530 -3707 -3919 1692 O ATOM 11044 CB VAL L 47 91.008 16.358 25.020 1.00366.22 C ANISOU11044 CB VAL L 47 39316 54003 45826 -3468 -4309 2477 C ATOM 11045 CG1 VAL L 47 90.505 16.362 23.581 1.00369.05 C ANISOU11045 CG1 VAL L 47 39229 55356 45637 -4243 -4693 2970 C ATOM 11046 CG2 VAL L 47 90.956 17.767 25.588 1.00363.11 C ANISOU11046 CG2 VAL L 47 38819 52931 46213 -3113 -4613 3130 C ATOM 11047 N GLU L 48 90.736 13.090 25.138 1.00379.38 N ANISOU11047 N GLU L 48 41332 56038 46777 -3527 -3332 634 N ATOM 11048 CA GLU L 48 90.445 11.756 24.532 1.00384.28 C ANISOU11048 CA GLU L 48 41851 57184 46972 -3895 -3084 -1 C ATOM 11049 C GLU L 48 89.446 10.872 25.325 1.00380.42 C ANISOU11049 C GLU L 48 41439 56139 46965 -3500 -2800 -352 C ATOM 11050 O GLU L 48 88.618 10.178 24.714 1.00394.69 O ANISOU11050 O GLU L 48 43009 58351 48603 -3839 -2807 -510 O ATOM 11051 CB GLU L 48 91.730 10.966 24.187 1.00383.48 C ANISOU11051 CB GLU L 48 41877 57464 46360 -4126 -2751 -753 C ATOM 11052 CG GLU L 48 92.473 11.425 22.916 1.00386.01 C ANISOU11052 CG GLU L 48 41965 58768 45932 -4818 -3006 -561 C ATOM 11053 CD GLU L 48 91.794 11.037 21.591 1.00388.38 C ANISOU11053 CD GLU L 48 41833 60117 45615 -5591 -3191 -561 C ATOM 11054 OE1 GLU L 48 91.464 9.841 21.382 1.00388.18 O ANISOU11054 OE1 GLU L 48 41731 60288 45470 -5752 -2881 -1303 O ATOM 11055 OE2 GLU L 48 91.608 11.938 20.734 1.00388.14 O ANISOU11055 OE2 GLU L 48 41497 60753 45223 -6075 -3662 199 O ATOM 11056 N ALA L 49 89.525 10.889 26.661 1.00364.90 N ANISOU11056 N ALA L 49 39771 53308 45565 -2826 -2556 -470 N ATOM 11057 CA ALA L 49 88.510 10.241 27.512 1.00353.09 C ANISOU11057 CA ALA L 49 38314 51276 44568 -2429 -2334 -641 C ATOM 11058 C ALA L 49 87.113 10.852 27.303 1.00353.90 C ANISOU11058 C ALA L 49 38135 51368 44961 -2480 -2673 -21 C ATOM 11059 O ALA L 49 86.139 10.112 27.157 1.00359.43 O ANISOU11059 O ALA L 49 38683 52142 45741 -2570 -2607 -158 O ATOM 11060 CB ALA L 49 88.910 10.282 28.983 1.00344.22 C ANISOU11060 CB ALA L 49 37518 49357 43910 -1758 -2044 -803 C ATOM 11061 N ALA L 50 87.036 12.192 27.267 1.00350.71 N ANISOU11061 N ALA L 50 37625 50851 44777 -2435 -3043 662 N ATOM 11062 CA ALA L 50 85.786 12.957 27.017 1.00354.61 C ANISOU11062 CA ALA L 50 37778 51293 45665 -2500 -3427 1359 C ATOM 11063 C ALA L 50 85.231 12.849 25.572 1.00363.69 C ANISOU11063 C ALA L 50 38532 53319 46331 -3228 -3786 1708 C ATOM 11064 O ALA L 50 84.027 12.589 25.383 1.00375.63 O ANISOU11064 O ALA L 50 39808 54880 48034 -3321 -3891 1890 O ATOM 11065 CB ALA L 50 85.955 14.423 27.428 1.00348.18 C ANISOU11065 CB ALA L 50 36902 50021 45369 -2234 -3709 1959 C ATOM 11066 N VAL L 51 86.101 13.049 24.570 1.00362.43 N ANISOU11066 N VAL L 51 38282 53898 45526 -3764 -3974 1804 N ATOM 11067 CA VAL L 51 85.739 12.915 23.135 1.00365.69 C ANISOU11067 CA VAL L 51 38294 55347 45302 -4563 -4304 2088 C ATOM 11068 C VAL L 51 85.247 11.492 22.764 1.00375.21 C ANISOU11068 C VAL L 51 39457 56962 46141 -4829 -4011 1366 C ATOM 11069 O VAL L 51 84.202 11.347 22.108 1.00378.13 O ANISOU11069 O VAL L 51 39488 57770 46413 -5208 -4252 1653 O ATOM 11070 CB VAL L 51 86.860 13.443 22.186 1.00360.84 C ANISOU11070 CB VAL L 51 37573 55513 44016 -5104 -4537 2320 C ATOM 11071 CG1 VAL L 51 86.637 13.013 20.745 1.00361.37 C ANISOU11071 CG1 VAL L 51 37250 56819 43234 -5989 -4750 2357 C ATOM 11072 CG2 VAL L 51 86.950 14.963 22.257 1.00358.51 C ANISOU11072 CG2 VAL L 51 37111 54931 44172 -5005 -5000 3298 C ATOM 11073 N ARG L 52 85.970 10.457 23.209 1.00381.93 N ANISOU11073 N ARG L 52 40613 57626 46876 -4625 -3507 455 N ATOM 11074 CA ARG L 52 85.522 9.058 23.010 1.00384.02 C ANISOU11074 CA ARG L 52 40816 58091 47000 -4792 -3185 -301 C ATOM 11075 C ARG L 52 84.231 8.658 23.800 1.00378.65 C ANISOU11075 C ARG L 52 40137 56747 46986 -4356 -3085 -253 C ATOM 11076 O ARG L 52 83.473 7.778 23.361 1.00382.45 O ANISOU11076 O ARG L 52 40411 57530 47372 -4634 -3014 -574 O ATOM 11077 CB ARG L 52 86.677 8.049 23.179 1.00380.76 C ANISOU11077 CB ARG L 52 40630 57654 46387 -4746 -2699 -1259 C ATOM 11078 CG ARG L 52 87.700 8.116 22.051 1.00376.34 C ANISOU11078 CG ARG L 52 39925 58037 45027 -5396 -2767 -1482 C ATOM 11079 CD ARG L 52 88.498 6.834 21.864 1.00366.93 C ANISOU11079 CD ARG L 52 38760 57025 43631 -5557 -2285 -2579 C ATOM 11080 NE ARG L 52 89.695 7.098 21.059 1.00362.90 N ANISOU11080 NE ARG L 52 38185 57250 42449 -6028 -2305 -2768 N ATOM 11081 CZ ARG L 52 90.644 6.209 20.762 1.00359.70 C ANISOU11081 CZ ARG L 52 37755 57098 41813 -6239 -1915 -3696 C ATOM 11082 NH1 ARG L 52 90.562 4.954 21.192 1.00356.11 N ANISOU11082 NH1 ARG L 52 37313 56179 41812 -6023 -1479 -4525 N ATOM 11083 NH2 ARG L 52 91.685 6.583 20.023 1.00359.12 N ANISOU11083 NH2 ARG L 52 37603 57740 41106 -6680 -1963 -3784 N ATOM 11084 N GLY L 53 83.969 9.318 24.934 1.00366.21 N ANISOU11084 N GLY L 53 38755 54317 46071 -3709 -3078 124 N ATOM 11085 CA GLY L 53 82.670 9.207 25.638 1.00344.38 C ANISOU11085 CA GLY L 53 35926 50992 43931 -3331 -3053 326 C ATOM 11086 C GLY L 53 81.485 9.730 24.825 1.00336.96 C ANISOU11086 C GLY L 53 34569 50455 43005 -3721 -3513 1006 C ATOM 11087 O GLY L 53 80.467 9.034 24.690 1.00325.86 O ANISOU11087 O GLY L 53 32991 49113 41708 -3817 -3474 889 O ATOM 11088 N VAL L 54 81.629 10.946 24.278 1.00338.80 N ANISOU11088 N VAL L 54 34606 50955 43164 -3962 -3966 1754 N ATOM 11089 CA VAL L 54 80.653 11.534 23.331 1.00344.47 C ANISOU11089 CA VAL L 54 34850 52189 43844 -4453 -4492 2542 C ATOM 11090 C VAL L 54 80.486 10.693 22.062 1.00352.07 C ANISOU11090 C VAL L 54 35550 54218 44001 -5231 -4574 2276 C ATOM 11091 O VAL L 54 79.368 10.516 21.609 1.00364.69 O ANISOU11091 O VAL L 54 36830 56087 45647 -5503 -4788 2560 O ATOM 11092 CB VAL L 54 80.954 13.020 22.965 1.00344.50 C ANISOU11092 CB VAL L 54 34631 52274 43989 -4598 -4994 3474 C ATOM 11093 CG1 VAL L 54 80.359 13.407 21.605 1.00350.60 C ANISOU11093 CG1 VAL L 54 34865 53983 44364 -5382 -5559 4241 C ATOM 11094 CG2 VAL L 54 80.438 13.952 24.052 1.00340.59 C ANISOU11094 CG2 VAL L 54 34146 50745 44518 -3927 -5045 3904 C ATOM 11095 N ARG L 55 81.575 10.175 21.495 1.00349.67 N ANISOU11095 N ARG L 55 35349 54535 42973 -5604 -4394 1695 N ATOM 11096 CA ARG L 55 81.473 9.316 20.298 1.00350.11 C ANISOU11096 CA ARG L 55 35123 55668 42235 -6379 -4407 1264 C ATOM 11097 C ARG L 55 80.764 7.975 20.585 1.00347.57 C ANISOU11097 C ARG L 55 34829 55119 42112 -6254 -4025 485 C ATOM 11098 O ARG L 55 80.172 7.371 19.677 1.00354.16 O ANISOU11098 O ARG L 55 35330 56722 42509 -6851 -4119 284 O ATOM 11099 CB ARG L 55 82.841 9.044 19.662 1.00346.31 C ANISOU11099 CB ARG L 55 34709 55889 40982 -6799 -4242 703 C ATOM 11100 CG ARG L 55 83.653 10.259 19.241 1.00339.59 C ANISOU11100 CG ARG L 55 33795 55407 39827 -7025 -4608 1420 C ATOM 11101 CD ARG L 55 84.822 9.806 18.385 1.00333.51 C ANISOU11101 CD ARG L 55 32985 55577 38155 -7608 -4440 788 C ATOM 11102 NE ARG L 55 86.090 10.404 18.781 1.00319.96 N ANISOU11102 NE ARG L 55 31556 53555 36458 -7330 -4359 829 N ATOM 11103 CZ ARG L 55 87.222 9.723 18.934 1.00311.57 C ANISOU11103 CZ ARG L 55 30746 52480 35156 -7258 -3909 -65 C ATOM 11104 NH1 ARG L 55 87.260 8.415 18.711 1.00308.97 N ANISOU11104 NH1 ARG L 55 30385 52402 34607 -7448 -3492 -1099 N ATOM 11105 NH2 ARG L 55 88.319 10.363 19.293 1.00305.04 N ANISOU11105 NH2 ARG L 55 30160 51372 34368 -7009 -3887 77 N ATOM 11106 N GLN L 56 80.828 7.506 21.831 1.00335.99 N ANISOU11106 N GLN L 56 33721 52644 41296 -5516 -3608 64 N ATOM 11107 CA GLN L 56 80.076 6.316 22.199 1.00329.34 C ANISOU11107 CA GLN L 56 32868 51483 40783 -5349 -3287 -522 C ATOM 11108 C GLN L 56 78.605 6.624 22.448 1.00340.01 C ANISOU11108 C GLN L 56 34024 52521 42642 -5183 -3534 105 C ATOM 11109 O GLN L 56 77.749 5.873 21.978 1.00342.19 O ANISOU11109 O GLN L 56 34047 53116 42851 -5493 -3540 -116 O ATOM 11110 CB GLN L 56 80.686 5.564 23.373 1.00312.38 C ANISOU11110 CB GLN L 56 31098 48485 39105 -4712 -2756 -1182 C ATOM 11111 CG GLN L 56 80.099 4.160 23.530 1.00301.26 C ANISOU11111 CG GLN L 56 29595 46898 37971 -4690 -2418 -1878 C ATOM 11112 CD GLN L 56 80.321 3.240 22.322 1.00299.34 C ANISOU11112 CD GLN L 56 29052 47532 37148 -5421 -2341 -2617 C ATOM 11113 OE1 GLN L 56 81.307 3.354 21.596 1.00298.98 O ANISOU11113 OE1 GLN L 56 28973 48121 36504 -5842 -2347 -2904 O ATOM 11114 NE2 GLN L 56 79.395 2.302 22.119 1.00295.36 N ANISOU11114 NE2 GLN L 56 28303 47077 36841 -5583 -2246 -2980 N ATOM 11115 N ALA L 57 78.314 7.719 23.161 1.00354.33 N ANISOU11115 N ALA L 57 35918 53718 44991 -4716 -3730 842 N ATOM 11116 CA ALA L 57 76.924 8.214 23.323 1.00381.68 C ANISOU11116 CA ALA L 57 39125 56901 48993 -4588 -4018 1533 C ATOM 11117 C ALA L 57 76.224 8.544 21.982 1.00413.59 C ANISOU11117 C ALA L 57 42675 61867 52601 -5352 -4544 2120 C ATOM 11118 O ALA L 57 75.049 8.199 21.801 1.00420.00 O ANISOU11118 O ALA L 57 43230 62734 53616 -5472 -4656 2275 O ATOM 11119 CB ALA L 57 76.851 9.386 24.309 1.00375.89 C ANISOU11119 CB ALA L 57 38509 55341 48969 -3972 -4108 2122 C ATOM 11120 N GLN L 58 76.957 9.184 21.054 1.00441.83 N ANISOU11120 N GLN L 58 46103 66208 55563 -5890 -4867 2463 N ATOM 11121 CA GLN L 58 76.554 9.374 19.620 1.00468.90 C ANISOU11121 CA GLN L 58 49035 70805 58319 -6788 -5357 2950 C ATOM 11122 C GLN L 58 76.165 8.040 18.892 1.00492.44 C ANISOU11122 C GLN L 58 51846 74528 60727 -7326 -5171 2169 C ATOM 11123 O GLN L 58 75.136 7.990 18.185 1.00505.75 O ANISOU11123 O GLN L 58 53122 76768 62272 -7802 -5506 2567 O ATOM 11124 CB GLN L 58 77.653 10.137 18.792 1.00460.99 C ANISOU11124 CB GLN L 58 47932 70590 56632 -7302 -5645 3311 C ATOM 11125 CG GLN L 58 77.775 11.669 18.971 1.00447.38 C ANISOU11125 CG GLN L 58 46090 68505 55387 -7115 -6094 4420 C ATOM 11126 CD GLN L 58 79.006 12.292 18.298 1.00438.53 C ANISOU11126 CD GLN L 58 44931 68067 53623 -7546 -6291 4661 C ATOM 11127 OE1 GLN L 58 79.925 11.592 17.862 1.00432.02 O ANISOU11127 OE1 GLN L 58 44255 67878 52015 -7876 -6008 3892 O ATOM 11128 NE2 GLN L 58 79.024 13.618 18.227 1.00434.49 N ANISOU11128 NE2 GLN L 58 44181 67390 53514 -7538 -6772 5730 N ATOM 11129 N ALA L 59 76.985 6.987 19.082 1.00506.00 N ANISOU11129 N ALA L 59 53842 76222 62192 -7250 -4647 1068 N ATOM 11130 CA ALA L 59 76.870 5.663 18.400 1.00519.30 C ANISOU11130 CA ALA L 59 55351 78569 63387 -7762 -4391 113 C ATOM 11131 C ALA L 59 75.551 4.916 18.667 1.00521.75 C ANISOU11131 C ALA L 59 55520 78529 64192 -7620 -4317 -25 C ATOM 11132 O ALA L 59 74.914 4.409 17.741 1.00537.47 O ANISOU11132 O ALA L 59 57129 81339 65745 -8269 -4469 -195 O ATOM 11133 CB ALA L 59 78.079 4.773 18.724 1.00514.27 C ANISOU11133 CB ALA L 59 55021 77731 62645 -7583 -3827 -996 C ATOM 11134 N GLU L 60 75.141 4.870 19.931 1.00505.37 N ANISOU11134 N GLU L 60 53727 75286 63001 -6801 -4090 56 N ATOM 11135 CA GLU L 60 73.895 4.207 20.335 1.00486.63 C ANISOU11135 CA GLU L 60 51241 72467 61187 -6578 -3999 -16 C ATOM 11136 C GLU L 60 72.690 5.187 20.416 1.00470.87 C ANISOU11136 C GLU L 60 49015 70275 59616 -6477 -4465 1082 C ATOM 11137 O GLU L 60 71.638 4.853 20.979 1.00465.43 O ANISOU11137 O GLU L 60 48275 69031 59535 -6142 -4391 1166 O ATOM 11138 CB GLU L 60 74.122 3.415 21.649 1.00479.83 C ANISOU11138 CB GLU L 60 50754 70538 61018 -5809 -3443 -631 C ATOM 11139 CG GLU L 60 74.938 4.152 22.725 1.00465.31 C ANISOU11139 CG GLU L 60 49328 67934 59534 -5134 -3295 -390 C ATOM 11140 CD GLU L 60 75.703 3.236 23.686 1.00454.20 C ANISOU11140 CD GLU L 60 48256 65861 58456 -4637 -2740 -1163 C ATOM 11141 OE1 GLU L 60 75.179 2.982 24.794 1.00450.66 O ANISOU11141 OE1 GLU L 60 47944 64608 58676 -4043 -2518 -1109 O ATOM 11142 OE2 GLU L 60 76.828 2.787 23.350 1.00445.86 O ANISOU11142 OE2 GLU L 60 47293 65100 57011 -4852 -2531 -1788 O ATOM 11143 N ASP L 61 72.852 6.367 19.804 1.00455.05 N ANISOU11143 N ASP L 61 46822 68755 57320 -6808 -4950 1927 N ATOM 11144 CA ASP L 61 71.932 7.525 19.913 1.00439.61 C ANISOU11144 CA ASP L 61 44614 66513 55905 -6676 -5427 3072 C ATOM 11145 C ASP L 61 71.320 7.758 21.292 1.00430.57 C ANISOU11145 C ASP L 61 43677 64118 55800 -5789 -5208 3230 C ATOM 11146 O ASP L 61 70.112 7.568 21.485 1.00428.61 O ANISOU11146 O ASP L 61 43223 63595 56032 -5675 -5276 3463 O ATOM 11147 CB ASP L 61 70.815 7.506 18.850 1.00439.14 C ANISOU11147 CB ASP L 61 44011 67269 55573 -7374 -5898 3600 C ATOM 11148 CG ASP L 61 70.036 8.826 18.788 1.00437.11 C ANISOU11148 CG ASP L 61 43401 66810 55870 -7346 -6469 4894 C ATOM 11149 OD1 ASP L 61 70.700 9.888 18.736 1.00434.62 O ANISOU11149 OD1 ASP L 61 43073 66471 55589 -7328 -6720 5488 O ATOM 11150 OD2 ASP L 61 68.778 8.783 18.782 1.00435.72 O ANISOU11150 OD2 ASP L 61 42928 66479 56147 -7350 -6665 5306 O ATOM 11151 N ALA L 62 72.159 8.167 22.240 1.00422.36 N ANISOU11151 N ALA L 62 43021 62379 55076 -5193 -4941 3083 N ATOM 11152 CA ALA L 62 71.682 8.654 23.536 1.00416.74 C ANISOU11152 CA ALA L 62 42455 60590 55295 -4402 -4776 3308 C ATOM 11153 C ALA L 62 71.386 10.144 23.402 1.00421.29 C ANISOU11153 C ALA L 62 42737 61008 56326 -4392 -5268 4327 C ATOM 11154 O ALA L 62 72.023 10.842 22.595 1.00427.20 O ANISOU11154 O ALA L 62 43341 62316 56660 -4832 -5630 4770 O ATOM 11155 CB ALA L 62 72.711 8.408 24.634 1.00404.40 C ANISOU11155 CB ALA L 62 41394 58409 53849 -3808 -4268 2671 C ATOM 11156 N LEU L 63 70.402 10.624 24.162 1.00420.30 N ANISOU11156 N LEU L 63 42467 60133 57093 -3918 -5289 4710 N ATOM 11157 CA LEU L 63 70.067 12.054 24.157 1.00418.80 C ANISOU11157 CA LEU L 63 41933 59610 57581 -3831 -5724 5638 C ATOM 11158 C LEU L 63 70.680 12.778 25.388 1.00409.94 C ANISOU11158 C LEU L 63 41093 57589 57075 -3112 -5437 5463 C ATOM 11159 O LEU L 63 70.510 13.979 25.566 1.00422.92 O ANISOU11159 O LEU L 63 42464 58793 59431 -2939 -5715 6088 O ATOM 11160 CB LEU L 63 68.554 12.305 23.902 1.00419.21 C ANISOU11160 CB LEU L 63 41472 59560 58250 -3943 -6067 6316 C ATOM 11161 CG LEU L 63 67.973 11.809 22.547 1.00417.01 C ANISOU11161 CG LEU L 63 40821 60294 57329 -4766 -6471 6649 C ATOM 11162 CD1 LEU L 63 66.452 11.967 22.467 1.00415.79 C ANISOU11162 CD1 LEU L 63 40193 59928 57860 -4789 -6749 7258 C ATOM 11163 CD2 LEU L 63 68.628 12.438 21.316 1.00418.60 C ANISOU11163 CD2 LEU L 63 40754 61409 56882 -5493 -6996 7271 C ATOM 11164 N ARG L 64 71.415 12.023 26.214 1.00385.72 N ANISOU11164 N ARG L 64 38532 54276 53745 -2728 -4886 4602 N ATOM 11165 CA ARG L 64 72.518 12.583 27.036 1.00363.84 C ANISOU11165 CA ARG L 64 36099 51044 51099 -2287 -4649 4337 C ATOM 11166 C ARG L 64 73.673 11.598 27.323 1.00357.21 C ANISOU11166 C ARG L 64 35769 50388 49565 -2221 -4198 3489 C ATOM 11167 O ARG L 64 73.504 10.372 27.231 1.00352.29 O ANISOU11167 O ARG L 64 35265 50012 48577 -2339 -3941 2972 O ATOM 11168 CB ARG L 64 72.030 13.330 28.292 1.00351.45 C ANISOU11168 CB ARG L 64 34483 48545 50505 -1610 -4468 4390 C ATOM 11169 CG ARG L 64 71.342 12.509 29.365 1.00340.32 C ANISOU11169 CG ARG L 64 33230 46698 49377 -1142 -3981 3852 C ATOM 11170 CD ARG L 64 71.560 13.191 30.707 1.00328.77 C ANISOU11170 CD ARG L 64 31890 44497 48527 -501 -3669 3612 C ATOM 11171 NE ARG L 64 71.211 14.610 30.652 1.00327.72 N ANISOU11171 NE ARG L 64 31347 43968 49204 -421 -4020 4212 N ATOM 11172 CZ ARG L 64 71.968 15.616 31.096 1.00322.74 C ANISOU11172 CZ ARG L 64 30748 42970 48906 -179 -4031 4217 C ATOM 11173 NH1 ARG L 64 73.147 15.397 31.658 1.00315.59 N ANISOU11173 NH1 ARG L 64 30301 42074 47534 13 -3710 3667 N ATOM 11174 NH2 ARG L 64 71.527 16.858 31.005 1.00326.17 N ANISOU11174 NH2 ARG L 64 30714 42982 50231 -123 -4366 4776 N ATOM 11175 N VAL L 65 74.857 12.136 27.620 1.00359.21 N ANISOU11175 N VAL L 65 36277 50516 49691 -2062 -4126 3369 N ATOM 11176 CA VAL L 65 76.070 11.301 27.727 1.00366.00 C ANISOU11176 CA VAL L 65 37561 51606 49895 -2078 -3772 2659 C ATOM 11177 C VAL L 65 76.121 10.659 29.140 1.00372.09 C ANISOU11177 C VAL L 65 38665 51745 50968 -1450 -3221 2053 C ATOM 11178 O VAL L 65 76.336 11.368 30.124 1.00375.72 O ANISOU11178 O VAL L 65 39238 51645 51871 -971 -3089 2069 O ATOM 11179 CB VAL L 65 77.365 12.087 27.323 1.00362.85 C ANISOU11179 CB VAL L 65 37271 51445 49149 -2253 -3956 2814 C ATOM 11180 CG1 VAL L 65 78.599 11.189 27.317 1.00358.03 C ANISOU11180 CG1 VAL L 65 37044 51114 47875 -2326 -3608 2088 C ATOM 11181 CG2 VAL L 65 77.218 12.731 25.945 1.00366.40 C ANISOU11181 CG2 VAL L 65 37318 52590 49307 -2917 -4532 3531 C ATOM 11182 N ASP L 66 75.909 9.328 29.214 1.00379.11 N ANISOU11182 N ASP L 66 39656 52757 51630 -1493 -2917 1538 N ATOM 11183 CA ASP L 66 75.727 8.553 30.483 1.00374.65 C ANISOU11183 CA ASP L 66 39301 51675 51371 -978 -2434 1082 C ATOM 11184 C ASP L 66 76.762 7.400 30.714 1.00375.07 C ANISOU11184 C ASP L 66 39663 51814 51030 -969 -2056 413 C ATOM 11185 O ASP L 66 77.539 7.050 29.813 1.00389.11 O ANISOU11185 O ASP L 66 41479 54075 52289 -1388 -2127 183 O ATOM 11186 CB ASP L 66 74.288 7.991 30.546 1.00365.23 C ANISOU11186 CB ASP L 66 37847 50385 50536 -964 -2416 1185 C ATOM 11187 CG ASP L 66 73.602 8.213 31.897 1.00353.17 C ANISOU11187 CG ASP L 66 36324 48229 49636 -378 -2153 1215 C ATOM 11188 OD1 ASP L 66 74.031 7.647 32.927 1.00343.50 O ANISOU11188 OD1 ASP L 66 35345 46738 48431 -22 -1747 816 O ATOM 11189 OD2 ASP L 66 72.589 8.939 31.913 1.00350.04 O ANISOU11189 OD2 ASP L 66 35633 47640 49724 -304 -2358 1653 O ATOM 11190 N VAL L 67 76.729 6.818 31.919 1.00361.52 N ANISOU11190 N VAL L 67 38111 49648 49601 -514 -1660 125 N ATOM 11191 CA VAL L 67 77.688 5.796 32.426 1.00346.68 C ANISOU11191 CA VAL L 67 36482 47688 47553 -397 -1287 -406 C ATOM 11192 C VAL L 67 78.044 4.591 31.494 1.00345.36 C ANISOU11192 C VAL L 67 36249 47905 47067 -841 -1227 -861 C ATOM 11193 O VAL L 67 79.235 4.210 31.368 1.00340.16 O ANISOU11193 O VAL L 67 35760 47347 46134 -931 -1085 -1240 O ATOM 11194 CB VAL L 67 77.213 5.302 33.826 1.00340.11 C ANISOU11194 CB VAL L 67 35695 46381 47147 92 -931 -479 C ATOM 11195 CG1 VAL L 67 78.162 4.275 34.418 1.00338.06 C ANISOU11195 CG1 VAL L 67 35626 46004 46816 213 -587 -895 C ATOM 11196 CG2 VAL L 67 77.054 6.472 34.788 1.00333.21 C ANISOU11196 CG2 VAL L 67 34876 45190 46537 504 -922 -207 C ATOM 11197 N ASP L 68 77.024 4.003 30.855 1.00345.36 N ANISOU11197 N ASP L 68 35972 48107 47142 -1123 -1323 -864 N ATOM 11198 CA ASP L 68 77.166 2.777 30.020 1.00344.93 C ANISOU11198 CA ASP L 68 35771 48390 46897 -1550 -1231 -1394 C ATOM 11199 C ASP L 68 78.007 2.984 28.739 1.00353.64 C ANISOU11199 C ASP L 68 36837 50156 47374 -2109 -1431 -1602 C ATOM 11200 O ASP L 68 78.609 2.028 28.221 1.00352.71 O ANISOU11200 O ASP L 68 36660 50275 47076 -2404 -1254 -2217 O ATOM 11201 CB ASP L 68 75.787 2.171 29.643 1.00341.08 C ANISOU11201 CB ASP L 68 34961 47985 46647 -1737 -1308 -1342 C ATOM 11202 CG ASP L 68 74.869 1.902 30.854 1.00335.53 C ANISOU11202 CG ASP L 68 34242 46695 46549 -1232 -1104 -1133 C ATOM 11203 OD1 ASP L 68 75.374 1.631 31.968 1.00333.76 O ANISOU11203 OD1 ASP L 68 34211 46042 46560 -809 -800 -1234 O ATOM 11204 OD2 ASP L 68 73.627 1.945 30.665 1.00331.73 O ANISOU11204 OD2 ASP L 68 33520 46234 46285 -1295 -1257 -848 O ATOM 11205 N GLN L 69 78.023 4.220 28.231 1.00364.22 N ANISOU11205 N GLN L 69 38159 51799 48429 -2271 -1797 -1090 N ATOM 11206 CA GLN L 69 78.844 4.588 27.073 1.00370.36 C ANISOU11206 CA GLN L 69 38886 53270 48562 -2809 -2020 -1155 C ATOM 11207 C GLN L 69 80.341 4.607 27.384 1.00370.52 C ANISOU11207 C GLN L 69 39204 53191 48383 -2670 -1804 -1504 C ATOM 11208 O GLN L 69 81.141 4.043 26.628 1.00383.79 O ANISOU11208 O GLN L 69 40842 55336 49644 -3073 -1714 -2024 O ATOM 11209 CB GLN L 69 78.404 5.920 26.492 1.00367.01 C ANISOU11209 CB GLN L 69 38297 53158 47990 -3020 -2509 -380 C ATOM 11210 CG GLN L 69 77.157 5.805 25.640 1.00364.04 C ANISOU11210 CG GLN L 69 37533 53226 47558 -3452 -2807 -93 C ATOM 11211 CD GLN L 69 75.865 6.054 26.398 1.00360.39 C ANISOU11211 CD GLN L 69 36973 52188 47771 -3038 -2849 348 C ATOM 11212 OE1 GLN L 69 75.758 6.978 27.204 1.00360.10 O ANISOU11212 OE1 GLN L 69 37033 51620 48166 -2581 -2894 778 O ATOM 11213 NE2 GLN L 69 74.867 5.236 26.124 1.00357.07 N ANISOU11213 NE2 GLN L 69 36324 51884 47460 -3216 -2826 205 N ATOM 11214 N LEU L 70 80.720 5.243 28.493 1.00357.95 N ANISOU11214 N LEU L 70 37885 51023 47096 -2120 -1707 -1261 N ATOM 11215 CA LEU L 70 82.129 5.235 28.932 1.00342.10 C ANISOU11215 CA LEU L 70 36168 48857 44955 -1937 -1489 -1569 C ATOM 11216 C LEU L 70 82.665 3.819 29.239 1.00339.41 C ANISOU11216 C LEU L 70 35871 48330 44758 -1883 -1074 -2268 C ATOM 11217 O LEU L 70 83.792 3.488 28.838 1.00339.32 O ANISOU11217 O LEU L 70 35923 48536 44467 -2088 -953 -2701 O ATOM 11218 CB LEU L 70 82.360 6.177 30.119 1.00329.26 C ANISOU11218 CB LEU L 70 34790 46673 43638 -1373 -1462 -1204 C ATOM 11219 CG LEU L 70 83.826 6.348 30.554 1.00318.90 C ANISOU11219 CG LEU L 70 33773 45233 42159 -1203 -1298 -1431 C ATOM 11220 CD1 LEU L 70 84.654 7.160 29.565 1.00314.36 C ANISOU11220 CD1 LEU L 70 33197 45156 41086 -1590 -1580 -1288 C ATOM 11221 CD2 LEU L 70 83.917 6.958 31.941 1.00314.83 C ANISOU11221 CD2 LEU L 70 33472 44138 42008 -617 -1170 -1222 C ATOM 11222 N GLU L 71 81.859 3.005 29.933 1.00332.45 N ANISOU11222 N GLU L 71 34911 47036 44366 -1620 -867 -2352 N ATOM 11223 CA GLU L 71 82.165 1.582 30.208 1.00325.58 C ANISOU11223 CA GLU L 71 33968 45923 43811 -1586 -507 -2934 C ATOM 11224 C GLU L 71 82.444 0.703 28.969 1.00332.65 C ANISOU11224 C GLU L 71 34604 47313 44472 -2165 -464 -3581 C ATOM 11225 O GLU L 71 83.240 -0.231 29.052 1.00332.25 O ANISOU11225 O GLU L 71 34513 47095 44631 -2183 -177 -4143 O ATOM 11226 CB GLU L 71 81.075 0.945 31.069 1.00313.25 C ANISOU11226 CB GLU L 71 32295 43898 42825 -1262 -359 -2790 C ATOM 11227 CG GLU L 71 81.231 1.264 32.538 1.00302.63 C ANISOU11227 CG GLU L 71 31179 42025 41781 -681 -197 -2462 C ATOM 11228 CD GLU L 71 80.077 0.781 33.377 1.00296.05 C ANISOU11228 CD GLU L 71 30206 40839 41437 -395 -77 -2237 C ATOM 11229 OE1 GLU L 71 79.063 0.326 32.804 1.00290.89 O ANISOU11229 OE1 GLU L 71 29298 40309 40917 -617 -157 -2271 O ATOM 11230 OE2 GLU L 71 80.193 0.884 34.618 1.00295.96 O ANISOU11230 OE2 GLU L 71 30328 40478 41644 31 94 -2018 O ATOM 11231 N LYS L 72 81.794 1.006 27.839 1.00340.04 N ANISOU11231 N LYS L 72 35322 48873 45004 -2655 -746 -3511 N ATOM 11232 CA LYS L 72 82.067 0.338 26.540 1.00344.42 C ANISOU11232 CA LYS L 72 35591 50097 45175 -3309 -732 -4162 C ATOM 11233 C LYS L 72 83.411 0.774 25.871 1.00347.11 C ANISOU11233 C LYS L 72 36022 50935 44926 -3622 -757 -4414 C ATOM 11234 O LYS L 72 84.018 -0.003 25.125 1.00355.99 O ANISOU11234 O LYS L 72 36946 52438 45873 -4038 -573 -5168 O ATOM 11235 CB LYS L 72 80.876 0.505 25.565 1.00341.35 C ANISOU11235 CB LYS L 72 34896 50313 44486 -3785 -1047 -3960 C ATOM 11236 CG LYS L 72 79.776 -0.561 25.621 1.00332.62 C ANISOU11236 CG LYS L 72 33517 49002 43859 -3809 -921 -4233 C ATOM 11237 CD LYS L 72 78.759 -0.305 24.514 1.00327.61 C ANISOU11237 CD LYS L 72 32569 49108 42797 -4373 -1271 -4039 C ATOM 11238 CE LYS L 72 78.087 -1.555 23.963 1.00326.99 C ANISOU11238 CE LYS L 72 32112 49212 42915 -4734 -1127 -4700 C ATOM 11239 NZ LYS L 72 77.278 -1.206 22.761 1.00326.86 N ANISOU11239 NZ LYS L 72 31780 50101 42309 -5388 -1504 -4512 N ATOM 11240 N VAL L 73 83.863 2.005 26.137 1.00338.02 N ANISOU11240 N VAL L 73 35135 49778 43517 -3432 -971 -3822 N ATOM 11241 CA VAL L 73 85.184 2.476 25.674 1.00323.48 C ANISOU11241 CA VAL L 73 33412 48314 41181 -3647 -987 -3977 C ATOM 11242 C VAL L 73 86.264 2.384 26.766 1.00310.03 C ANISOU11242 C VAL L 73 32030 45937 39829 -3118 -704 -4100 C ATOM 11243 O VAL L 73 87.389 2.850 26.551 1.00307.90 O ANISOU11243 O VAL L 73 31898 45870 39217 -3207 -714 -4164 O ATOM 11244 CB VAL L 73 85.147 3.910 25.075 1.00322.65 C ANISOU11244 CB VAL L 73 33323 48735 40532 -3889 -1443 -3253 C ATOM 11245 CG1 VAL L 73 84.064 4.028 24.014 1.00328.57 C ANISOU11245 CG1 VAL L 73 33714 50191 40937 -4443 -1768 -3016 C ATOM 11246 CG2 VAL L 73 84.969 4.970 26.160 1.00316.01 C ANISOU11246 CG2 VAL L 73 32760 47245 40064 -3288 -1580 -2521 C ATOM 11247 N LEU L 74 85.920 1.802 27.926 1.00296.86 N ANISOU11247 N LEU L 74 30455 43521 38818 -2599 -471 -4085 N ATOM 11248 CA LEU L 74 86.896 1.514 28.997 1.00284.71 C ANISOU11248 CA LEU L 74 29150 41378 37647 -2141 -189 -4208 C ATOM 11249 C LEU L 74 87.976 0.539 28.544 1.00285.13 C ANISOU11249 C LEU L 74 29068 41516 37751 -2393 93 -4982 C ATOM 11250 O LEU L 74 89.155 0.835 28.769 1.00284.46 O ANISOU11250 O LEU L 74 29175 41355 37550 -2288 167 -5043 O ATOM 11251 CB LEU L 74 86.261 0.999 30.302 1.00278.44 C ANISOU11251 CB LEU L 74 28401 39876 37515 -1613 -7 -3996 C ATOM 11252 CG LEU L 74 85.510 1.912 31.266 1.00276.15 C ANISOU11252 CG LEU L 74 28296 39285 37343 -1175 -148 -3306 C ATOM 11253 CD1 LEU L 74 85.374 1.205 32.600 1.00275.50 C ANISOU11253 CD1 LEU L 74 28249 38594 37835 -709 125 -3245 C ATOM 11254 CD2 LEU L 74 86.183 3.267 31.437 1.00271.48 C ANISOU11254 CD2 LEU L 74 27979 38772 36398 -1044 -340 -2930 C ATOM 11255 N PRO L 75 87.587 -0.618 27.919 1.00287.96 N ANISOU11255 N PRO L 75 29067 42004 38339 -2724 260 -5606 N ATOM 11256 CA PRO L 75 88.564 -1.519 27.286 1.00293.91 C ANISOU11256 CA PRO L 75 29590 42914 39166 -3056 533 -6468 C ATOM 11257 C PRO L 75 89.552 -0.773 26.399 1.00300.72 C ANISOU11257 C PRO L 75 30525 44459 39274 -3444 420 -6613 C ATOM 11258 O PRO L 75 90.772 -0.853 26.633 1.00301.88 O ANISOU11258 O PRO L 75 30778 44422 39501 -3337 600 -6864 O ATOM 11259 CB PRO L 75 87.683 -2.431 26.433 1.00296.60 C ANISOU11259 CB PRO L 75 29503 43572 39620 -3498 590 -7024 C ATOM 11260 CG PRO L 75 86.456 -2.563 27.245 1.00291.78 C ANISOU11260 CG PRO L 75 28919 42467 39477 -3120 522 -6504 C ATOM 11261 CD PRO L 75 86.230 -1.201 27.840 1.00287.67 C ANISOU11261 CD PRO L 75 28783 41908 38607 -2782 234 -5595 C ATOM 11262 N GLN L 76 89.027 -0.015 25.435 1.00306.95 N ANISOU11262 N GLN L 76 31244 46030 39352 -3885 103 -6371 N ATOM 11263 CA GLN L 76 89.860 0.730 24.481 1.00311.11 C ANISOU11263 CA GLN L 76 31774 47345 39087 -4344 -51 -6420 C ATOM 11264 C GLN L 76 90.780 1.843 25.067 1.00312.13 C ANISOU11264 C GLN L 76 32295 47258 39039 -4000 -183 -5844 C ATOM 11265 O GLN L 76 91.917 2.019 24.597 1.00318.11 O ANISOU11265 O GLN L 76 33066 48370 39430 -4238 -117 -6137 O ATOM 11266 CB GLN L 76 89.001 1.228 23.317 1.00310.33 C ANISOU11266 CB GLN L 76 31431 48180 38298 -4946 -397 -6195 C ATOM 11267 CG GLN L 76 89.778 1.608 22.065 1.00311.96 C ANISOU11267 CG GLN L 76 31458 49428 37642 -5631 -498 -6465 C ATOM 11268 CD GLN L 76 90.843 0.602 21.619 1.00314.60 C ANISOU11268 CD GLN L 76 31579 49949 38002 -5921 -71 -7574 C ATOM 11269 OE1 GLN L 76 90.658 -0.622 21.660 1.00315.89 O ANISOU11269 OE1 GLN L 76 31496 49823 38703 -5939 264 -8360 O ATOM 11270 NE2 GLN L 76 91.971 1.131 21.171 1.00314.70 N ANISOU11270 NE2 GLN L 76 31646 50435 37487 -6160 -82 -7647 N ATOM 11271 N LEU L 77 90.317 2.553 26.104 1.00308.57 N ANISOU11271 N LEU L 77 32134 46229 38879 -3452 -339 -5098 N ATOM 11272 CA LEU L 77 91.094 3.635 26.778 1.00299.33 C ANISOU11272 CA LEU L 77 31319 44783 37630 -3087 -463 -4568 C ATOM 11273 C LEU L 77 92.317 3.193 27.627 1.00291.85 C ANISOU11273 C LEU L 77 30572 43276 37040 -2717 -144 -4886 C ATOM 11274 O LEU L 77 93.343 3.882 27.652 1.00287.00 O ANISOU11274 O LEU L 77 30147 42740 36160 -2686 -202 -4759 O ATOM 11275 CB LEU L 77 90.160 4.522 27.624 1.00293.94 C ANISOU11275 CB LEU L 77 30813 43678 37190 -2645 -700 -3777 C ATOM 11276 CG LEU L 77 90.607 5.904 28.119 1.00287.13 C ANISOU11276 CG LEU L 77 30221 42649 36225 -2364 -937 -3149 C ATOM 11277 CD1 LEU L 77 91.039 6.800 26.968 1.00287.31 C ANISOU11277 CD1 LEU L 77 30142 43403 35619 -2866 -1260 -2905 C ATOM 11278 CD2 LEU L 77 89.465 6.557 28.887 1.00282.73 C ANISOU11278 CD2 LEU L 77 29714 41678 36032 -1979 -1107 -2551 C ATOM 11279 N LEU L 78 92.178 2.061 28.324 1.00286.85 N ANISOU11279 N LEU L 78 29865 42078 37047 -2449 164 -5234 N ATOM 11280 CA LEU L 78 93.253 1.397 29.105 1.00281.15 C ANISOU11280 CA LEU L 78 29221 40807 36795 -2146 475 -5541 C ATOM 11281 C LEU L 78 94.502 1.075 28.266 1.00282.80 C ANISOU11281 C LEU L 78 29297 41378 36773 -2529 636 -6188 C ATOM 11282 O LEU L 78 95.643 1.302 28.688 1.00282.63 O ANISOU11282 O LEU L 78 29457 41143 36786 -2344 718 -6179 O ATOM 11283 CB LEU L 78 92.704 0.095 29.747 1.00280.57 C ANISOU11283 CB LEU L 78 28935 40162 37506 -1930 742 -5794 C ATOM 11284 CG LEU L 78 91.733 0.170 30.957 1.00279.02 C ANISOU11284 CG LEU L 78 28865 39444 37704 -1438 698 -5193 C ATOM 11285 CD1 LEU L 78 90.737 -0.993 31.047 1.00281.05 C ANISOU11285 CD1 LEU L 78 28802 39440 38543 -1450 847 -5409 C ATOM 11286 CD2 LEU L 78 92.491 0.330 32.270 1.00276.86 C ANISOU11286 CD2 LEU L 78 28840 38640 37712 -949 797 -4857 C ATOM 11287 N LEU L 79 94.252 0.534 27.080 1.00286.90 N ANISOU11287 N LEU L 79 29471 42478 37057 -3083 691 -6779 N ATOM 11288 CA LEU L 79 95.297 0.116 26.145 1.00292.34 C ANISOU11288 CA LEU L 79 29932 43631 37512 -3542 888 -7548 C ATOM 11289 C LEU L 79 96.031 1.298 25.491 1.00295.92 C ANISOU11289 C LEU L 79 30549 44758 37126 -3821 651 -7274 C ATOM 11290 O LEU L 79 97.227 1.192 25.233 1.00295.77 O ANISOU11290 O LEU L 79 30502 44864 37013 -3955 824 -7691 O ATOM 11291 CB LEU L 79 94.712 -0.805 25.060 1.00296.87 C ANISOU11291 CB LEU L 79 30033 44721 38041 -4105 1026 -8327 C ATOM 11292 CG LEU L 79 93.813 -2.003 25.411 1.00297.56 C ANISOU11292 CG LEU L 79 29847 44285 38925 -3973 1226 -8663 C ATOM 11293 CD1 LEU L 79 93.032 -2.448 24.179 1.00305.29 C ANISOU11293 CD1 LEU L 79 30416 46026 39554 -4615 1215 -9244 C ATOM 11294 CD2 LEU L 79 94.588 -3.155 26.043 1.00296.14 C ANISOU11294 CD2 LEU L 79 29485 43322 39711 -3707 1619 -9213 C ATOM 11295 N ASP L 80 95.302 2.398 25.220 1.00300.51 N ANISOU11295 N ASP L 80 31257 45751 37170 -3916 253 -6558 N ATOM 11296 CA ASP L 80 95.840 3.640 24.581 1.00304.90 C ANISOU11296 CA ASP L 80 31920 46958 36970 -4202 -56 -6114 C ATOM 11297 C ASP L 80 96.812 4.458 25.465 1.00300.47 C ANISOU11297 C ASP L 80 31744 45897 36523 -3732 -109 -5657 C ATOM 11298 O ASP L 80 97.614 5.251 24.953 1.00303.25 O ANISOU11298 O ASP L 80 32147 46707 36364 -3969 -264 -5481 O ATOM 11299 CB ASP L 80 94.697 4.571 24.077 1.00308.69 C ANISOU11299 CB ASP L 80 32344 47930 37014 -4430 -505 -5384 C ATOM 11300 CG ASP L 80 94.236 4.254 22.642 1.00315.57 C ANISOU11300 CG ASP L 80 32789 49851 37260 -5218 -585 -5751 C ATOM 11301 OD1 ASP L 80 94.773 3.307 22.025 1.00318.04 O ANISOU11301 OD1 ASP L 80 32841 50527 37470 -5595 -263 -6664 O ATOM 11302 OD2 ASP L 80 93.334 4.962 22.129 1.00318.28 O ANISOU11302 OD2 ASP L 80 33018 50678 37235 -5483 -973 -5133 O ATOM 11303 N PHE L 81 96.747 4.267 26.784 1.00294.41 N ANISOU11303 N PHE L 81 31218 44243 36401 -3100 12 -5458 N ATOM 11304 CA PHE L 81 97.505 5.118 27.713 1.00288.08 C ANISOU11304 CA PHE L 81 30774 42988 35692 -2648 -70 -4981 C ATOM 11305 C PHE L 81 98.219 4.305 28.807 1.00289.97 C ANISOU11305 C PHE L 81 31127 42488 36559 -2203 265 -5264 C ATOM 11306 O PHE L 81 99.425 4.427 29.042 1.00290.98 O ANISOU11306 O PHE L 81 31381 42487 36689 -2112 362 -5370 O ATOM 11307 CB PHE L 81 96.566 6.162 28.350 1.00279.28 C ANISOU11307 CB PHE L 81 29850 41625 34637 -2317 -385 -4184 C ATOM 11308 CG PHE L 81 96.103 7.269 27.407 1.00275.64 C ANISOU11308 CG PHE L 81 29287 41797 33644 -2697 -798 -3682 C ATOM 11309 CD1 PHE L 81 96.988 8.249 26.982 1.00274.42 C ANISOU11309 CD1 PHE L 81 29206 41974 33087 -2871 -1007 -3401 C ATOM 11310 CD2 PHE L 81 94.766 7.363 26.992 1.00273.69 C ANISOU11310 CD2 PHE L 81 28845 41785 33359 -2873 -1005 -3405 C ATOM 11311 CE1 PHE L 81 96.560 9.277 26.152 1.00275.22 C ANISOU11311 CE1 PHE L 81 29155 42632 32784 -3230 -1425 -2821 C ATOM 11312 CE2 PHE L 81 94.338 8.389 26.155 1.00274.35 C ANISOU11312 CE2 PHE L 81 28779 42430 33029 -3234 -1424 -2834 C ATOM 11313 CZ PHE L 81 95.237 9.347 25.734 1.00275.89 C ANISOU11313 CZ PHE L 81 29018 42952 32854 -3419 -1642 -2518 C TER 11314 PHE L 81 ATOM 11315 N SER M 8 82.162 59.491 53.212 1.00296.81 N ANISOU11315 N SER M 8 37358 43599 31814 -2975 -13 -1745 N ATOM 11316 CA SER M 8 80.916 59.957 52.500 1.00302.72 C ANISOU11316 CA SER M 8 38445 43730 32842 -2943 -85 -1836 C ATOM 11317 C SER M 8 80.686 59.218 51.160 1.00304.16 C ANISOU11317 C SER M 8 38805 43516 33245 -2764 -143 -1685 C ATOM 11318 O SER M 8 81.356 59.492 50.152 1.00306.51 O ANISOU11318 O SER M 8 39245 43708 33503 -2882 -149 -1730 O ATOM 11319 CB SER M 8 80.926 61.493 52.318 1.00302.25 C ANISOU11319 CB SER M 8 38619 43497 32724 -3252 -74 -2138 C ATOM 11320 OG SER M 8 79.696 61.990 51.789 1.00302.44 O ANISOU11320 OG SER M 8 38941 42970 33001 -3206 -140 -2219 O ATOM 11321 N GLY M 9 79.735 58.285 51.159 1.00305.43 N ANISOU11321 N GLY M 9 38948 43468 33632 -2492 -179 -1517 N ATOM 11322 CA GLY M 9 79.483 57.415 49.990 1.00309.44 C ANISOU11322 CA GLY M 9 39575 43645 34353 -2304 -220 -1371 C ATOM 11323 C GLY M 9 79.471 55.919 50.268 1.00319.59 C ANISOU11323 C GLY M 9 40627 45068 35732 -2022 -185 -1103 C ATOM 11324 O GLY M 9 79.381 55.506 51.431 1.00325.87 O ANISOU11324 O GLY M 9 41183 46166 36465 -1930 -142 -1003 O ATOM 11325 N PHE M 10 79.581 55.113 49.198 1.00323.32 N ANISOU11325 N PHE M 10 41167 45327 36353 -1889 -195 -988 N ATOM 11326 CA PHE M 10 79.470 53.626 49.253 1.00322.02 C ANISOU11326 CA PHE M 10 40823 45187 36342 -1606 -150 -738 C ATOM 11327 C PHE M 10 80.638 52.858 49.897 1.00314.87 C ANISOU11327 C PHE M 10 39598 44774 35264 -1530 -60 -551 C ATOM 11328 O PHE M 10 81.822 53.243 49.822 1.00316.48 O ANISOU11328 O PHE M 10 39727 45285 35233 -1685 -36 -600 O ATOM 11329 CB PHE M 10 79.151 53.006 47.867 1.00321.57 C ANISOU11329 CB PHE M 10 40940 44723 36518 -1495 -179 -702 C ATOM 11330 CG PHE M 10 77.667 52.867 47.551 1.00314.28 C ANISOU11330 CG PHE M 10 40189 43355 35867 -1374 -236 -733 C ATOM 11331 CD1 PHE M 10 76.830 53.988 47.483 1.00314.77 C ANISOU11331 CD1 PHE M 10 40472 43174 35950 -1503 -317 -925 C ATOM 11332 CD2 PHE M 10 77.116 51.608 47.277 1.00304.46 C ANISOU11332 CD2 PHE M 10 38885 41930 34866 -1133 -202 -577 C ATOM 11333 CE1 PHE M 10 75.485 53.848 47.182 1.00310.61 C ANISOU11333 CE1 PHE M 10 40085 42267 35662 -1384 -372 -954 C ATOM 11334 CE2 PHE M 10 75.770 51.471 46.956 1.00299.63 C ANISOU11334 CE2 PHE M 10 38418 40932 34493 -1035 -251 -622 C ATOM 11335 CZ PHE M 10 74.951 52.590 46.921 1.00303.97 C ANISOU11335 CZ PHE M 10 39172 41276 35044 -1156 -341 -807 C ATOM 11336 N ARG M 11 80.257 51.730 50.491 1.00295.76 N ANISOU11336 N ARG M 11 36991 42412 32972 -1278 -7 -327 N ATOM 11337 CA ARG M 11 81.112 50.961 51.356 1.00276.34 C ANISOU11337 CA ARG M 11 34204 40422 30368 -1157 79 -110 C ATOM 11338 C ARG M 11 81.685 49.861 50.491 1.00266.52 C ANISOU11338 C ARG M 11 32915 39095 29254 -987 132 54 C ATOM 11339 O ARG M 11 80.983 49.253 49.682 1.00260.56 O ANISOU11339 O ARG M 11 32302 37921 28776 -857 126 84 O ATOM 11340 CB ARG M 11 80.315 50.426 52.570 1.00271.25 C ANISOU11340 CB ARG M 11 33388 39886 29789 -984 116 47 C ATOM 11341 CG ARG M 11 79.100 51.262 52.979 1.00266.80 C ANISOU11341 CG ARG M 11 32980 39102 29287 -1080 50 -132 C ATOM 11342 CD ARG M 11 79.462 52.447 53.871 1.00261.58 C ANISOU11342 CD ARG M 11 32253 38799 28334 -1321 34 -311 C ATOM 11343 NE ARG M 11 79.228 52.178 55.280 1.00256.16 N ANISOU11343 NE ARG M 11 31311 38472 27546 -1239 80 -191 N ATOM 11344 CZ ARG M 11 78.357 52.854 56.018 1.00255.12 C ANISOU11344 CZ ARG M 11 31214 38315 27404 -1321 50 -331 C ATOM 11345 NH1 ARG M 11 77.656 53.846 55.481 1.00255.16 N ANISOU11345 NH1 ARG M 11 31501 37943 27503 -1475 -22 -590 N ATOM 11346 NH2 ARG M 11 78.193 52.554 57.298 1.00254.74 N ANISOU11346 NH2 ARG M 11 30914 38628 27248 -1247 97 -211 N ATOM 11347 N LYS M 12 82.986 49.649 50.645 1.00259.44 N ANISOU11347 N LYS M 12 31814 38612 28148 -1000 186 141 N ATOM 11348 CA LYS M 12 83.763 48.790 49.764 1.00258.17 C ANISOU11348 CA LYS M 12 31606 38422 28062 -884 238 255 C ATOM 11349 C LYS M 12 83.187 47.383 49.559 1.00262.53 C ANISOU11349 C LYS M 12 32108 38708 28934 -577 309 480 C ATOM 11350 O LYS M 12 82.889 46.991 48.431 1.00263.90 O ANISOU11350 O LYS M 12 32449 38493 29328 -531 303 435 O ATOM 11351 CB LYS M 12 85.223 48.745 50.247 1.00253.09 C ANISOU11351 CB LYS M 12 30691 38349 27121 -920 293 339 C ATOM 11352 CG LYS M 12 86.018 50.020 49.943 1.00246.85 C ANISOU11352 CG LYS M 12 29992 37747 26051 -1248 241 83 C ATOM 11353 CD LYS M 12 87.238 50.212 50.846 1.00245.53 C ANISOU11353 CD LYS M 12 29523 38230 25536 -1322 288 129 C ATOM 11354 CE LYS M 12 88.476 49.408 50.435 1.00243.85 C ANISOU11354 CE LYS M 12 29113 38284 25251 -1206 355 279 C ATOM 11355 NZ LYS M 12 89.277 50.032 49.353 1.00238.42 N ANISOU11355 NZ LYS M 12 28571 37560 24455 -1435 328 76 N ATOM 11356 N GLU M 13 83.019 46.633 50.645 1.00270.01 N ANISOU11356 N GLU M 13 32821 39864 29904 -374 382 718 N ATOM 11357 CA GLU M 13 82.545 45.255 50.550 1.00282.29 C ANISOU11357 CA GLU M 13 34307 41185 31762 -81 477 952 C ATOM 11358 C GLU M 13 81.143 45.201 49.970 1.00281.41 C ANISOU11358 C GLU M 13 34448 40525 31951 -63 435 839 C ATOM 11359 O GLU M 13 80.816 44.280 49.223 1.00276.45 O ANISOU11359 O GLU M 13 33874 39564 31600 89 493 904 O ATOM 11360 CB GLU M 13 82.569 44.577 51.925 1.00299.99 C ANISOU11360 CB GLU M 13 36259 43770 33953 116 564 1237 C ATOM 11361 CG GLU M 13 82.167 43.089 51.959 1.00321.79 C ANISOU11361 CG GLU M 13 38921 46317 37028 434 691 1519 C ATOM 11362 CD GLU M 13 80.788 42.802 52.582 1.00335.11 C ANISOU11362 CD GLU M 13 40651 47760 38915 531 705 1583 C ATOM 11363 OE1 GLU M 13 80.696 41.925 53.473 1.00349.34 O ANISOU11363 OE1 GLU M 13 42244 49713 40776 749 811 1872 O ATOM 11364 OE2 GLU M 13 79.779 43.445 52.197 1.00337.73 O ANISOU11364 OE2 GLU M 13 41222 47753 39344 395 615 1354 O ATOM 11365 N LEU M 14 80.325 46.188 50.325 1.00287.48 N ANISOU11365 N LEU M 14 35357 41212 32661 -219 341 663 N ATOM 11366 CA LEU M 14 78.938 46.230 49.901 1.00294.61 C ANISOU11366 CA LEU M 14 36479 41640 33819 -203 293 551 C ATOM 11367 C LEU M 14 78.838 46.022 48.400 1.00287.97 C ANISOU11367 C LEU M 14 35845 40404 33165 -219 270 433 C ATOM 11368 O LEU M 14 78.154 45.100 47.928 1.00289.01 O ANISOU11368 O LEU M 14 36015 40210 33585 -57 322 496 O ATOM 11369 CB LEU M 14 78.299 47.561 50.309 1.00301.47 C ANISOU11369 CB LEU M 14 37492 42497 34555 -412 182 329 C ATOM 11370 CG LEU M 14 76.935 47.971 49.740 1.00300.93 C ANISOU11370 CG LEU M 14 37688 41957 34694 -451 98 149 C ATOM 11371 CD1 LEU M 14 75.833 46.963 50.042 1.00309.43 C ANISOU11371 CD1 LEU M 14 38718 42801 36048 -232 156 286 C ATOM 11372 CD2 LEU M 14 76.569 49.332 50.329 1.00294.96 C ANISOU11372 CD2 LEU M 14 37024 41283 33761 -654 9 -48 C ATOM 11373 N VAL M 15 79.553 46.870 47.664 1.00278.59 N ANISOU11373 N VAL M 15 34779 39265 31805 -422 201 259 N ATOM 11374 CA VAL M 15 79.498 46.880 46.205 1.00272.84 C ANISOU11374 CA VAL M 15 34261 38203 31202 -479 162 119 C ATOM 11375 C VAL M 15 79.986 45.547 45.600 1.00275.71 C ANISOU11375 C VAL M 15 34508 38503 31744 -288 274 270 C ATOM 11376 O VAL M 15 79.469 45.099 44.569 1.00281.04 O ANISOU11376 O VAL M 15 35318 38821 32642 -243 276 200 O ATOM 11377 CB VAL M 15 80.282 48.076 45.617 1.00268.50 C ANISOU11377 CB VAL M 15 33848 37765 30405 -745 79 -76 C ATOM 11378 CG1 VAL M 15 79.933 48.255 44.155 1.00267.80 C ANISOU11378 CG1 VAL M 15 34011 37296 30444 -818 17 -234 C ATOM 11379 CG2 VAL M 15 79.979 49.361 46.376 1.00264.23 C ANISOU11379 CG2 VAL M 15 33381 37337 29676 -932 1 -212 C ATOM 11380 N SER M 16 80.962 44.916 46.261 1.00274.75 N ANISOU11380 N SER M 16 34127 38738 31526 -171 373 474 N ATOM 11381 CA SER M 16 81.550 43.643 45.822 1.00272.43 C ANISOU11381 CA SER M 16 33691 38423 31394 27 499 639 C ATOM 11382 C SER M 16 80.538 42.516 45.801 1.00271.15 C ANISOU11382 C SER M 16 33522 37915 31584 248 589 753 C ATOM 11383 O SER M 16 80.413 41.805 44.805 1.00274.20 O ANISOU11383 O SER M 16 33973 38011 32197 319 643 716 O ATOM 11384 CB SER M 16 82.712 43.245 46.732 1.00272.28 C ANISOU11384 CB SER M 16 33376 38888 31189 131 585 863 C ATOM 11385 OG SER M 16 83.087 41.897 46.518 1.00269.07 O ANISOU11385 OG SER M 16 32814 38429 30988 377 728 1065 O ATOM 11386 N ARG M 17 79.836 42.350 46.912 1.00267.90 N ANISOU11386 N ARG M 17 33023 37550 31214 348 613 885 N ATOM 11387 CA ARG M 17 78.839 41.308 47.005 1.00268.49 C ANISOU11387 CA ARG M 17 33086 37310 31618 545 709 997 C ATOM 11388 C ARG M 17 77.653 41.624 46.094 1.00269.46 C ANISOU11388 C ARG M 17 33470 36986 31924 449 627 757 C ATOM 11389 O ARG M 17 77.026 40.716 45.550 1.00268.57 O ANISOU11389 O ARG M 17 33391 36543 32108 570 709 766 O ATOM 11390 CB ARG M 17 78.434 41.085 48.457 1.00271.90 C ANISOU11390 CB ARG M 17 33348 37940 32020 664 757 1207 C ATOM 11391 CG ARG M 17 79.574 40.492 49.271 1.00286.73 C ANISOU11391 CG ARG M 17 34939 40242 33763 815 865 1490 C ATOM 11392 CD ARG M 17 79.061 39.698 50.465 1.00301.69 C ANISOU11392 CD ARG M 17 36652 42212 35762 1025 974 1770 C ATOM 11393 NE ARG M 17 80.148 39.392 51.401 1.00320.88 N ANISOU11393 NE ARG M 17 38798 45138 37984 1146 1047 2040 N ATOM 11394 CZ ARG M 17 80.869 38.277 51.377 1.00332.98 C ANISOU11394 CZ ARG M 17 40152 46734 39632 1374 1196 2295 C ATOM 11395 NH1 ARG M 17 80.616 37.338 50.475 1.00342.17 N ANISOU11395 NH1 ARG M 17 41394 47481 41134 1497 1300 2303 N ATOM 11396 NH2 ARG M 17 81.845 38.094 52.260 1.00331.99 N ANISOU11396 NH2 ARG M 17 39759 47098 39283 1482 1246 2540 N ATOM 11397 N LEU M 18 77.382 42.913 45.898 1.00274.74 N ANISOU11397 N LEU M 18 34320 37653 32415 232 472 539 N ATOM 11398 CA LEU M 18 76.358 43.356 44.947 1.00281.14 C ANISOU11398 CA LEU M 18 35382 38080 33357 132 375 307 C ATOM 11399 C LEU M 18 76.702 42.996 43.516 1.00294.14 C ANISOU11399 C LEU M 18 37126 39523 35110 107 389 198 C ATOM 11400 O LEU M 18 75.828 42.594 42.751 1.00298.17 O ANISOU11400 O LEU M 18 37749 39693 35848 142 392 97 O ATOM 11401 CB LEU M 18 76.130 44.864 45.034 1.00271.80 C ANISOU11401 CB LEU M 18 34368 36952 31949 -89 216 115 C ATOM 11402 CG LEU M 18 75.263 45.427 46.165 1.00264.93 C ANISOU11402 CG LEU M 18 33493 36133 31034 -103 168 112 C ATOM 11403 CD1 LEU M 18 75.277 46.948 46.080 1.00260.67 C ANISOU11403 CD1 LEU M 18 33127 35643 30271 -337 29 -94 C ATOM 11404 CD2 LEU M 18 73.834 44.883 46.136 1.00259.61 C ANISOU11404 CD2 LEU M 18 32879 35118 30640 15 182 96 C ATOM 11405 N LEU M 19 77.966 43.169 43.144 1.00305.97 N ANISOU11405 N LEU M 19 38574 41250 36429 35 395 203 N ATOM 11406 CA LEU M 19 78.400 42.679 41.848 1.00310.00 C ANISOU11406 CA LEU M 19 39137 41608 37041 30 430 120 C ATOM 11407 C LEU M 19 78.551 41.135 41.817 1.00317.65 C ANISOU11407 C LEU M 19 39928 42485 38279 267 613 290 C ATOM 11408 O LEU M 19 78.298 40.544 40.769 1.00334.09 O ANISOU11408 O LEU M 19 42076 44298 40562 292 657 189 O ATOM 11409 CB LEU M 19 79.619 43.444 41.271 1.00300.20 C ANISOU11409 CB LEU M 19 37932 40600 35527 -151 369 28 C ATOM 11410 CG LEU M 19 79.416 44.620 40.287 1.00286.97 C ANISOU11410 CG LEU M 19 36517 38793 33723 -389 220 -214 C ATOM 11411 CD1 LEU M 19 80.744 45.053 39.677 1.00286.62 C ANISOU11411 CD1 LEU M 19 36470 38981 33451 -539 206 -271 C ATOM 11412 CD2 LEU M 19 78.414 44.320 39.179 1.00273.93 C ANISOU11412 CD2 LEU M 19 35031 36748 32301 -375 192 -355 C ATOM 11413 N HIS M 20 78.908 40.470 42.930 1.00302.21 N ANISOU11413 N HIS M 20 37749 40736 36338 441 726 542 N ATOM 11414 CA HIS M 20 78.843 38.979 42.984 1.00279.09 C ANISOU11414 CA HIS M 20 34670 37656 33716 686 916 721 C ATOM 11415 C HIS M 20 77.420 38.384 42.920 1.00283.08 C ANISOU11415 C HIS M 20 35253 37769 34534 770 965 685 C ATOM 11416 O HIS M 20 77.263 37.166 42.825 1.00276.25 O ANISOU11416 O HIS M 20 34293 36714 33954 948 1133 795 O ATOM 11417 CB HIS M 20 79.632 38.397 44.156 1.00255.09 C ANISOU11417 CB HIS M 20 31366 34947 30610 867 1032 1028 C ATOM 11418 CG HIS M 20 81.047 38.088 43.805 1.00239.14 C ANISOU11418 CG HIS M 20 29208 33168 28484 906 1096 1100 C ATOM 11419 ND1 HIS M 20 81.410 36.923 43.169 1.00233.79 N ANISOU11419 ND1 HIS M 20 28448 32322 28056 1068 1253 1165 N ATOM 11420 CD2 HIS M 20 82.181 38.810 43.955 1.00231.84 C ANISOU11420 CD2 HIS M 20 28215 32637 27235 795 1026 1094 C ATOM 11421 CE1 HIS M 20 82.714 36.927 42.967 1.00231.16 C ANISOU11421 CE1 HIS M 20 27995 32278 27555 1069 1274 1209 C ATOM 11422 NE2 HIS M 20 83.207 38.060 43.435 1.00228.62 N ANISOU11422 NE2 HIS M 20 27677 32309 26879 901 1137 1168 N ATOM 11423 N LEU M 21 76.406 39.259 42.959 1.00290.78 N ANISOU11423 N LEU M 21 36399 38624 35458 637 825 524 N ATOM 11424 CA LEU M 21 74.980 38.921 42.705 1.00293.70 C ANISOU11424 CA LEU M 21 36876 38625 36089 667 834 419 C ATOM 11425 C LEU M 21 74.619 38.534 41.233 1.00297.33 C ANISOU11425 C LEU M 21 37464 38762 36745 622 848 203 C ATOM 11426 O LEU M 21 73.837 37.582 41.011 1.00296.54 O ANISOU11426 O LEU M 21 37345 38381 36944 727 964 192 O ATOM 11427 CB LEU M 21 74.059 40.061 43.216 1.00289.87 C ANISOU11427 CB LEU M 21 36524 38147 35464 542 672 309 C ATOM 11428 CG LEU M 21 73.249 39.889 44.514 1.00285.79 C ANISOU11428 CG LEU M 21 35919 37662 35005 642 708 453 C ATOM 11429 CD1 LEU M 21 72.952 41.199 45.232 1.00282.39 C ANISOU11429 CD1 LEU M 21 35561 37410 34322 504 551 379 C ATOM 11430 CD2 LEU M 21 71.951 39.171 44.194 1.00283.10 C ANISOU11430 CD2 LEU M 21 35634 36951 34979 717 770 382 C ATOM 11431 N HIS M 22 75.204 39.260 40.261 1.00299.61 N ANISOU11431 N HIS M 22 37871 39109 36858 459 738 34 N ATOM 11432 CA HIS M 22 74.876 39.167 38.804 1.00297.79 C ANISOU11432 CA HIS M 22 37779 38630 36737 372 710 -200 C ATOM 11433 C HIS M 22 75.977 38.579 37.838 1.00309.82 C ANISOU11433 C HIS M 22 39240 40194 38284 374 800 -231 C ATOM 11434 O HIS M 22 75.802 38.572 36.603 1.00306.68 O ANISOU11434 O HIS M 22 38947 39637 37937 282 770 -436 O ATOM 11435 CB HIS M 22 74.362 40.531 38.287 1.00281.33 C ANISOU11435 CB HIS M 22 35918 36519 34454 171 498 -405 C ATOM 11436 CG HIS M 22 73.147 41.050 39.004 1.00266.40 C ANISOU11436 CG HIS M 22 34102 34533 32582 171 414 -424 C ATOM 11437 ND1 HIS M 22 71.920 40.422 38.948 1.00260.65 N ANISOU11437 ND1 HIS M 22 33384 33539 32112 255 463 -478 N ATOM 11438 CD2 HIS M 22 72.966 42.155 39.767 1.00259.95 C ANISOU11438 CD2 HIS M 22 33352 33854 31560 88 289 -416 C ATOM 11439 CE1 HIS M 22 71.041 41.108 39.656 1.00254.81 C ANISOU11439 CE1 HIS M 22 32709 32786 31320 233 366 -493 C ATOM 11440 NE2 HIS M 22 71.650 42.164 40.163 1.00255.54 N ANISOU11440 NE2 HIS M 22 32839 33115 31139 134 261 -458 N ATOM 11441 N PHE M 23 77.087 38.095 38.411 1.00327.19 N ANISOU11441 N PHE M 23 41257 42620 40438 482 908 -31 N ATOM 11442 CA PHE M 23 78.159 37.396 37.668 1.00338.12 C ANISOU11442 CA PHE M 23 42542 44055 41872 523 1022 -29 C ATOM 11443 C PHE M 23 77.635 36.095 37.049 1.00346.31 C ANISOU11443 C PHE M 23 43533 44766 43283 649 1196 -81 C ATOM 11444 O PHE M 23 77.083 35.245 37.783 1.00353.22 O ANISOU11444 O PHE M 23 44310 45502 44395 821 1332 69 O ATOM 11445 CB PHE M 23 79.353 37.011 38.595 1.00336.76 C ANISOU11445 CB PHE M 23 42149 44196 41606 663 1123 235 C ATOM 11446 CG PHE M 23 80.304 38.136 38.917 1.00332.70 C ANISOU11446 CG PHE M 23 41639 44060 40711 520 989 250 C ATOM 11447 CD1 PHE M 23 80.476 39.210 38.045 1.00331.80 C ANISOU11447 CD1 PHE M 23 41704 43981 40381 282 832 28 C ATOM 11448 CD2 PHE M 23 81.053 38.103 40.098 1.00327.16 C ANISOU11448 CD2 PHE M 23 40749 43692 39862 621 1032 490 C ATOM 11449 CE1 PHE M 23 81.348 40.248 38.352 1.00325.80 C ANISOU11449 CE1 PHE M 23 40950 43556 39281 134 727 30 C ATOM 11450 CE2 PHE M 23 81.917 39.142 40.413 1.00320.14 C ANISOU11450 CE2 PHE M 23 39851 43166 38618 472 919 480 C ATOM 11451 CZ PHE M 23 82.075 40.208 39.535 1.00320.26 C ANISOU11451 CZ PHE M 23 40057 43188 38437 223 773 245 C ATOM 11452 N LYS M 24 77.817 35.939 35.732 1.00349.69 N ANISOU11452 N LYS M 24 44026 45080 43760 557 1201 -293 N ATOM 11453 CA LYS M 24 77.630 34.624 35.049 1.00350.72 C ANISOU11453 CA LYS M 24 44077 44943 44235 666 1399 -361 C ATOM 11454 C LYS M 24 78.761 33.548 35.376 1.00347.61 C ANISOU11454 C LYS M 24 43460 44639 43973 864 1612 -156 C ATOM 11455 O LYS M 24 78.448 32.357 35.531 1.00361.60 O ANISOU11455 O LYS M 24 45128 46184 46078 1035 1817 -80 O ATOM 11456 CB LYS M 24 77.323 34.801 33.532 1.00348.49 C ANISOU11456 CB LYS M 24 43927 44515 43965 496 1337 -676 C ATOM 11457 CG LYS M 24 75.997 35.522 33.247 1.00337.01 C ANISOU11457 CG LYS M 24 42659 42909 42480 369 1179 -850 C ATOM 11458 CD LYS M 24 74.781 34.589 33.254 1.00327.05 C ANISOU11458 CD LYS M 24 41373 41329 41562 461 1307 -915 C ATOM 11459 CE LYS M 24 73.686 35.127 34.163 1.00318.17 C ANISOU11459 CE LYS M 24 40322 40153 40413 471 1207 -851 C ATOM 11460 NZ LYS M 24 72.763 36.043 33.428 1.00309.95 N ANISOU11460 NZ LYS M 24 39466 39047 39251 305 1014 -1082 N ATOM 11461 N ASP M 25 80.037 33.962 35.508 1.00327.48 N ANISOU11461 N ASP M 25 40837 42416 41173 845 1570 -63 N ATOM 11462 CA ASP M 25 81.076 33.149 36.196 1.00310.36 C ANISOU11462 CA ASP M 25 38442 40414 39066 1058 1738 200 C ATOM 11463 C ASP M 25 81.435 33.790 37.547 1.00302.51 C ANISOU11463 C ASP M 25 37375 39749 37816 1101 1655 448 C ATOM 11464 O ASP M 25 81.871 34.937 37.605 1.00293.50 O ANISOU11464 O ASP M 25 36303 38877 36337 931 1479 392 O ATOM 11465 CB ASP M 25 82.353 32.927 35.340 1.00308.47 C ANISOU11465 CB ASP M 25 38119 40324 38758 1038 1791 128 C ATOM 11466 CG ASP M 25 83.326 31.883 35.952 1.00309.90 C ANISOU11466 CG ASP M 25 38052 40621 39073 1299 1997 396 C ATOM 11467 OD1 ASP M 25 82.992 31.283 36.995 1.00309.60 O ANISOU11467 OD1 ASP M 25 37910 40529 39193 1500 2108 648 O ATOM 11468 OD2 ASP M 25 84.434 31.660 35.396 1.00312.85 O ANISOU11468 OD2 ASP M 25 38328 41150 39390 1311 2052 366 O ATOM 11469 N ASP M 26 81.248 33.043 38.630 1.00302.26 N ANISOU11469 N ASP M 26 37199 39700 37946 1321 1790 717 N ATOM 11470 CA ASP M 26 81.552 33.546 39.969 1.00305.86 C ANISOU11470 CA ASP M 26 37555 40489 38166 1375 1728 961 C ATOM 11471 C ASP M 26 83.072 33.545 40.229 1.00311.55 C ANISOU11471 C ASP M 26 38090 41610 38674 1443 1757 1118 C ATOM 11472 O ASP M 26 83.543 34.050 41.232 1.00314.29 O ANISOU11472 O ASP M 26 38334 42313 38767 1461 1695 1293 O ATOM 11473 CB ASP M 26 80.829 32.687 41.028 1.00307.17 C ANISOU11473 CB ASP M 26 37619 40514 38578 1596 1873 1214 C ATOM 11474 CG ASP M 26 79.307 32.825 40.983 1.00305.19 C ANISOU11474 CG ASP M 26 37535 39935 38486 1517 1826 1072 C ATOM 11475 OD1 ASP M 26 78.836 33.969 40.804 1.00298.84 O ANISOU11475 OD1 ASP M 26 36898 39177 37469 1308 1624 883 O ATOM 11476 OD2 ASP M 26 78.609 31.793 41.173 1.00308.70 O ANISOU11476 OD2 ASP M 26 37937 40087 39266 1671 1999 1160 O ATOM 11477 N LYS M 27 83.849 32.946 39.336 1.00317.73 N ANISOU11477 N LYS M 27 38812 42352 39558 1485 1859 1051 N ATOM 11478 CA LYS M 27 85.305 33.061 39.421 1.00322.54 C ANISOU11478 CA LYS M 27 39256 43356 39937 1517 1865 1149 C ATOM 11479 C LYS M 27 85.781 34.474 39.066 1.00318.94 C ANISOU11479 C LYS M 27 38919 43181 39080 1230 1646 952 C ATOM 11480 O LYS M 27 86.949 34.825 39.293 1.00317.20 O ANISOU11480 O LYS M 27 38571 43354 38596 1209 1617 1021 O ATOM 11481 CB LYS M 27 85.980 32.071 38.485 1.00331.53 C ANISOU11481 CB LYS M 27 40304 44362 41298 1627 2033 1098 C ATOM 11482 CG LYS M 27 85.789 30.592 38.811 1.00338.96 C ANISOU11482 CG LYS M 27 41097 45047 42644 1931 2289 1313 C ATOM 11483 CD LYS M 27 86.876 29.761 38.118 1.00346.06 C ANISOU11483 CD LYS M 27 41846 45968 43671 2059 2450 1313 C ATOM 11484 CE LYS M 27 86.801 29.858 36.595 1.00348.70 C ANISOU11484 CE LYS M 27 42328 46090 44072 1860 2423 941 C ATOM 11485 NZ LYS M 27 88.123 30.029 35.924 1.00348.90 N ANISOU11485 NZ LYS M 27 42261 46395 43907 1805 2409 852 N ATOM 11486 N THR M 28 84.879 35.273 38.497 1.00314.04 N ANISOU11486 N THR M 28 38540 42359 38420 1010 1500 709 N ATOM 11487 CA THR M 28 85.175 36.668 38.150 1.00310.42 C ANISOU11487 CA THR M 28 38228 42106 37608 728 1298 522 C ATOM 11488 C THR M 28 85.566 37.468 39.393 1.00318.52 C ANISOU11488 C THR M 28 39171 43520 38328 695 1211 677 C ATOM 11489 O THR M 28 84.875 37.399 40.429 1.00316.82 O ANISOU11489 O THR M 28 38922 43290 38165 793 1218 829 O ATOM 11490 CB THR M 28 83.976 37.325 37.458 1.00298.74 C ANISOU11490 CB THR M 28 37017 40315 36173 540 1168 279 C ATOM 11491 OG1 THR M 28 83.541 36.470 36.402 1.00291.23 O ANISOU11491 OG1 THR M 28 36111 39023 35520 587 1267 143 O ATOM 11492 CG2 THR M 28 84.358 38.682 36.887 1.00293.47 C ANISOU11492 CG2 THR M 28 36514 39816 35176 255 985 82 C ATOM 11493 N LYS M 29 86.688 38.189 39.291 1.00325.73 N ANISOU11493 N LYS M 29 40041 44796 38925 553 1140 630 N ATOM 11494 CA LYS M 29 87.247 39.003 40.403 1.00329.09 C ANISOU11494 CA LYS M 29 40364 45654 39020 488 1064 740 C ATOM 11495 C LYS M 29 86.995 40.516 40.185 1.00331.81 C ANISOU11495 C LYS M 29 40933 46042 39096 170 874 513 C ATOM 11496 O LYS M 29 86.604 40.934 39.092 1.00332.80 O ANISOU11496 O LYS M 29 41277 45913 39259 6 801 290 O ATOM 11497 CB LYS M 29 88.757 38.704 40.641 1.00321.88 C ANISOU11497 CB LYS M 29 39197 45176 37926 569 1139 874 C ATOM 11498 CG LYS M 29 89.228 37.366 40.073 1.00308.90 C ANISOU11498 CG LYS M 29 37410 43405 36551 801 1314 966 C ATOM 11499 CD LYS M 29 89.934 36.473 41.072 1.00299.01 C ANISOU11499 CD LYS M 29 35850 42432 35325 1092 1456 1291 C ATOM 11500 CE LYS M 29 90.259 35.129 40.430 1.00296.08 C ANISOU11500 CE LYS M 29 35368 41848 35278 1327 1644 1363 C ATOM 11501 NZ LYS M 29 90.240 33.986 41.387 1.00297.16 N ANISOU11501 NZ LYS M 29 35283 41994 35628 1672 1817 1709 N ATOM 11502 N VAL M 30 87.166 41.307 41.250 1.00333.15 N ANISOU11502 N VAL M 30 41045 46526 39008 93 805 577 N ATOM 11503 CA VAL M 30 87.315 42.776 41.168 1.00327.09 C ANISOU11503 CA VAL M 30 40437 45903 37937 -213 655 380 C ATOM 11504 C VAL M 30 88.539 43.187 42.051 1.00337.49 C ANISOU11504 C VAL M 30 41533 47776 38920 -262 663 473 C ATOM 11505 O VAL M 30 88.606 42.789 43.221 1.00348.29 O ANISOU11505 O VAL M 30 42691 49380 40260 -96 719 686 O ATOM 11506 CB VAL M 30 86.028 43.551 41.592 1.00308.31 C ANISOU11506 CB VAL M 30 38255 43304 35585 -309 549 298 C ATOM 11507 CG1 VAL M 30 86.103 44.995 41.116 1.00300.08 C ANISOU11507 CG1 VAL M 30 37434 42279 34304 -625 410 60 C ATOM 11508 CG2 VAL M 30 84.756 42.895 41.064 1.00294.87 C ANISOU11508 CG2 VAL M 30 36689 41116 34230 -188 569 272 C ATOM 11509 N SER M 31 89.518 43.936 41.496 1.00335.54 N ANISOU11509 N SER M 31 41317 47756 38416 -485 614 320 N ATOM 11510 CA SER M 31 90.740 44.381 42.259 1.00323.78 C ANISOU11510 CA SER M 31 39610 46827 36584 -564 622 371 C ATOM 11511 C SER M 31 90.461 45.625 43.124 1.00309.77 C ANISOU11511 C SER M 31 37902 45228 34567 -778 526 281 C ATOM 11512 O SER M 31 89.407 46.244 42.966 1.00305.65 O ANISOU11512 O SER M 31 37624 44377 34132 -888 444 156 O ATOM 11513 CB SER M 31 91.976 44.596 41.347 1.00330.03 C ANISOU11513 CB SER M 31 40377 47821 37199 -714 628 244 C ATOM 11514 OG SER M 31 91.957 45.848 40.668 1.00334.24 O ANISOU11514 OG SER M 31 41160 48273 37561 -1046 520 -11 O ATOM 11515 N GLY M 32 91.392 45.975 44.021 1.00297.27 N ANISOU11515 N GLY M 32 36097 44167 32686 -835 541 335 N ATOM 11516 CA GLY M 32 91.206 47.075 44.973 1.00287.56 C ANISOU11516 CA GLY M 32 34881 43158 31219 -1029 474 250 C ATOM 11517 C GLY M 32 90.872 48.386 44.296 1.00280.70 C ANISOU11517 C GLY M 32 34326 42061 30265 -1359 372 -36 C ATOM 11518 O GLY M 32 89.823 48.973 44.548 1.00278.69 O ANISOU11518 O GLY M 32 34253 41549 30085 -1429 308 -115 O ATOM 11519 N ASP M 33 91.768 48.829 43.432 1.00276.82 N ANISOU11519 N ASP M 33 33893 41663 29621 -1554 362 -183 N ATOM 11520 CA ASP M 33 91.547 50.013 42.596 1.00271.12 C ANISOU11520 CA ASP M 33 33482 40698 28831 -1862 279 -438 C ATOM 11521 C ASP M 33 90.230 49.992 41.804 1.00261.02 C ANISOU11521 C ASP M 33 32500 38830 27844 -1820 217 -493 C ATOM 11522 O ASP M 33 89.525 50.998 41.783 1.00256.07 O ANISOU11522 O ASP M 33 32103 37991 27200 -1997 141 -636 O ATOM 11523 CB ASP M 33 92.733 50.259 41.627 1.00278.89 C ANISOU11523 CB ASP M 33 34475 41847 29643 -2043 294 -558 C ATOM 11524 CG ASP M 33 93.819 51.151 42.190 1.00285.08 C ANISOU11524 CG ASP M 33 35133 43123 30061 -2294 307 -665 C ATOM 11525 OD1 ASP M 33 93.663 51.623 43.338 1.00287.11 O ANISOU11525 OD1 ASP M 33 35295 43605 30188 -2340 303 -659 O ATOM 11526 OD2 ASP M 33 94.876 51.280 41.520 1.00288.48 O ANISOU11526 OD2 ASP M 33 35525 43753 30331 -2432 332 -749 O ATOM 11527 N ALA M 34 89.891 48.862 41.159 1.00252.77 N ANISOU11527 N ALA M 34 31443 37527 27067 -1588 255 -388 N ATOM 11528 CA ALA M 34 88.694 48.775 40.292 1.00243.52 C ANISOU11528 CA ALA M 34 30534 35828 26164 -1553 200 -456 C ATOM 11529 C ALA M 34 87.431 48.988 41.096 1.00238.00 C ANISOU11529 C ALA M 34 29911 34926 25590 -1483 157 -425 C ATOM 11530 O ALA M 34 86.510 49.705 40.698 1.00230.93 O ANISOU11530 O ALA M 34 29272 33706 24763 -1594 71 -555 O ATOM 11531 CB ALA M 34 88.639 47.434 39.574 1.00243.27 C ANISOU11531 CB ALA M 34 30429 35610 26393 -1315 274 -357 C ATOM 11532 N LEU M 35 87.415 48.362 42.254 1.00238.79 N ANISOU11532 N LEU M 35 29775 35241 25710 -1293 219 -242 N ATOM 11533 CA LEU M 35 86.311 48.488 43.136 1.00240.25 C ANISOU11533 CA LEU M 35 29990 35297 25995 -1218 191 -198 C ATOM 11534 C LEU M 35 86.237 49.923 43.628 1.00240.69 C ANISOU11534 C LEU M 35 30164 35463 25823 -1483 113 -365 C ATOM 11535 O LEU M 35 85.158 50.525 43.613 1.00233.90 O ANISOU11535 O LEU M 35 29511 34298 25060 -1542 41 -465 O ATOM 11536 CB LEU M 35 86.501 47.518 44.278 1.00246.28 C ANISOU11536 CB LEU M 35 30450 36335 26788 -970 285 49 C ATOM 11537 CG LEU M 35 85.249 47.213 45.072 1.00249.44 C ANISOU11537 CG LEU M 35 30856 36543 27377 -816 284 144 C ATOM 11538 CD1 LEU M 35 84.105 46.791 44.161 1.00246.60 C ANISOU11538 CD1 LEU M 35 30709 35648 27338 -731 261 91 C ATOM 11539 CD2 LEU M 35 85.556 46.129 46.092 1.00254.01 C ANISOU11539 CD2 LEU M 35 31123 37399 27989 -553 394 425 C ATOM 11540 N GLN M 36 87.386 50.464 44.049 1.00245.80 N ANISOU11540 N GLN M 36 30675 36544 26172 -1645 135 -404 N ATOM 11541 CA AGLN M 36 87.479 51.864 44.456 0.50245.11 C ANISOU11541 CA AGLN M 36 30694 36580 25854 -1932 83 -592 C ATOM 11542 CA BGLN M 36 87.489 51.867 44.452 0.50245.43 C ANISOU11542 CA BGLN M 36 30734 36623 25893 -1934 83 -593 C ATOM 11543 C GLN M 36 86.845 52.779 43.411 1.00238.23 C ANISOU11543 C GLN M 36 30180 35278 25059 -2120 0 -790 C ATOM 11544 O GLN M 36 86.139 53.729 43.745 1.00236.77 O ANISOU11544 O GLN M 36 30157 34944 24861 -2250 -53 -912 O ATOM 11545 CB AGLN M 36 88.934 52.263 44.704 0.50252.51 C ANISOU11545 CB AGLN M 36 31454 38019 26468 -2108 128 -641 C ATOM 11546 CB BGLN M 36 88.950 52.270 44.673 0.50253.29 C ANISOU11546 CB BGLN M 36 31557 38115 26565 -2112 127 -644 C ATOM 11547 CG AGLN M 36 89.486 51.832 46.051 0.50260.38 C ANISOU11547 CG AGLN M 36 32103 39527 27301 -1996 193 -488 C ATOM 11548 CG BGLN M 36 89.506 51.946 46.047 0.50261.85 C ANISOU11548 CG BGLN M 36 32302 39718 27470 -2023 189 -508 C ATOM 11549 CD AGLN M 36 89.315 52.897 47.114 0.50265.51 C ANISOU11549 CD AGLN M 36 32735 40393 27752 -2192 173 -616 C ATOM 11550 CD BGLN M 36 88.974 52.886 47.104 0.50267.15 C ANISOU11550 CD BGLN M 36 32990 40488 28024 -2166 161 -614 C ATOM 11551 OE1AGLN M 36 88.209 53.387 47.350 0.50268.70 O ANISOU11551 OE1AGLN M 36 33314 40500 28280 -2219 123 -690 O ATOM 11552 OE1BGLN M 36 87.795 52.838 47.450 0.50269.84 O ANISOU11552 OE1BGLN M 36 33427 40546 28551 -2063 127 -586 O ATOM 11553 NE2AGLN M 36 90.414 53.260 47.768 0.50269.41 N ANISOU11553 NE2AGLN M 36 33005 41424 27934 -2332 217 -655 N ATOM 11554 NE2BGLN M 36 89.840 53.756 47.615 0.50271.83 N ANISOU11554 NE2BGLN M 36 33485 41490 28307 -2414 180 -752 N ATOM 11555 N LEU M 37 87.071 52.486 42.143 1.00227.00 N ANISOU11555 N LEU M 37 28877 33653 23719 -2124 -10 -817 N ATOM 11556 CA LEU M 37 86.468 53.325 41.141 1.00217.76 C ANISOU11556 CA LEU M 37 28035 32094 22608 -2286 -91 -978 C ATOM 11557 C LEU M 37 84.994 52.972 40.852 1.00215.39 C ANISOU11557 C LEU M 37 27892 31341 22605 -2113 -146 -950 C ATOM 11558 O LEU M 37 84.228 53.830 40.431 1.00218.03 O ANISOU11558 O LEU M 37 28483 31375 22984 -2227 -223 -1071 O ATOM 11559 CB LEU M 37 87.354 53.430 39.894 1.00213.30 C ANISOU11559 CB LEU M 37 27555 31537 21952 -2428 -87 -1054 C ATOM 11560 CG LEU M 37 88.635 54.277 39.989 1.00208.54 C ANISOU11560 CG LEU M 37 26906 31298 21033 -2703 -56 -1163 C ATOM 11561 CD1 LEU M 37 89.495 54.084 38.738 1.00207.08 C ANISOU11561 CD1 LEU M 37 26762 31131 20787 -2789 -41 -1205 C ATOM 11562 CD2 LEU M 37 88.360 55.765 40.184 1.00206.19 C ANISOU11562 CD2 LEU M 37 26828 30905 20610 -2978 -100 -1337 C ATOM 11563 N MET M 38 84.580 51.736 41.113 1.00210.72 N ANISOU11563 N MET M 38 27144 30704 22217 -1840 -102 -790 N ATOM 11564 CA MET M 38 83.166 51.399 41.004 1.00208.62 C ANISOU11564 CA MET M 38 26996 30049 22219 -1684 -144 -771 C ATOM 11565 C MET M 38 82.311 52.349 41.794 1.00207.42 C ANISOU11565 C MET M 38 26952 29814 22041 -1763 -204 -848 C ATOM 11566 O MET M 38 81.258 52.791 41.352 1.00202.66 O ANISOU11566 O MET M 38 26568 28860 21570 -1776 -280 -935 O ATOM 11567 CB MET M 38 82.907 50.004 41.526 1.00211.58 C ANISOU11567 CB MET M 38 27149 30452 22790 -1395 -61 -578 C ATOM 11568 CG MET M 38 82.614 49.019 40.426 1.00219.88 C ANISOU11568 CG MET M 38 28241 31224 24078 -1253 -36 -554 C ATOM 11569 SD MET M 38 81.210 49.615 39.476 1.00230.15 S ANISOU11569 SD MET M 38 29867 32037 25541 -1315 -153 -718 S ATOM 11570 CE MET M 38 79.843 49.069 40.514 1.00232.64 C ANISOU11570 CE MET M 38 30115 32191 26086 -1100 -139 -620 C ATOM 11571 N VAL M 39 82.783 52.649 42.988 1.00213.56 N ANISOU11571 N VAL M 39 27560 30939 22644 -1812 -166 -818 N ATOM 11572 CA VAL M 39 82.121 53.603 43.853 1.00223.96 C ANISOU11572 CA VAL M 39 28947 32239 23906 -1911 -208 -912 C ATOM 11573 C VAL M 39 81.948 54.946 43.158 1.00233.39 C ANISOU11573 C VAL M 39 30438 33208 25032 -2157 -281 -1115 C ATOM 11574 O VAL M 39 80.893 55.554 43.250 1.00231.48 O ANISOU11574 O VAL M 39 30368 32691 24893 -2171 -342 -1197 O ATOM 11575 CB VAL M 39 82.893 53.788 45.179 1.00225.41 C ANISOU11575 CB VAL M 39 28879 32908 23855 -1970 -147 -875 C ATOM 11576 CG1 VAL M 39 82.273 54.889 46.050 1.00225.09 C ANISOU11576 CG1 VAL M 39 28916 32866 23742 -2110 -181 -1013 C ATOM 11577 CG2 VAL M 39 82.964 52.461 45.929 1.00226.17 C ANISOU11577 CG2 VAL M 39 28685 33217 24031 -1700 -72 -639 C ATOM 11578 N GLU M 40 82.988 55.401 42.467 1.00249.46 N ANISOU11578 N GLU M 40 32528 35361 26895 -2347 -270 -1189 N ATOM 11579 CA GLU M 40 82.945 56.702 41.801 1.00262.22 C ANISOU11579 CA GLU M 40 34424 36775 28431 -2596 -322 -1365 C ATOM 11580 C GLU M 40 81.917 56.665 40.680 1.00257.33 C ANISOU11580 C GLU M 40 34054 35689 28028 -2514 -403 -1380 C ATOM 11581 O GLU M 40 81.191 57.640 40.451 1.00255.63 O ANISOU11581 O GLU M 40 34077 35199 27852 -2610 -464 -1486 O ATOM 11582 CB GLU M 40 84.327 57.110 41.267 1.00276.23 C ANISOU11582 CB GLU M 40 36191 38790 29971 -2819 -281 -1431 C ATOM 11583 CG GLU M 40 85.454 57.142 42.313 1.00287.90 C ANISOU11583 CG GLU M 40 37399 40786 31203 -2913 -199 -1428 C ATOM 11584 CD GLU M 40 85.700 58.499 42.970 1.00296.62 C ANISOU11584 CD GLU M 40 38570 42016 32113 -3192 -180 -1607 C ATOM 11585 OE1 GLU M 40 86.603 58.591 43.846 1.00295.90 O ANISOU11585 OE1 GLU M 40 38249 42376 31801 -3290 -112 -1628 O ATOM 11586 OE2 GLU M 40 85.006 59.474 42.614 1.00306.80 O ANISOU11586 OE2 GLU M 40 40134 42965 33469 -3315 -226 -1729 O ATOM 11587 N LEU M 41 81.845 55.524 40.000 1.00251.22 N ANISOU11587 N LEU M 41 33215 34836 27399 -2330 -398 -1274 N ATOM 11588 CA LEU M 41 80.891 55.351 38.916 1.00242.32 C ANISOU11588 CA LEU M 41 32285 33314 26470 -2242 -470 -1290 C ATOM 11589 C LEU M 41 79.514 55.545 39.459 1.00237.35 C ANISOU11589 C LEU M 41 31733 32441 26008 -2130 -523 -1303 C ATOM 11590 O LEU M 41 78.724 56.346 38.960 1.00240.81 O ANISOU11590 O LEU M 41 32408 32588 26500 -2187 -601 -1390 O ATOM 11591 CB LEU M 41 80.948 53.944 38.329 1.00237.76 C ANISOU11591 CB LEU M 41 31575 32716 26047 -2040 -432 -1184 C ATOM 11592 CG LEU M 41 79.752 53.671 37.406 1.00233.48 C ANISOU11592 CG LEU M 41 31199 31784 25728 -1927 -502 -1209 C ATOM 11593 CD1 LEU M 41 80.056 54.196 36.016 1.00232.60 C ANISOU11593 CD1 LEU M 41 31290 31545 25539 -2080 -554 -1296 C ATOM 11594 CD2 LEU M 41 79.385 52.205 37.316 1.00232.62 C ANISOU11594 CD2 LEU M 41 30924 31619 25841 -1682 -447 -1109 C ATOM 11595 N LEU M 42 79.233 54.778 40.493 1.00229.07 N ANISOU11595 N LEU M 42 30471 31522 25040 -1959 -475 -1204 N ATOM 11596 CA LEU M 42 77.937 54.813 41.084 1.00223.27 C ANISOU11596 CA LEU M 42 29772 30589 24469 -1836 -515 -1208 C ATOM 11597 C LEU M 42 77.705 56.163 41.752 1.00222.38 C ANISOU11597 C LEU M 42 29778 30475 24241 -2006 -549 -1333 C ATOM 11598 O LEU M 42 76.565 56.634 41.788 1.00224.08 O ANISOU11598 O LEU M 42 30140 30419 24581 -1967 -613 -1396 O ATOM 11599 CB LEU M 42 77.771 53.644 42.048 1.00222.37 C ANISOU11599 CB LEU M 42 29393 30637 24458 -1622 -442 -1058 C ATOM 11600 CG LEU M 42 77.773 52.252 41.399 1.00220.99 C ANISOU11600 CG LEU M 42 29117 30385 24463 -1428 -394 -941 C ATOM 11601 CD1 LEU M 42 77.558 51.167 42.444 1.00225.46 C ANISOU11601 CD1 LEU M 42 29433 31089 25141 -1217 -308 -777 C ATOM 11602 CD2 LEU M 42 76.698 52.154 40.326 1.00216.35 C ANISOU11602 CD2 LEU M 42 28726 29401 24076 -1367 -466 -1012 C ATOM 11603 N LYS M 43 78.786 56.772 42.256 1.00219.00 N ANISOU11603 N LYS M 43 29280 30351 23578 -2196 -499 -1379 N ATOM 11604 CA LYS M 43 78.763 58.151 42.755 1.00215.54 C ANISOU11604 CA LYS M 43 28968 29914 23013 -2407 -511 -1531 C ATOM 11605 C LYS M 43 78.113 59.026 41.693 1.00217.08 C ANISOU11605 C LYS M 43 29486 29706 23289 -2486 -591 -1630 C ATOM 11606 O LYS M 43 77.027 59.554 41.907 1.00220.99 O ANISOU11606 O LYS M 43 30111 29951 23904 -2443 -643 -1690 O ATOM 11607 CB LYS M 43 80.175 58.658 43.101 1.00211.06 C ANISOU11607 CB LYS M 43 28300 29721 22172 -2636 -439 -1587 C ATOM 11608 CG LYS M 43 80.314 60.164 43.282 1.00207.80 C ANISOU11608 CG LYS M 43 28064 29263 21628 -2906 -434 -1774 C ATOM 11609 CD LYS M 43 81.738 60.609 43.008 1.00208.08 C ANISOU11609 CD LYS M 43 28073 29569 21419 -3149 -372 -1838 C ATOM 11610 CE LYS M 43 82.239 61.562 44.080 1.00210.26 C ANISOU11610 CE LYS M 43 28274 30115 21499 -3376 -303 -1987 C ATOM 11611 NZ LYS M 43 82.390 60.891 45.403 1.00209.85 N ANISOU11611 NZ LYS M 43 27897 30459 21376 -3266 -256 -1918 N ATOM 11612 N VAL M 44 78.744 59.137 40.533 1.00216.67 N ANISOU11612 N VAL M 44 29555 29594 23174 -2585 -603 -1635 N ATOM 11613 CA VAL M 44 78.196 59.984 39.479 1.00217.15 C ANISOU11613 CA VAL M 44 29920 29295 23289 -2660 -678 -1705 C ATOM 11614 C VAL M 44 76.837 59.487 38.973 1.00221.87 C ANISOU11614 C VAL M 44 30603 29569 24127 -2435 -762 -1659 C ATOM 11615 O VAL M 44 75.968 60.290 38.623 1.00222.68 O ANISOU11615 O VAL M 44 30924 29374 24308 -2444 -830 -1718 O ATOM 11616 CB VAL M 44 79.184 60.128 38.324 1.00214.16 C ANISOU11616 CB VAL M 44 29637 28954 22781 -2812 -669 -1707 C ATOM 11617 CG1 VAL M 44 78.674 61.146 37.312 1.00213.03 C ANISOU11617 CG1 VAL M 44 29812 28462 22665 -2909 -738 -1765 C ATOM 11618 CG2 VAL M 44 80.524 60.544 38.882 1.00211.44 C ANISOU11618 CG2 VAL M 44 29179 28963 22197 -3032 -579 -1761 C ATOM 11619 N PHE M 45 76.679 58.162 38.960 1.00226.32 N ANISOU11619 N PHE M 45 30983 30200 24806 -2234 -748 -1554 N ATOM 11620 CA PHE M 45 75.444 57.463 38.614 1.00226.97 C ANISOU11620 CA PHE M 45 31084 30034 25118 -2014 -805 -1515 C ATOM 11621 C PHE M 45 74.262 58.093 39.344 1.00225.88 C ANISOU11621 C PHE M 45 31023 29717 25081 -1959 -852 -1575 C ATOM 11622 O PHE M 45 73.353 58.665 38.739 1.00220.72 O ANISOU11622 O PHE M 45 30572 28772 24517 -1934 -935 -1626 O ATOM 11623 CB PHE M 45 75.631 56.019 39.071 1.00229.39 C ANISOU11623 CB PHE M 45 31120 30524 25512 -1836 -734 -1399 C ATOM 11624 CG PHE M 45 74.490 55.102 38.783 1.00231.33 C ANISOU11624 CG PHE M 45 31341 30555 25999 -1616 -761 -1360 C ATOM 11625 CD1 PHE M 45 74.583 54.197 37.736 1.00234.48 C ANISOU11625 CD1 PHE M 45 31719 30883 26488 -1537 -753 -1326 C ATOM 11626 CD2 PHE M 45 73.354 55.075 39.594 1.00230.08 C ANISOU11626 CD2 PHE M 45 31155 30287 25978 -1493 -783 -1366 C ATOM 11627 CE1 PHE M 45 73.542 53.315 37.471 1.00236.57 C ANISOU11627 CE1 PHE M 45 31947 30960 26979 -1349 -763 -1310 C ATOM 11628 CE2 PHE M 45 72.309 54.202 39.334 1.00231.42 C ANISOU11628 CE2 PHE M 45 31291 30270 26368 -1303 -798 -1340 C ATOM 11629 CZ PHE M 45 72.403 53.316 38.272 1.00234.42 C ANISOU11629 CZ PHE M 45 31655 30574 26839 -1234 -785 -1315 C ATOM 11630 N VAL M 46 74.277 57.989 40.662 1.00228.46 N ANISOU11630 N VAL M 46 31178 30238 25387 -1935 -798 -1565 N ATOM 11631 CA VAL M 46 73.178 58.528 41.420 1.00230.98 C ANISOU11631 CA VAL M 46 31545 30415 25801 -1881 -834 -1631 C ATOM 11632 C VAL M 46 73.301 60.056 41.589 1.00242.12 C ANISOU11632 C VAL M 46 33144 31750 27096 -2088 -847 -1766 C ATOM 11633 O VAL M 46 72.266 60.713 41.711 1.00245.26 O ANISOU11633 O VAL M 46 33679 31908 27600 -2048 -902 -1840 O ATOM 11634 CB VAL M 46 72.932 57.791 42.761 1.00224.65 C ANISOU11634 CB VAL M 46 30487 29824 25042 -1756 -776 -1569 C ATOM 11635 CG1 VAL M 46 71.543 58.100 43.275 1.00221.62 C ANISOU11635 CG1 VAL M 46 30159 29233 24811 -1652 -827 -1631 C ATOM 11636 CG2 VAL M 46 73.045 56.281 42.617 1.00218.67 C ANISOU11636 CG2 VAL M 46 29537 29157 24388 -1574 -731 -1421 C ATOM 11637 N VAL M 47 74.534 60.615 41.571 1.00252.78 N ANISOU11637 N VAL M 47 34504 33295 28243 -2305 -790 -1805 N ATOM 11638 CA VAL M 47 74.782 62.098 41.595 1.00259.98 C ANISOU11638 CA VAL M 47 35616 34116 29047 -2535 -780 -1943 C ATOM 11639 C VAL M 47 73.836 62.692 40.580 1.00270.22 C ANISOU11639 C VAL M 47 37191 35000 30478 -2485 -872 -1963 C ATOM 11640 O VAL M 47 73.013 63.580 40.878 1.00270.64 O ANISOU11640 O VAL M 47 37384 34833 30610 -2488 -898 -2050 O ATOM 11641 CB VAL M 47 76.247 62.531 41.199 1.00254.76 C ANISOU11641 CB VAL M 47 34977 33655 28163 -2782 -716 -1972 C ATOM 11642 CG1 VAL M 47 76.314 63.938 40.617 1.00252.52 C ANISOU11642 CG1 VAL M 47 34984 33130 27831 -2986 -721 -2080 C ATOM 11643 CG2 VAL M 47 77.195 62.503 42.378 1.00252.50 C ANISOU11643 CG2 VAL M 47 34456 33784 27697 -2904 -618 -2011 C ATOM 11644 N GLU M 48 73.942 62.136 39.381 1.00282.62 N ANISOU11644 N GLU M 48 38821 36483 32076 -2424 -918 -1878 N ATOM 11645 CA GLU M 48 73.253 62.662 38.234 1.00295.22 C ANISOU11645 CA GLU M 48 40671 37743 33753 -2393 -1005 -1876 C ATOM 11646 C GLU M 48 71.785 62.269 38.204 1.00296.03 C ANISOU11646 C GLU M 48 40785 37625 34068 -2153 -1089 -1858 C ATOM 11647 O GLU M 48 70.953 63.043 37.737 1.00295.92 O ANISOU11647 O GLU M 48 40975 37328 34131 -2120 -1158 -1888 O ATOM 11648 CB GLU M 48 74.008 62.274 36.970 1.00303.99 C ANISOU11648 CB GLU M 48 41830 38890 34781 -2448 -1016 -1808 C ATOM 11649 CG GLU M 48 75.227 63.162 36.729 1.00316.44 C ANISOU11649 CG GLU M 48 43512 40565 36154 -2721 -953 -1853 C ATOM 11650 CD GLU M 48 74.849 64.596 36.354 1.00324.44 C ANISOU11650 CD GLU M 48 44820 41284 37167 -2840 -978 -1912 C ATOM 11651 OE1 GLU M 48 73.928 64.776 35.521 1.00326.91 O ANISOU11651 OE1 GLU M 48 45301 41317 37592 -2720 -1069 -1869 O ATOM 11652 OE2 GLU M 48 75.474 65.548 36.884 1.00331.97 O ANISOU11652 OE2 GLU M 48 45833 42289 38008 -3052 -900 -2001 O ATOM 11653 N ALA M 49 71.468 61.089 38.735 1.00296.41 N ANISOU11653 N ALA M 49 40607 37805 34210 -1986 -1075 -1806 N ATOM 11654 CA ALA M 49 70.078 60.725 39.009 1.00298.98 C ANISOU11654 CA ALA M 49 40904 37964 34730 -1776 -1133 -1811 C ATOM 11655 C ALA M 49 69.372 61.829 39.846 1.00302.23 C ANISOU11655 C ALA M 49 41411 38245 35177 -1803 -1146 -1914 C ATOM 11656 O ALA M 49 68.291 62.323 39.472 1.00301.27 O ANISOU11656 O ALA M 49 41442 37853 35174 -1707 -1226 -1949 O ATOM 11657 CB ALA M 49 70.005 59.359 39.691 1.00292.91 C ANISOU11657 CB ALA M 49 39864 37388 34040 -1628 -1082 -1741 C ATOM 11658 N ALA M 50 70.008 62.235 40.947 1.00305.69 N ANISOU11658 N ALA M 50 41754 38887 35505 -1936 -1063 -1971 N ATOM 11659 CA ALA M 50 69.477 63.286 41.820 1.00305.36 C ANISOU11659 CA ALA M 50 41782 38754 35485 -1991 -1052 -2094 C ATOM 11660 C ALA M 50 69.456 64.663 41.140 1.00301.33 C ANISOU11660 C ALA M 50 41564 37973 34954 -2121 -1076 -2166 C ATOM 11661 O ALA M 50 68.435 65.371 41.180 1.00302.84 O ANISOU11661 O ALA M 50 41894 37903 35267 -2047 -1124 -2229 O ATOM 11662 CB ALA M 50 70.268 63.330 43.113 1.00309.22 C ANISOU11662 CB ALA M 50 42076 39574 35838 -2121 -949 -2146 C ATOM 11663 N VAL M 51 70.576 65.018 40.507 1.00295.10 N ANISOU11663 N VAL M 51 40865 37245 34014 -2308 -1037 -2150 N ATOM 11664 CA VAL M 51 70.735 66.293 39.795 1.00292.02 C ANISOU11664 CA VAL M 51 40756 36609 33587 -2455 -1040 -2194 C ATOM 11665 C VAL M 51 69.729 66.507 38.654 1.00294.74 C ANISOU11665 C VAL M 51 41311 36612 34065 -2300 -1152 -2128 C ATOM 11666 O VAL M 51 69.098 67.572 38.578 1.00303.94 O ANISOU11666 O VAL M 51 42676 37501 35305 -2301 -1170 -2179 O ATOM 11667 CB VAL M 51 72.182 66.472 39.298 1.00287.86 C ANISOU11667 CB VAL M 51 40260 36250 32863 -2688 -972 -2178 C ATOM 11668 CG1 VAL M 51 72.268 67.603 38.296 1.00285.11 C ANISOU11668 CG1 VAL M 51 40217 35617 32493 -2810 -983 -2179 C ATOM 11669 CG2 VAL M 51 73.101 66.745 40.477 1.00289.48 C ANISOU11669 CG2 VAL M 51 40312 36752 32925 -2883 -854 -2286 C ATOM 11670 N ARG M 52 69.575 65.500 37.793 1.00289.50 N ANISOU11670 N ARG M 52 40590 35975 33428 -2164 -1220 -2019 N ATOM 11671 CA ARG M 52 68.570 65.537 36.728 1.00285.36 C ANISOU11671 CA ARG M 52 40216 35189 33016 -1998 -1333 -1957 C ATOM 11672 C ARG M 52 67.126 65.647 37.195 1.00283.38 C ANISOU11672 C ARG M 52 39965 34757 32947 -1795 -1398 -2000 C ATOM 11673 O ARG M 52 66.341 66.384 36.581 1.00278.26 O ANISOU11673 O ARG M 52 39512 33840 32372 -1718 -1469 -1987 O ATOM 11674 CB ARG M 52 68.712 64.347 35.811 1.00284.28 C ANISOU11674 CB ARG M 52 39980 35160 32871 -1906 -1378 -1863 C ATOM 11675 CG ARG M 52 69.857 64.532 34.880 1.00288.53 C ANISOU11675 CG ARG M 52 40613 35769 33245 -2083 -1352 -1813 C ATOM 11676 CD ARG M 52 70.003 63.330 33.995 1.00294.62 C ANISOU11676 CD ARG M 52 41271 36656 34014 -1996 -1386 -1741 C ATOM 11677 NE ARG M 52 71.420 63.025 33.888 1.00305.15 N ANISOU11677 NE ARG M 52 42524 38231 35186 -2172 -1304 -1726 N ATOM 11678 CZ ARG M 52 72.018 62.428 32.858 1.00313.00 C ANISOU11678 CZ ARG M 52 43499 39320 36105 -2203 -1311 -1673 C ATOM 11679 NH1 ARG M 52 71.336 62.061 31.786 1.00313.91 N ANISOU11679 NH1 ARG M 52 43670 39318 36283 -2081 -1397 -1634 N ATOM 11680 NH2 ARG M 52 73.326 62.214 32.890 1.00321.67 N ANISOU11680 NH2 ARG M 52 44512 40652 37054 -2365 -1229 -1670 N ATOM 11681 N GLY M 53 66.788 64.903 38.258 1.00284.11 N ANISOU11681 N GLY M 53 39834 35006 33108 -1704 -1371 -2040 N ATOM 11682 CA GLY M 53 65.464 64.958 38.912 1.00288.70 C ANISOU11682 CA GLY M 53 40376 35460 33854 -1528 -1416 -2101 C ATOM 11683 C GLY M 53 65.046 66.356 39.391 1.00299.58 C ANISOU11683 C GLY M 53 41925 36628 35271 -1582 -1402 -2203 C ATOM 11684 O GLY M 53 63.903 66.776 39.166 1.00302.79 O ANISOU11684 O GLY M 53 42436 36799 35810 -1428 -1478 -2220 O ATOM 11685 N VAL M 54 65.969 67.087 40.038 1.00301.13 N ANISOU11685 N VAL M 54 42146 36911 35357 -1800 -1299 -2278 N ATOM 11686 CA VAL M 54 65.729 68.496 40.477 1.00291.34 C ANISOU11686 CA VAL M 54 41081 35459 34156 -1891 -1256 -2396 C ATOM 11687 C VAL M 54 65.673 69.558 39.337 1.00286.81 C ANISOU11687 C VAL M 54 40816 34564 33594 -1926 -1288 -2346 C ATOM 11688 O VAL M 54 64.888 70.517 39.434 1.00277.02 O ANISOU11688 O VAL M 54 39732 33050 32473 -1866 -1299 -2402 O ATOM 11689 CB VAL M 54 66.686 68.968 41.610 1.00286.50 C ANISOU11689 CB VAL M 54 40380 35052 33423 -2129 -1121 -2525 C ATOM 11690 CG1 VAL M 54 66.280 70.355 42.088 1.00280.76 C ANISOU11690 CG1 VAL M 54 39821 34081 32772 -2204 -1067 -2670 C ATOM 11691 CG2 VAL M 54 66.673 68.001 42.791 1.00283.50 C ANISOU11691 CG2 VAL M 54 39694 34996 33024 -2080 -1089 -2557 C ATOM 11692 N ARG M 55 66.492 69.401 38.284 1.00283.87 N ANISOU11692 N ARG M 55 40528 34226 33103 -2018 -1298 -2237 N ATOM 11693 CA ARG M 55 66.400 70.260 37.081 1.00278.62 C ANISOU11693 CA ARG M 55 40145 33278 32440 -2029 -1339 -2149 C ATOM 11694 C ARG M 55 65.064 70.139 36.404 1.00282.79 C ANISOU11694 C ARG M 55 40739 33597 33109 -1759 -1471 -2073 C ATOM 11695 O ARG M 55 64.590 71.078 35.784 1.00285.97 O ANISOU11695 O ARG M 55 41370 33718 33568 -1711 -1504 -2025 O ATOM 11696 CB ARG M 55 67.433 69.899 36.052 1.00269.25 C ANISOU11696 CB ARG M 55 38995 32213 31094 -2152 -1338 -2041 C ATOM 11697 CG ARG M 55 68.784 70.466 36.363 1.00266.66 C ANISOU11697 CG ARG M 55 38704 32002 30613 -2449 -1207 -2102 C ATOM 11698 CD ARG M 55 69.622 70.421 35.113 1.00264.20 C ANISOU11698 CD ARG M 55 38506 31716 30161 -2561 -1218 -1985 C ATOM 11699 NE ARG M 55 70.795 69.578 35.306 1.00262.49 N ANISOU11699 NE ARG M 55 38090 31852 29788 -2700 -1160 -1996 N ATOM 11700 CZ ARG M 55 70.912 68.311 34.912 1.00257.46 C ANISOU11700 CZ ARG M 55 37276 31421 29123 -2594 -1215 -1924 C ATOM 11701 NH1 ARG M 55 69.917 67.704 34.274 1.00253.09 N ANISOU11701 NH1 ARG M 55 36712 30767 28680 -2360 -1330 -1847 N ATOM 11702 NH2 ARG M 55 72.034 67.644 35.158 1.00255.34 N ANISOU11702 NH2 ARG M 55 36831 31466 28718 -2722 -1148 -1937 N ATOM 11703 N GLN M 56 64.470 68.960 36.503 1.00289.28 N ANISOU11703 N GLN M 56 41356 34569 33986 -1583 -1542 -2057 N ATOM 11704 CA GLN M 56 63.091 68.787 36.096 1.00293.59 C ANISOU11704 CA GLN M 56 41916 34959 34674 -1324 -1661 -2024 C ATOM 11705 C GLN M 56 62.089 69.485 37.057 1.00295.34 C ANISOU11705 C GLN M 56 42154 35011 35049 -1221 -1655 -2137 C ATOM 11706 O GLN M 56 61.257 70.258 36.584 1.00308.53 O ANISOU11706 O GLN M 56 43995 36421 36811 -1093 -1716 -2109 O ATOM 11707 CB GLN M 56 62.773 67.303 35.850 1.00291.88 C ANISOU11707 CB GLN M 56 41479 34946 34476 -1186 -1723 -1986 C ATOM 11708 CG GLN M 56 61.579 67.048 34.926 1.00290.29 C ANISOU11708 CG GLN M 56 41312 34619 34364 -954 -1855 -1927 C ATOM 11709 CD GLN M 56 61.694 67.685 33.541 1.00291.95 C ANISOU11709 CD GLN M 56 41747 34681 34498 -962 -1919 -1807 C ATOM 11710 OE1 GLN M 56 62.784 68.043 33.089 1.00292.64 O ANISOU11710 OE1 GLN M 56 41944 34793 34451 -1151 -1865 -1752 O ATOM 11711 NE2 GLN M 56 60.551 67.814 32.850 1.00291.26 N ANISOU11711 NE2 GLN M 56 41719 34458 34486 -755 -2034 -1761 N ATOM 11712 N ALA M 57 62.186 69.247 38.373 1.00284.99 N ANISOU11712 N ALA M 57 40667 33855 33759 -1274 -1579 -2261 N ATOM 11713 CA ALA M 57 61.283 69.864 39.367 1.00271.79 C ANISOU11713 CA ALA M 57 38986 32056 32224 -1192 -1562 -2391 C ATOM 11714 C ALA M 57 61.243 71.381 39.284 1.00270.29 C ANISOU11714 C ALA M 57 39052 31565 32080 -1263 -1516 -2435 C ATOM 11715 O ALA M 57 60.175 71.959 39.336 1.00267.37 O ANISOU11715 O ALA M 57 38765 30969 31855 -1100 -1562 -2469 O ATOM 11716 CB ALA M 57 61.608 69.402 40.780 1.00264.93 C ANISOU11716 CB ALA M 57 37883 31446 31329 -1282 -1472 -2512 C ATOM 11717 N GLN M 58 62.404 72.004 39.125 1.00272.27 N ANISOU11717 N GLN M 58 39427 31810 32213 -1503 -1421 -2433 N ATOM 11718 CA GLN M 58 62.522 73.434 38.822 1.00285.85 C ANISOU11718 CA GLN M 58 41423 33216 33970 -1595 -1361 -2446 C ATOM 11719 C GLN M 58 61.975 73.895 37.461 1.00305.23 C ANISOU11719 C GLN M 58 44109 35390 36472 -1445 -1458 -2276 C ATOM 11720 O GLN M 58 61.457 75.014 37.364 1.00313.77 O ANISOU11720 O GLN M 58 45393 36155 37669 -1392 -1437 -2284 O ATOM 11721 CB GLN M 58 63.990 73.803 38.788 1.00270.72 C ANISOU11721 CB GLN M 58 39571 31398 31890 -1902 -1238 -2462 C ATOM 11722 CG GLN M 58 64.613 74.231 40.093 1.00259.01 C ANISOU11722 CG GLN M 58 37995 30044 30371 -2121 -1091 -2662 C ATOM 11723 CD GLN M 58 65.948 74.849 39.847 1.00256.07 C ANISOU11723 CD GLN M 58 37745 29697 29853 -2420 -971 -2676 C ATOM 11724 OE1 GLN M 58 66.953 74.156 39.721 1.00251.84 O ANISOU11724 OE1 GLN M 58 37089 29451 29148 -2555 -953 -2637 O ATOM 11725 NE2 GLN M 58 65.968 76.162 39.746 1.00255.89 N ANISOU11725 NE2 GLN M 58 37964 29359 29900 -2525 -882 -2731 N ATOM 11726 N ALA M 59 62.185 73.082 36.410 1.00322.60 N ANISOU11726 N ALA M 59 46283 37714 38573 -1393 -1549 -2124 N ATOM 11727 CA ALA M 59 61.837 73.449 35.002 1.00333.02 C ANISOU11727 CA ALA M 59 47809 38835 39888 -1277 -1642 -1943 C ATOM 11728 C ALA M 59 60.330 73.546 34.775 1.00343.28 C ANISOU11728 C ALA M 59 49124 39962 41344 -971 -1762 -1910 C ATOM 11729 O ALA M 59 59.874 74.361 33.968 1.00346.22 O ANISOU11729 O ALA M 59 49707 40079 41759 -866 -1807 -1792 O ATOM 11730 CB ALA M 59 62.467 72.493 33.985 1.00327.31 C ANISOU11730 CB ALA M 59 47022 38332 39007 -1315 -1702 -1816 C ATOM 11731 N GLU M 60 59.581 72.692 35.482 1.00354.15 N ANISOU11731 N GLU M 60 50269 41491 42799 -829 -1811 -2006 N ATOM 11732 CA GLU M 60 58.107 72.749 35.581 1.00361.71 C ANISOU11732 CA GLU M 60 51193 42323 43916 -550 -1909 -2028 C ATOM 11733 C GLU M 60 57.653 73.337 36.940 1.00368.20 C ANISOU11733 C GLU M 60 51974 43047 44876 -547 -1829 -2211 C ATOM 11734 O GLU M 60 56.468 73.233 37.312 1.00368.75 O ANISOU11734 O GLU M 60 51957 43071 45079 -334 -1894 -2273 O ATOM 11735 CB GLU M 60 57.486 71.362 35.346 1.00356.21 C ANISOU11735 CB GLU M 60 50264 41861 43215 -389 -2018 -2015 C ATOM 11736 CG GLU M 60 57.879 70.313 36.382 1.00347.29 C ANISOU11736 CG GLU M 60 48876 41011 42065 -483 -1957 -2131 C ATOM 11737 CD GLU M 60 57.585 68.906 35.915 1.00340.12 C ANISOU11737 CD GLU M 60 47770 40324 41134 -378 -2036 -2090 C ATOM 11738 OE1 GLU M 60 56.662 68.297 36.486 1.00341.05 O ANISOU11738 OE1 GLU M 60 47716 40510 41357 -230 -2071 -2169 O ATOM 11739 OE2 GLU M 60 58.254 68.422 34.972 1.00334.94 O ANISOU11739 OE2 GLU M 60 47132 39768 40360 -446 -2056 -1987 O ATOM 11740 N ASP M 61 58.617 73.929 37.666 1.00363.81 N ANISOU11740 N ASP M 61 51467 42484 44278 -794 -1685 -2308 N ATOM 11741 CA ASP M 61 58.372 74.785 38.858 1.00342.13 C ANISOU11741 CA ASP M 61 48734 39607 41650 -845 -1579 -2493 C ATOM 11742 C ASP M 61 57.609 74.080 40.019 1.00337.95 C ANISOU11742 C ASP M 61 47942 39263 41200 -739 -1596 -2646 C ATOM 11743 O ASP M 61 56.512 74.513 40.434 1.00340.48 O ANISOU11743 O ASP M 61 48263 39424 41678 -565 -1623 -2728 O ATOM 11744 CB ASP M 61 57.702 76.129 38.448 1.00328.16 C ANISOU11744 CB ASP M 61 47228 37430 40027 -727 -1575 -2459 C ATOM 11745 CG ASP M 61 57.992 77.273 39.425 1.00311.66 C ANISOU11745 CG ASP M 61 45233 35158 38023 -893 -1410 -2641 C ATOM 11746 OD1 ASP M 61 59.145 77.749 39.467 1.00300.13 O ANISOU11746 OD1 ASP M 61 43874 33693 36469 -1162 -1286 -2665 O ATOM 11747 OD2 ASP M 61 57.055 77.718 40.126 1.00308.00 O ANISOU11747 OD2 ASP M 61 44743 34556 37724 -757 -1400 -2769 O ATOM 11748 N ALA M 62 58.212 72.994 40.524 1.00328.64 N ANISOU11748 N ALA M 62 46536 38421 39909 -844 -1575 -2673 N ATOM 11749 CA ALA M 62 57.676 72.207 41.648 1.00323.98 C ANISOU11749 CA ALA M 62 45680 38052 39363 -778 -1574 -2794 C ATOM 11750 C ALA M 62 58.048 72.756 43.052 1.00327.71 C ANISOU11750 C ALA M 62 46077 38601 39837 -954 -1436 -2993 C ATOM 11751 O ALA M 62 59.091 73.397 43.228 1.00339.07 O ANISOU11751 O ALA M 62 47604 40040 41185 -1191 -1323 -3039 O ATOM 11752 CB ALA M 62 58.100 70.744 41.514 1.00313.49 C ANISOU11752 CB ALA M 62 44141 37043 37928 -785 -1610 -2709 C ATOM 11753 N LEU M 63 57.192 72.487 44.037 1.00318.90 N ANISOU11753 N LEU M 63 44785 37569 38812 -847 -1441 -3119 N ATOM 11754 CA LEU M 63 57.419 72.925 45.421 1.00305.32 C ANISOU11754 CA LEU M 63 42956 35963 37088 -1000 -1316 -3322 C ATOM 11755 C LEU M 63 58.170 71.840 46.242 1.00297.34 C ANISOU11755 C LEU M 63 41673 35376 35924 -1128 -1267 -3330 C ATOM 11756 O LEU M 63 58.849 72.143 47.220 1.00294.97 O ANISOU11756 O LEU M 63 41284 35251 35539 -1329 -1150 -3462 O ATOM 11757 CB LEU M 63 56.096 73.430 46.042 1.00295.80 C ANISOU11757 CB LEU M 63 41731 34595 36065 -826 -1336 -3466 C ATOM 11758 CG LEU M 63 55.256 74.178 44.985 1.00288.05 C ANISOU11758 CG LEU M 63 40990 33225 35228 -624 -1422 -3386 C ATOM 11759 CD1 LEU M 63 53.775 74.166 45.311 1.00283.82 C ANISOU11759 CD1 LEU M 63 40378 32599 34861 -368 -1498 -3463 C ATOM 11760 CD2 LEU M 63 55.745 75.591 44.733 1.00283.35 C ANISOU11760 CD2 LEU M 63 40662 32325 34672 -755 -1324 -3426 C ATOM 11761 N ARG M 64 58.063 70.583 45.798 1.00285.60 N ANISOU11761 N ARG M 64 40056 34055 34404 -1011 -1352 -3182 N ATOM 11762 CA ARG M 64 58.979 69.485 46.191 1.00277.10 C ANISOU11762 CA ARG M 64 38766 33344 33176 -1120 -1309 -3115 C ATOM 11763 C ARG M 64 59.178 68.485 45.035 1.00279.85 C ANISOU11763 C ARG M 64 39117 33723 33490 -1030 -1394 -2918 C ATOM 11764 O ARG M 64 58.410 68.497 44.064 1.00279.26 O ANISOU11764 O ARG M 64 39162 33430 33510 -860 -1497 -2848 O ATOM 11765 CB ARG M 64 58.511 68.783 47.474 1.00263.92 C ANISOU11765 CB ARG M 64 36821 31934 31519 -1074 -1279 -3195 C ATOM 11766 CG ARG M 64 57.179 68.059 47.404 1.00253.75 C ANISOU11766 CG ARG M 64 35439 30596 30376 -821 -1376 -3167 C ATOM 11767 CD ARG M 64 57.361 66.662 47.956 1.00247.43 C ANISOU11767 CD ARG M 64 34371 30122 29518 -798 -1356 -3085 C ATOM 11768 NE ARG M 64 58.074 66.651 49.232 1.00243.43 N ANISOU11768 NE ARG M 64 33689 29915 28888 -966 -1243 -3159 N ATOM 11769 CZ ARG M 64 59.022 65.772 49.556 1.00240.54 C ANISOU11769 CZ ARG M 64 33151 29857 28384 -1054 -1186 -3054 C ATOM 11770 NH1 ARG M 64 59.392 64.842 48.690 1.00235.77 N ANISOU11770 NH1 ARG M 64 32539 29277 27764 -996 -1223 -2881 N ATOM 11771 NH2 ARG M 64 59.609 65.827 50.740 1.00241.51 N ANISOU11771 NH2 ARG M 64 33103 30276 28383 -1198 -1087 -3124 N ATOM 11772 N VAL M 65 60.216 67.652 45.099 1.00286.13 N ANISOU11772 N VAL M 65 39780 34791 34145 -1142 -1349 -2834 N ATOM 11773 CA VAL M 65 60.460 66.711 43.986 1.00290.25 C ANISOU11773 CA VAL M 65 40302 35339 34641 -1070 -1415 -2666 C ATOM 11774 C VAL M 65 59.645 65.423 44.185 1.00290.57 C ANISOU11774 C VAL M 65 40135 35496 34771 -880 -1461 -2617 C ATOM 11775 O VAL M 65 59.932 64.618 45.062 1.00283.47 O ANISOU11775 O VAL M 65 39015 34858 33832 -904 -1399 -2607 O ATOM 11776 CB VAL M 65 61.970 66.435 43.688 1.00293.27 C ANISOU11776 CB VAL M 65 40669 35915 34843 -1264 -1349 -2584 C ATOM 11777 CG1 VAL M 65 62.141 65.623 42.410 1.00292.59 C ANISOU11777 CG1 VAL M 65 40616 35807 34745 -1187 -1419 -2433 C ATOM 11778 CG2 VAL M 65 62.765 67.722 43.537 1.00299.86 C ANISOU11778 CG2 VAL M 65 41706 36637 35590 -1472 -1288 -2648 C ATOM 11779 N ASP M 66 58.627 65.258 43.339 1.00299.54 N ANISOU11779 N ASP M 66 41345 36439 36027 -693 -1567 -2584 N ATOM 11780 CA ASP M 66 57.765 64.064 43.280 1.00304.70 C ANISOU11780 CA ASP M 66 41831 37159 36782 -513 -1615 -2546 C ATOM 11781 C ASP M 66 58.125 63.096 42.111 1.00309.01 C ANISOU11781 C ASP M 66 42367 37741 37301 -478 -1652 -2415 C ATOM 11782 O ASP M 66 58.904 63.438 41.194 1.00324.91 O ANISOU11782 O ASP M 66 44528 39699 39220 -570 -1665 -2349 O ATOM 11783 CB ASP M 66 56.308 64.516 43.134 1.00300.60 C ANISOU11783 CB ASP M 66 41376 36426 36412 -327 -1706 -2624 C ATOM 11784 CG ASP M 66 55.401 63.904 44.162 1.00292.95 C ANISOU11784 CG ASP M 66 40198 35566 35542 -221 -1690 -2700 C ATOM 11785 OD1 ASP M 66 55.303 62.667 44.248 1.00287.56 O ANISOU11785 OD1 ASP M 66 39337 35039 34884 -167 -1673 -2641 O ATOM 11786 OD2 ASP M 66 54.776 64.691 44.892 1.00288.63 O ANISOU11786 OD2 ASP M 66 39669 34942 35054 -196 -1686 -2823 O ATOM 11787 N VAL M 67 57.528 61.901 42.123 1.00297.43 N ANISOU11787 N VAL M 67 40728 36359 35921 -350 -1663 -2388 N ATOM 11788 CA VAL M 67 57.858 60.854 41.133 1.00280.95 C ANISOU11788 CA VAL M 67 38596 34325 33825 -323 -1675 -2289 C ATOM 11789 C VAL M 67 57.662 61.280 39.649 1.00281.24 C ANISOU11789 C VAL M 67 38826 34183 33847 -282 -1778 -2257 C ATOM 11790 O VAL M 67 58.429 60.840 38.778 1.00288.61 O ANISOU11790 O VAL M 67 39783 35170 34705 -345 -1772 -2179 O ATOM 11791 CB VAL M 67 57.158 59.502 41.458 1.00266.99 C ANISOU11791 CB VAL M 67 36607 32657 32180 -195 -1650 -2283 C ATOM 11792 CG1 VAL M 67 58.083 58.332 41.163 1.00255.03 C ANISOU11792 CG1 VAL M 67 34971 31298 30628 -246 -1573 -2179 C ATOM 11793 CG2 VAL M 67 56.728 59.448 42.920 1.00263.55 C ANISOU11793 CG2 VAL M 67 36021 32322 31794 -176 -1590 -2342 C ATOM 11794 N ASP M 68 56.665 62.145 39.382 1.00270.84 N ANISOU11794 N ASP M 68 37639 32671 32594 -176 -1868 -2314 N ATOM 11795 CA ASP M 68 56.410 62.709 38.038 1.00259.74 C ANISOU11795 CA ASP M 68 36423 31101 31162 -123 -1971 -2270 C ATOM 11796 C ASP M 68 57.697 63.221 37.347 1.00260.10 C ANISOU11796 C ASP M 68 36629 31140 31055 -295 -1946 -2183 C ATOM 11797 O ASP M 68 57.994 62.827 36.212 1.00252.93 O ANISOU11797 O ASP M 68 35759 30253 30088 -301 -1985 -2110 O ATOM 11798 CB ASP M 68 55.326 63.821 38.106 1.00251.16 C ANISOU11798 CB ASP M 68 35467 29803 30156 2 -2050 -2332 C ATOM 11799 CG ASP M 68 53.930 63.304 38.555 1.00242.84 C ANISOU11799 CG ASP M 68 34259 28758 29248 190 -2095 -2422 C ATOM 11800 OD1 ASP M 68 53.793 62.142 39.008 1.00237.46 O ANISOU11800 OD1 ASP M 68 33371 28236 28616 208 -2048 -2445 O ATOM 11801 OD2 ASP M 68 52.960 64.087 38.452 1.00237.82 O ANISOU11801 OD2 ASP M 68 33712 27964 28683 322 -2171 -2469 O ATOM 11802 N GLN M 69 58.454 64.071 38.047 1.00266.01 N ANISOU11802 N GLN M 69 37457 31875 31738 -446 -1873 -2204 N ATOM 11803 CA GLN M 69 59.721 64.632 37.550 1.00270.61 C ANISOU11803 CA GLN M 69 38185 32460 32172 -637 -1830 -2140 C ATOM 11804 C GLN M 69 60.823 63.606 37.412 1.00272.49 C ANISOU11804 C GLN M 69 38289 32931 32312 -748 -1765 -2080 C ATOM 11805 O GLN M 69 61.479 63.549 36.372 1.00268.45 O ANISOU11805 O GLN M 69 37865 32428 31704 -818 -1782 -2004 O ATOM 11806 CB GLN M 69 60.235 65.739 38.461 1.00275.29 C ANISOU11806 CB GLN M 69 38868 33003 32726 -785 -1749 -2209 C ATOM 11807 CG GLN M 69 59.458 67.035 38.388 1.00283.12 C ANISOU11807 CG GLN M 69 40060 33714 33797 -719 -1793 -2254 C ATOM 11808 CD GLN M 69 58.359 67.115 39.419 1.00290.07 C ANISOU11808 CD GLN M 69 40836 34557 34818 -586 -1799 -2371 C ATOM 11809 OE1 GLN M 69 58.469 66.570 40.525 1.00297.40 O ANISOU11809 OE1 GLN M 69 41571 35673 35754 -623 -1733 -2441 O ATOM 11810 NE2 GLN M 69 57.287 67.818 39.071 1.00293.29 N ANISOU11810 NE2 GLN M 69 41370 34732 35335 -425 -1879 -2387 N ATOM 11811 N LEU M 70 61.051 62.841 38.483 1.00280.48 N ANISOU11811 N LEU M 70 39090 34136 33344 -765 -1685 -2110 N ATOM 11812 CA LEU M 70 61.981 61.693 38.490 1.00284.18 C ANISOU11812 CA LEU M 70 39388 34836 33749 -828 -1614 -2046 C ATOM 11813 C LEU M 70 61.801 60.822 37.244 1.00283.10 C ANISOU11813 C LEU M 70 39236 34688 33640 -743 -1668 -1987 C ATOM 11814 O LEU M 70 62.759 60.518 36.504 1.00286.98 O ANISOU11814 O LEU M 70 39746 35264 34029 -840 -1645 -1925 O ATOM 11815 CB LEU M 70 61.741 60.815 39.736 1.00283.87 C ANISOU11815 CB LEU M 70 39104 34968 33784 -767 -1544 -2068 C ATOM 11816 CG LEU M 70 62.491 59.467 39.843 1.00277.67 C ANISOU11816 CG LEU M 70 38114 34407 32980 -777 -1462 -1985 C ATOM 11817 CD1 LEU M 70 63.828 59.652 40.555 1.00270.87 C ANISOU11817 CD1 LEU M 70 37192 33761 31964 -950 -1365 -1956 C ATOM 11818 CD2 LEU M 70 61.669 58.339 40.486 1.00271.93 C ANISOU11818 CD2 LEU M 70 37176 33741 32402 -623 -1433 -1983 C ATOM 11819 N GLU M 71 60.561 60.414 37.023 1.00274.95 N ANISOU11819 N GLU M 71 38159 33565 32742 -567 -1736 -2022 N ATOM 11820 CA GLU M 71 60.276 59.515 35.928 1.00263.02 C ANISOU11820 CA GLU M 71 36602 32064 31268 -486 -1778 -1997 C ATOM 11821 C GLU M 71 60.381 60.191 34.553 1.00260.16 C ANISOU11821 C GLU M 71 36441 31593 30812 -514 -1867 -1958 C ATOM 11822 O GLU M 71 60.639 59.525 33.549 1.00255.35 O ANISOU11822 O GLU M 71 35804 31046 30168 -520 -1880 -1928 O ATOM 11823 CB GLU M 71 58.973 58.784 36.180 1.00262.77 C ANISOU11823 CB GLU M 71 36431 32005 31402 -309 -1806 -2060 C ATOM 11824 CG GLU M 71 59.123 57.862 37.376 1.00265.80 C ANISOU11824 CG GLU M 71 36597 32532 31859 -302 -1695 -2062 C ATOM 11825 CD GLU M 71 57.790 57.326 37.863 1.00269.65 C ANISOU11825 CD GLU M 71 36958 32982 32512 -144 -1711 -2133 C ATOM 11826 OE1 GLU M 71 56.736 57.829 37.415 1.00273.30 O ANISOU11826 OE1 GLU M 71 37505 33312 33025 -41 -1813 -2196 O ATOM 11827 OE2 GLU M 71 57.781 56.399 38.692 1.00270.08 O ANISOU11827 OE2 GLU M 71 36825 33146 32645 -119 -1618 -2122 O ATOM 11828 N LYS M 72 60.253 61.519 34.517 1.00263.06 N ANISOU11828 N LYS M 72 37009 31806 31133 -542 -1916 -1953 N ATOM 11829 CA LYS M 72 60.647 62.282 33.314 1.00271.09 C ANISOU11829 CA LYS M 72 38237 32734 32031 -608 -1974 -1882 C ATOM 11830 C LYS M 72 62.192 62.330 33.040 1.00281.25 C ANISOU11830 C LYS M 72 39567 34135 33157 -822 -1897 -1823 C ATOM 11831 O LYS M 72 62.594 62.667 31.913 1.00290.99 O ANISOU11831 O LYS M 72 40937 35340 34282 -884 -1937 -1757 O ATOM 11832 CB LYS M 72 59.983 63.679 33.288 1.00267.80 C ANISOU11832 CB LYS M 72 38030 32087 31634 -555 -2041 -1879 C ATOM 11833 CG LYS M 72 58.474 63.617 33.070 1.00264.59 C ANISOU11833 CG LYS M 72 37597 31582 31352 -329 -2146 -1915 C ATOM 11834 CD LYS M 72 57.795 64.978 33.003 1.00269.48 C ANISOU11834 CD LYS M 72 38419 31967 32003 -249 -2210 -1900 C ATOM 11835 CE LYS M 72 56.305 64.785 33.251 1.00271.03 C ANISOU11835 CE LYS M 72 38521 32112 32344 -23 -2289 -1971 C ATOM 11836 NZ LYS M 72 55.511 66.039 33.146 1.00276.71 N ANISOU11836 NZ LYS M 72 39420 32603 33114 96 -2357 -1953 N ATOM 11837 N VAL M 73 63.027 61.982 34.043 1.00283.01 N ANISOU11837 N VAL M 73 39665 34508 33356 -930 -1788 -1844 N ATOM 11838 CA VAL M 73 64.525 62.000 33.942 1.00278.36 C ANISOU11838 CA VAL M 73 39086 34065 32610 -1135 -1705 -1802 C ATOM 11839 C VAL M 73 65.199 60.610 33.852 1.00276.11 C ANISOU11839 C VAL M 73 38589 34003 32315 -1145 -1640 -1779 C ATOM 11840 O VAL M 73 66.423 60.500 33.677 1.00271.86 O ANISOU11840 O VAL M 73 38036 33607 31648 -1296 -1575 -1744 O ATOM 11841 CB VAL M 73 65.216 62.865 35.050 1.00274.36 C ANISOU11841 CB VAL M 73 38617 33587 32038 -1289 -1621 -1840 C ATOM 11842 CG1 VAL M 73 64.509 64.202 35.229 1.00273.64 C ANISOU11842 CG1 VAL M 73 38725 33252 31991 -1271 -1664 -1879 C ATOM 11843 CG2 VAL M 73 65.314 62.129 36.380 1.00272.58 C ANISOU11843 CG2 VAL M 73 38157 33545 31863 -1267 -1540 -1881 C ATOM 11844 N LEU M 74 64.391 59.559 33.948 1.00272.64 N ANISOU11844 N LEU M 74 37986 33585 32017 -984 -1650 -1802 N ATOM 11845 CA LEU M 74 64.874 58.186 33.769 1.00268.21 C ANISOU11845 CA LEU M 74 37230 33190 31485 -966 -1582 -1781 C ATOM 11846 C LEU M 74 65.496 57.850 32.379 1.00282.89 C ANISOU11846 C LEU M 74 39134 35097 33253 -1032 -1597 -1752 C ATOM 11847 O LEU M 74 66.532 57.167 32.323 1.00276.78 O ANISOU11847 O LEU M 74 38252 34486 32424 -1110 -1513 -1723 O ATOM 11848 CB LEU M 74 63.760 57.173 34.079 1.00248.84 C ANISOU11848 CB LEU M 74 34611 30714 29222 -784 -1582 -1823 C ATOM 11849 CG LEU M 74 63.019 57.119 35.414 1.00236.28 C ANISOU11849 CG LEU M 74 32917 29108 27748 -691 -1556 -1855 C ATOM 11850 CD1 LEU M 74 62.248 55.811 35.494 1.00227.38 C ANISOU11850 CD1 LEU M 74 31601 27997 26794 -546 -1522 -1880 C ATOM 11851 CD2 LEU M 74 63.984 57.233 36.578 1.00235.91 C ANISOU11851 CD2 LEU M 74 32789 29218 27626 -796 -1457 -1817 C ATOM 11852 N PRO M 75 64.851 58.295 31.251 1.00304.29 N ANISOU11852 N PRO M 75 41989 37683 35943 -991 -1704 -1759 N ATOM 11853 CA PRO M 75 65.277 57.804 29.901 1.00313.50 C ANISOU11853 CA PRO M 75 43162 38922 37033 -1036 -1721 -1748 C ATOM 11854 C PRO M 75 66.726 58.103 29.561 1.00312.69 C ANISOU11854 C PRO M 75 43120 38933 36752 -1230 -1666 -1697 C ATOM 11855 O PRO M 75 67.474 57.212 29.162 1.00320.75 O ANISOU11855 O PRO M 75 44020 40102 37748 -1277 -1601 -1700 O ATOM 11856 CB PRO M 75 64.360 58.546 28.906 1.00322.32 C ANISOU11856 CB PRO M 75 44447 39898 38119 -970 -1853 -1743 C ATOM 11857 CG PRO M 75 63.435 59.404 29.704 1.00326.50 C ANISOU11857 CG PRO M 75 45062 40264 38727 -877 -1905 -1752 C ATOM 11858 CD PRO M 75 63.648 59.157 31.178 1.00318.85 C ANISOU11858 CD PRO M 75 43969 39338 37840 -884 -1812 -1779 C ATOM 11859 N GLN M 76 67.092 59.365 29.740 1.00302.98 N ANISOU11859 N GLN M 76 42077 37630 35411 -1342 -1685 -1659 N ATOM 11860 CA GLN M 76 68.389 59.874 29.363 1.00290.43 C ANISOU11860 CA GLN M 76 40581 36129 33639 -1545 -1640 -1617 C ATOM 11861 C GLN M 76 69.487 59.331 30.262 1.00278.64 C ANISOU11861 C GLN M 76 38923 34833 32113 -1637 -1519 -1624 C ATOM 11862 O GLN M 76 70.595 59.184 29.803 1.00274.61 O ANISOU11862 O GLN M 76 38399 34466 31474 -1774 -1469 -1604 O ATOM 11863 CB GLN M 76 68.383 61.407 29.350 1.00293.97 C ANISOU11863 CB GLN M 76 41282 36413 34000 -1640 -1679 -1582 C ATOM 11864 CG GLN M 76 69.546 62.031 28.600 1.00298.73 C ANISOU11864 CG GLN M 76 42025 37071 34407 -1851 -1651 -1533 C ATOM 11865 CD GLN M 76 69.635 61.527 27.179 1.00300.13 C ANISOU11865 CD GLN M 76 42209 37315 34512 -1848 -1701 -1501 C ATOM 11866 OE1 GLN M 76 68.678 61.625 26.414 1.00302.42 O ANISOU11866 OE1 GLN M 76 42569 37497 34838 -1727 -1800 -1480 O ATOM 11867 NE2 GLN M 76 70.786 60.982 26.818 1.00298.03 N ANISOU11867 NE2 GLN M 76 41857 37246 34134 -1981 -1633 -1505 N ATOM 11868 N LEU M 77 69.181 59.020 31.520 1.00270.63 N ANISOU11868 N LEU M 77 37774 33845 31207 -1558 -1472 -1647 N ATOM 11869 CA LEU M 77 70.167 58.416 32.412 1.00272.31 C ANISOU11869 CA LEU M 77 37801 34276 31386 -1618 -1358 -1635 C ATOM 11870 C LEU M 77 70.610 57.018 31.951 1.00278.77 C ANISOU11870 C LEU M 77 38428 35241 32248 -1562 -1300 -1618 C ATOM 11871 O LEU M 77 71.805 56.733 31.943 1.00286.92 O ANISOU11871 O LEU M 77 39382 36462 33172 -1671 -1224 -1592 O ATOM 11872 CB LEU M 77 69.666 58.399 33.854 1.00267.47 C ANISOU11872 CB LEU M 77 37081 33671 30872 -1537 -1324 -1653 C ATOM 11873 CG LEU M 77 70.628 57.868 34.923 1.00265.11 C ANISOU11873 CG LEU M 77 36580 33625 30524 -1587 -1209 -1624 C ATOM 11874 CD1 LEU M 77 71.934 58.651 35.028 1.00262.26 C ANISOU11874 CD1 LEU M 77 36280 33412 29953 -1810 -1159 -1626 C ATOM 11875 CD2 LEU M 77 69.937 57.860 36.277 1.00265.88 C ANISOU11875 CD2 LEU M 77 36575 33726 30721 -1493 -1189 -1641 C ATOM 11876 N LEU M 78 69.649 56.177 31.559 1.00282.75 N ANISOU11876 N LEU M 78 38858 35659 32913 -1399 -1330 -1642 N ATOM 11877 CA LEU M 78 69.886 54.845 30.943 1.00288.04 C ANISOU11877 CA LEU M 78 39364 36418 33658 -1338 -1272 -1650 C ATOM 11878 C LEU M 78 70.759 54.809 29.680 1.00299.52 C ANISOU11878 C LEU M 78 40873 37956 34974 -1462 -1273 -1656 C ATOM 11879 O LEU M 78 71.478 53.834 29.441 1.00296.07 O ANISOU11879 O LEU M 78 40283 37654 34553 -1466 -1186 -1656 O ATOM 11880 CB LEU M 78 68.556 54.234 30.531 1.00281.52 C ANISOU11880 CB LEU M 78 38502 35453 33010 -1174 -1321 -1707 C ATOM 11881 CG LEU M 78 67.758 53.484 31.583 1.00276.83 C ANISOU11881 CG LEU M 78 37746 34821 32612 -1018 -1271 -1713 C ATOM 11882 CD1 LEU M 78 66.282 53.535 31.244 1.00272.42 C ANISOU11882 CD1 LEU M 78 37236 34093 32175 -893 -1362 -1783 C ATOM 11883 CD2 LEU M 78 68.277 52.057 31.608 1.00277.45 C ANISOU11883 CD2 LEU M 78 37610 35009 32797 -967 -1142 -1700 C ATOM 11884 N LEU M 79 70.633 55.843 28.848 1.00315.57 N ANISOU11884 N LEU M 79 43119 39900 36880 -1552 -1369 -1658 N ATOM 11885 CA LEU M 79 71.327 55.930 27.541 1.00324.35 C ANISOU11885 CA LEU M 79 44306 41085 37844 -1675 -1386 -1662 C ATOM 11886 C LEU M 79 72.817 56.307 27.682 1.00322.84 C ANISOU11886 C LEU M 79 44129 41063 37472 -1867 -1314 -1626 C ATOM 11887 O LEU M 79 73.667 55.842 26.918 1.00312.16 O ANISOU11887 O LEU M 79 42722 39851 36033 -1951 -1272 -1638 O ATOM 11888 CB LEU M 79 70.590 56.924 26.618 1.00329.54 C ANISOU11888 CB LEU M 79 45188 41590 38429 -1689 -1514 -1652 C ATOM 11889 CG LEU M 79 69.071 56.797 26.395 1.00331.53 C ANISOU11889 CG LEU M 79 45452 41688 38823 -1508 -1606 -1688 C ATOM 11890 CD1 LEU M 79 68.474 57.999 25.660 1.00333.64 C ANISOU11890 CD1 LEU M 79 45955 41817 38995 -1521 -1730 -1643 C ATOM 11891 CD2 LEU M 79 68.761 55.485 25.698 1.00327.94 C ANISOU11891 CD2 LEU M 79 44822 41310 38469 -1422 -1582 -1765 C ATOM 11892 N ASP M 80 73.105 57.159 28.667 1.00330.93 N ANISOU11892 N ASP M 80 45217 42081 38438 -1942 -1297 -1597 N ATOM 11893 CA ASP M 80 74.474 57.525 29.065 1.00338.81 C ANISOU11893 CA ASP M 80 46199 43263 39270 -2124 -1217 -1579 C ATOM 11894 C ASP M 80 75.219 56.341 29.747 1.00334.37 C ANISOU11894 C ASP M 80 45367 42921 38754 -2072 -1104 -1569 C ATOM 11895 O ASP M 80 76.442 56.355 29.882 1.00336.56 O ANISOU11895 O ASP M 80 45580 43404 38891 -2204 -1032 -1558 O ATOM 11896 CB ASP M 80 74.448 58.767 29.990 1.00348.90 C ANISOU11896 CB ASP M 80 47609 44469 40489 -2216 -1223 -1576 C ATOM 11897 CG ASP M 80 74.086 60.081 29.251 1.00352.52 C ANISOU11897 CG ASP M 80 48353 44723 40864 -2312 -1306 -1566 C ATOM 11898 OD1 ASP M 80 74.217 60.155 28.008 1.00349.66 O ANISOU11898 OD1 ASP M 80 48091 44340 40422 -2363 -1349 -1546 O ATOM 11899 OD2 ASP M 80 73.680 61.058 29.928 1.00360.48 O ANISOU11899 OD2 ASP M 80 49484 45594 41888 -2336 -1320 -1576 O ATOM 11900 N PHE M 81 74.464 55.333 30.183 1.00323.61 N ANISOU11900 N PHE M 81 43847 41518 37591 -1875 -1084 -1568 N ATOM 11901 CA PHE M 81 75.010 54.136 30.812 1.00310.94 C ANISOU11901 CA PHE M 81 41989 40086 36068 -1787 -971 -1535 C ATOM 11902 C PHE M 81 74.540 52.890 30.074 1.00306.32 C ANISOU11902 C PHE M 81 41291 39443 35653 -1646 -946 -1564 C ATOM 11903 O PHE M 81 74.979 51.778 30.372 1.00304.58 O ANISOU11903 O PHE M 81 40865 39334 35527 -1561 -841 -1536 O ATOM 11904 CB PHE M 81 74.567 54.048 32.275 1.00305.45 C ANISOU11904 CB PHE M 81 41187 39399 35469 -1683 -937 -1495 C ATOM 11905 CG PHE M 81 75.352 54.923 33.213 1.00296.34 C ANISOU11905 CG PHE M 81 40046 38400 34147 -1823 -910 -1474 C ATOM 11906 CD1 PHE M 81 76.747 54.912 33.199 1.00288.91 C ANISOU11906 CD1 PHE M 81 39029 37708 33034 -1959 -839 -1455 C ATOM 11907 CD2 PHE M 81 74.690 55.738 34.151 1.00292.16 C ANISOU11907 CD2 PHE M 81 39588 37786 33631 -1821 -946 -1490 C ATOM 11908 CE1 PHE M 81 77.455 55.710 34.091 1.00281.88 C ANISOU11908 CE1 PHE M 81 38133 36986 31982 -2100 -806 -1456 C ATOM 11909 CE2 PHE M 81 75.397 56.546 35.040 1.00283.92 C ANISOU11909 CE2 PHE M 81 38544 36899 32433 -1964 -910 -1497 C ATOM 11910 CZ PHE M 81 76.785 56.529 35.006 1.00281.03 C ANISOU11910 CZ PHE M 81 38099 36790 31889 -2109 -839 -1482 C TER 11911 PHE M 81 ATOM 11912 N SER N 8 61.651 41.523 0.769 1.00276.18 N ANISOU11912 N SER N 8 36976 41671 26287 5625 -1088 -1476 N ATOM 11913 CA SER N 8 60.967 42.059 1.981 1.00275.48 C ANISOU11913 CA SER N 8 36513 41642 26514 5696 -1237 -1399 C ATOM 11914 C SER N 8 61.969 42.349 3.090 1.00272.69 C ANISOU11914 C SER N 8 36251 41021 26335 5349 -758 -637 C ATOM 11915 O SER N 8 62.399 41.458 3.845 1.00270.80 O ANISOU11915 O SER N 8 35575 40630 26687 4912 -270 -450 O ATOM 11916 CB SER N 8 59.853 41.111 2.445 1.00274.24 C ANISOU11916 CB SER N 8 35458 41658 27083 5577 -1223 -2059 C ATOM 11917 OG SER N 8 59.400 41.457 3.743 1.00270.19 O ANISOU11917 OG SER N 8 34590 41122 26945 5467 -1130 -1939 O ATOM 11918 N GLY N 9 62.363 43.615 3.152 1.00275.76 N ANISOU11918 N GLY N 9 37254 41332 26187 5557 -928 -198 N ATOM 11919 CA GLY N 9 63.348 44.079 4.135 1.00280.09 C ANISOU11919 CA GLY N 9 37959 41654 26808 5263 -550 494 C ATOM 11920 C GLY N 9 64.819 44.217 3.750 1.00288.31 C ANISOU11920 C GLY N 9 39508 42422 27615 5058 -167 1004 C ATOM 11921 O GLY N 9 65.161 44.285 2.562 1.00284.27 O ANISOU11921 O GLY N 9 39489 41861 26659 5190 -186 892 O ATOM 11922 N PHE N 10 65.672 44.181 4.790 1.00304.71 N ANISOU11922 N PHE N 10 41427 44313 30033 4698 196 1514 N ATOM 11923 CA PHE N 10 67.063 44.715 4.824 1.00320.27 C ANISOU11923 CA PHE N 10 43826 46014 31846 4512 518 2047 C ATOM 11924 C PHE N 10 68.071 44.117 3.823 1.00319.70 C ANISOU11924 C PHE N 10 43936 45723 31810 4347 889 2023 C ATOM 11925 O PHE N 10 68.370 42.903 3.853 1.00326.60 O ANISOU11925 O PHE N 10 44313 46501 33276 4087 1158 1923 O ATOM 11926 CB PHE N 10 67.643 44.691 6.269 1.00326.83 C ANISOU11926 CB PHE N 10 44329 46737 33113 4162 722 2525 C ATOM 11927 CG PHE N 10 67.006 45.690 7.225 1.00319.22 C ANISOU11927 CG PHE N 10 43430 45916 31943 4259 483 2643 C ATOM 11928 CD1 PHE N 10 65.839 45.373 7.922 1.00317.64 C ANISOU11928 CD1 PHE N 10 42786 45913 31987 4263 315 2359 C ATOM 11929 CD2 PHE N 10 67.591 46.938 7.458 1.00317.55 C ANISOU11929 CD2 PHE N 10 43700 45610 31344 4296 501 2992 C ATOM 11930 CE1 PHE N 10 65.252 46.287 8.796 1.00315.74 C ANISOU11930 CE1 PHE N 10 42584 45778 31604 4310 167 2400 C ATOM 11931 CE2 PHE N 10 67.000 47.854 8.326 1.00318.32 C ANISOU11931 CE2 PHE N 10 43840 45819 31287 4362 327 3053 C ATOM 11932 CZ PHE N 10 65.829 47.529 8.993 1.00316.76 C ANISOU11932 CZ PHE N 10 43195 45821 31336 4368 161 2750 C ATOM 11933 N ARG N 11 68.559 44.996 2.938 1.00310.65 N ANISOU11933 N ARG N 11 43535 44462 30035 4488 936 2091 N ATOM 11934 CA ARG N 11 69.639 44.688 2.005 1.00297.19 C ANISOU11934 CA ARG N 11 42140 42494 28284 4275 1398 2073 C ATOM 11935 C ARG N 11 70.929 44.546 2.773 1.00282.93 C ANISOU11935 C ARG N 11 40042 40403 27055 3890 1842 2476 C ATOM 11936 O ARG N 11 71.200 45.288 3.743 1.00277.75 O ANISOU11936 O ARG N 11 39380 39722 26427 3849 1783 2859 O ATOM 11937 CB ARG N 11 69.807 45.766 0.897 1.00295.66 C ANISOU11937 CB ARG N 11 42954 42202 27178 4488 1384 2058 C ATOM 11938 CG ARG N 11 68.915 45.621 -0.336 1.00288.39 C ANISOU11938 CG ARG N 11 42455 41466 25652 4798 1032 1591 C ATOM 11939 CD ARG N 11 69.604 46.075 -1.632 1.00277.00 C ANISOU11939 CD ARG N 11 41991 39780 23475 4746 1343 1554 C ATOM 11940 NE ARG N 11 69.807 47.519 -1.715 1.00264.63 N ANISOU11940 NE ARG N 11 41294 38039 21211 4939 1277 1906 N ATOM 11941 CZ ARG N 11 68.973 48.374 -2.305 1.00260.67 C ANISOU11941 CZ ARG N 11 41532 37623 19886 5408 720 1866 C ATOM 11942 NH1 ARG N 11 67.843 47.967 -2.876 1.00259.46 N ANISOU11942 NH1 ARG N 11 41327 37774 19480 5757 105 1450 N ATOM 11943 NH2 ARG N 11 69.274 49.659 -2.317 1.00256.11 N ANISOU11943 NH2 ARG N 11 41743 36801 18763 5542 755 2229 N ATOM 11944 N LYS N 12 71.696 43.566 2.323 1.00268.08 N ANISOU11944 N LYS N 12 37886 38305 25666 3615 2263 2338 N ATOM 11945 CA LYS N 12 73.048 43.335 2.747 1.00254.87 C ANISOU11945 CA LYS N 12 35932 36297 24608 3272 2697 2604 C ATOM 11946 C LYS N 12 73.827 44.688 2.701 1.00257.84 C ANISOU11946 C LYS N 12 36934 36509 24522 3244 2880 2865 C ATOM 11947 O LYS N 12 74.338 45.179 3.739 1.00256.39 O ANISOU11947 O LYS N 12 36561 36268 24586 3137 2843 3236 O ATOM 11948 CB LYS N 12 73.622 42.203 1.857 1.00247.44 C ANISOU11948 CB LYS N 12 34752 35124 24140 3044 3154 2249 C ATOM 11949 CG LYS N 12 73.275 40.793 2.336 1.00238.13 C ANISOU11949 CG LYS N 12 32758 33953 23766 2954 3098 2142 C ATOM 11950 CD LYS N 12 71.942 40.248 1.845 1.00233.98 C ANISOU11950 CD LYS N 12 32179 33740 22981 3152 2822 1708 C ATOM 11951 CE LYS N 12 72.163 39.334 0.670 1.00234.60 C ANISOU11951 CE LYS N 12 32214 33685 23235 3000 3214 1208 C ATOM 11952 NZ LYS N 12 72.569 37.993 1.162 1.00232.76 N ANISOU11952 NZ LYS N 12 31173 33191 24073 2753 3481 1204 N ATOM 11953 N GLU N 13 73.829 45.322 1.522 1.00261.57 N ANISOU11953 N GLU N 13 38207 36915 24260 3340 3051 2662 N ATOM 11954 CA GLU N 13 74.460 46.653 1.293 1.00259.34 C ANISOU11954 CA GLU N 13 38682 36428 23427 3318 3294 2859 C ATOM 11955 C GLU N 13 74.005 47.815 2.249 1.00255.39 C ANISOU11955 C GLU N 13 38351 36080 22606 3535 2899 3218 C ATOM 11956 O GLU N 13 74.833 48.645 2.674 1.00258.43 O ANISOU11956 O GLU N 13 38915 36262 23013 3368 3164 3463 O ATOM 11957 CB GLU N 13 74.321 47.038 -0.195 1.00259.05 C ANISOU11957 CB GLU N 13 39605 36291 22530 3411 3485 2581 C ATOM 11958 CG GLU N 13 75.076 48.288 -0.622 1.00257.77 C ANISOU11958 CG GLU N 13 40338 35805 21796 3311 3905 2738 C ATOM 11959 CD GLU N 13 74.172 49.438 -1.053 1.00259.16 C ANISOU11959 CD GLU N 13 41465 36075 20928 3741 3472 2853 C ATOM 11960 OE1 GLU N 13 74.587 50.173 -1.976 1.00266.60 O ANISOU11960 OE1 GLU N 13 43408 36719 21169 3681 3844 2843 O ATOM 11961 OE2 GLU N 13 73.056 49.620 -0.500 1.00255.44 O ANISOU11961 OE2 GLU N 13 40780 35930 20344 4132 2784 2937 O ATOM 11962 N LEU N 14 72.705 47.855 2.580 1.00246.93 N ANISOU11962 N LEU N 14 37177 35346 21299 3877 2311 3182 N ATOM 11963 CA LEU N 14 72.076 48.909 3.416 1.00234.26 C ANISOU11963 CA LEU N 14 35709 33893 19403 4106 1929 3420 C ATOM 11964 C LEU N 14 72.722 49.057 4.763 1.00230.55 C ANISOU11964 C LEU N 14 34747 33390 19462 3824 2031 3756 C ATOM 11965 O LEU N 14 73.107 50.144 5.203 1.00229.77 O ANISOU11965 O LEU N 14 34963 33191 19148 3788 2118 3990 O ATOM 11966 CB LEU N 14 70.599 48.568 3.652 1.00224.00 C ANISOU11966 CB LEU N 14 34093 32952 18064 4434 1347 3200 C ATOM 11967 CG LEU N 14 69.751 49.209 4.757 1.00213.45 C ANISOU11967 CG LEU N 14 32541 31822 16735 4600 960 3319 C ATOM 11968 CD1 LEU N 14 69.729 50.726 4.696 1.00211.56 C ANISOU11968 CD1 LEU N 14 33010 31463 15907 4825 887 3504 C ATOM 11969 CD2 LEU N 14 68.354 48.692 4.550 1.00212.76 C ANISOU11969 CD2 LEU N 14 32164 32026 16646 4910 491 2913 C ATOM 11970 N VAL N 15 72.788 47.934 5.430 1.00228.80 N ANISOU11970 N VAL N 15 33765 33247 19919 3628 1991 3769 N ATOM 11971 CA VAL N 15 73.325 47.917 6.720 1.00227.53 C ANISOU11971 CA VAL N 15 33146 33076 20229 3371 1982 4089 C ATOM 11972 C VAL N 15 74.804 48.305 6.642 1.00234.29 C ANISOU11972 C VAL N 15 34106 33612 21301 3090 2416 4235 C ATOM 11973 O VAL N 15 75.301 49.051 7.488 1.00232.58 O ANISOU11973 O VAL N 15 33883 33369 21116 2950 2418 4483 O ATOM 11974 CB VAL N 15 73.096 46.545 7.316 1.00222.83 C ANISOU11974 CB VAL N 15 31823 32559 20281 3235 1852 4085 C ATOM 11975 CG1 VAL N 15 73.530 46.570 8.750 1.00220.71 C ANISOU11975 CG1 VAL N 15 31185 32299 20373 2988 1732 4464 C ATOM 11976 CG2 VAL N 15 71.615 46.206 7.225 1.00220.12 C ANISOU11976 CG2 VAL N 15 31396 32504 19733 3489 1520 3812 C ATOM 11977 N SER N 16 75.485 47.836 5.598 1.00244.40 N ANISOU11977 N SER N 16 35485 34645 22731 2988 2817 4015 N ATOM 11978 CA SER N 16 76.905 48.155 5.371 1.00250.18 C ANISOU11978 CA SER N 16 36281 35022 23754 2691 3333 4021 C ATOM 11979 C SER N 16 77.171 49.646 5.277 1.00253.11 C ANISOU11979 C SER N 16 37347 35287 23534 2703 3526 4117 C ATOM 11980 O SER N 16 78.027 50.179 5.989 1.00253.57 O ANISOU11980 O SER N 16 37236 35225 23883 2476 3671 4272 O ATOM 11981 CB SER N 16 77.417 47.483 4.089 1.00253.45 C ANISOU11981 CB SER N 16 36812 35174 24312 2571 3821 3663 C ATOM 11982 OG SER N 16 78.669 48.031 3.680 1.00250.66 O ANISOU11982 OG SER N 16 36696 34447 24095 2283 4425 3568 O ATOM 11983 N ARG N 17 76.442 50.290 4.368 1.00256.41 N ANISOU11983 N ARG N 17 38559 35728 23138 2973 3513 4007 N ATOM 11984 CA ARG N 17 76.529 51.720 4.115 1.00258.01 C ANISOU11984 CA ARG N 17 39580 35772 22680 3049 3694 4104 C ATOM 11985 C ARG N 17 76.275 52.468 5.400 1.00252.77 C ANISOU11985 C ARG N 17 38699 35284 22055 3084 3378 4378 C ATOM 11986 O ARG N 17 77.006 53.396 5.769 1.00258.70 O ANISOU11986 O ARG N 17 39646 35849 22796 2894 3671 4489 O ATOM 11987 CB ARG N 17 75.415 52.140 3.158 1.00264.54 C ANISOU11987 CB ARG N 17 41201 36677 22636 3471 3426 4009 C ATOM 11988 CG ARG N 17 75.738 52.178 1.670 1.00276.51 C ANISOU11988 CG ARG N 17 43531 37902 23627 3438 3858 3787 C ATOM 11989 CD ARG N 17 74.628 52.937 0.943 1.00290.48 C ANISOU11989 CD ARG N 17 46206 39731 24432 3921 3438 3804 C ATOM 11990 NE ARG N 17 75.002 53.423 -0.396 1.00310.73 N ANISOU11990 NE ARG N 17 49887 41933 26242 3881 3872 3712 N ATOM 11991 CZ ARG N 17 75.587 54.601 -0.662 1.00318.54 C ANISOU11991 CZ ARG N 17 51739 42525 26767 3782 4324 3878 C ATOM 11992 NH1 ARG N 17 75.933 55.426 0.322 1.00315.93 N ANISOU11992 NH1 ARG N 17 51208 42120 26711 3698 4421 4111 N ATOM 11993 NH2 ARG N 17 75.865 54.932 -1.914 1.00333.05 N ANISOU11993 NH2 ARG N 17 54667 44014 27860 3715 4737 3789 N ATOM 11994 N LEU N 18 75.189 52.066 6.050 1.00241.14 N ANISOU11994 N LEU N 18 36842 34165 20615 3304 2819 4431 N ATOM 11995 CA LEU N 18 74.736 52.721 7.251 1.00229.39 C ANISOU11995 CA LEU N 18 35181 32875 19100 3334 2513 4631 C ATOM 11996 C LEU N 18 75.843 52.719 8.311 1.00230.42 C ANISOU11996 C LEU N 18 34817 32947 19784 2921 2678 4818 C ATOM 11997 O LEU N 18 76.119 53.753 8.905 1.00231.70 O ANISOU11997 O LEU N 18 35167 33071 19795 2821 2759 4939 O ATOM 11998 CB LEU N 18 73.441 52.075 7.768 1.00215.91 C ANISOU11998 CB LEU N 18 33055 31524 17455 3546 1989 4572 C ATOM 11999 CG LEU N 18 72.086 52.474 7.171 1.00209.17 C ANISOU11999 CG LEU N 18 32601 30810 16063 4015 1634 4375 C ATOM 12000 CD1 LEU N 18 70.984 51.699 7.862 1.00202.38 C ANISOU12000 CD1 LEU N 18 31132 30278 15486 4094 1230 4242 C ATOM 12001 CD2 LEU N 18 71.826 53.963 7.283 1.00206.47 C ANISOU12001 CD2 LEU N 18 32849 30370 15229 4211 1603 4472 C ATOM 12002 N LEU N 19 76.497 51.570 8.507 1.00232.39 N ANISOU12002 N LEU N 19 34443 33163 20691 2696 2710 4819 N ATOM 12003 CA LEU N 19 77.573 51.435 9.495 1.00237.25 C ANISOU12003 CA LEU N 19 34529 33715 21898 2348 2739 4984 C ATOM 12004 C LEU N 19 78.793 52.248 9.150 1.00252.37 C ANISOU12004 C LEU N 19 36680 35311 23896 2121 3245 4892 C ATOM 12005 O LEU N 19 79.325 52.949 10.006 1.00253.31 O ANISOU12005 O LEU N 19 36694 35441 24108 1922 3236 5003 O ATOM 12006 CB LEU N 19 77.995 49.978 9.649 1.00232.66 C ANISOU12006 CB LEU N 19 33252 33088 22059 2224 2629 4996 C ATOM 12007 CG LEU N 19 77.097 49.102 10.508 1.00227.91 C ANISOU12007 CG LEU N 19 32247 32760 21588 2287 2140 5167 C ATOM 12008 CD1 LEU N 19 77.545 47.666 10.323 1.00231.35 C ANISOU12008 CD1 LEU N 19 32122 33031 22749 2209 2142 5138 C ATOM 12009 CD2 LEU N 19 77.152 49.521 11.972 1.00224.19 C ANISOU12009 CD2 LEU N 19 31602 32466 21111 2103 1819 5464 C ATOM 12010 N HIS N 20 79.227 52.146 7.895 1.00270.38 N ANISOU12010 N HIS N 20 39291 37300 26139 2114 3723 4646 N ATOM 12011 CA HIS N 20 80.424 52.844 7.417 1.00283.93 C ANISOU12011 CA HIS N 20 41262 38637 27979 1840 4358 4468 C ATOM 12012 C HIS N 20 80.319 54.371 7.508 1.00289.38 C ANISOU12012 C HIS N 20 42646 39257 28048 1858 4552 4535 C ATOM 12013 O HIS N 20 81.342 55.079 7.512 1.00296.72 O ANISOU12013 O HIS N 20 43672 39905 29162 1564 5045 4410 O ATOM 12014 CB HIS N 20 80.763 52.411 5.985 1.00284.08 C ANISOU12014 CB HIS N 20 41624 38346 27966 1796 4899 4157 C ATOM 12015 CG HIS N 20 81.858 51.392 5.905 1.00280.62 C ANISOU12015 CG HIS N 20 40449 37683 28489 1506 5166 3937 C ATOM 12016 ND1 HIS N 20 83.058 51.636 5.274 1.00281.95 N ANISOU12016 ND1 HIS N 20 40687 37422 29016 1168 5905 3603 N ATOM 12017 CD2 HIS N 20 81.935 50.129 6.386 1.00277.23 C ANISOU12017 CD2 HIS N 20 39186 37352 28794 1506 4812 3980 C ATOM 12018 CE1 HIS N 20 83.826 50.564 5.365 1.00282.46 C ANISOU12018 CE1 HIS N 20 39926 37340 30053 992 5965 3419 C ATOM 12019 NE2 HIS N 20 83.165 49.635 6.031 1.00279.00 N ANISOU12019 NE2 HIS N 20 38954 37207 29845 1212 5286 3674 N ATOM 12020 N LEU N 21 79.077 54.853 7.596 1.00285.74 N ANISOU12020 N LEU N 21 42616 39025 26927 2201 4176 4691 N ATOM 12021 CA LEU N 21 78.761 56.278 7.662 1.00276.89 C ANISOU12021 CA LEU N 21 42182 37817 25204 2306 4292 4772 C ATOM 12022 C LEU N 21 79.261 56.896 8.985 1.00275.14 C ANISOU12022 C LEU N 21 41555 37697 25286 2033 4233 4876 C ATOM 12023 O LEU N 21 79.762 58.039 9.012 1.00274.08 O ANISOU12023 O LEU N 21 41832 37326 24977 1881 4640 4834 O ATOM 12024 CB LEU N 21 77.241 56.456 7.509 1.00268.90 C ANISOU12024 CB LEU N 21 41539 37038 23589 2781 3792 4863 C ATOM 12025 CG LEU N 21 76.597 57.626 6.754 1.00262.69 C ANISOU12025 CG LEU N 21 41749 36043 22018 3118 3870 4887 C ATOM 12026 CD1 LEU N 21 75.084 57.504 6.795 1.00257.61 C ANISOU12026 CD1 LEU N 21 41131 35698 21051 3599 3217 4906 C ATOM 12027 CD2 LEU N 21 77.031 58.977 7.298 1.00259.80 C ANISOU12027 CD2 LEU N 21 41709 35470 21531 2963 4182 4973 C ATOM 12028 N HIS N 22 79.152 56.107 10.061 1.00271.73 N ANISOU12028 N HIS N 22 40353 37596 25295 1943 3747 5000 N ATOM 12029 CA HIS N 22 79.301 56.576 11.456 1.00266.70 C ANISOU12029 CA HIS N 22 39361 37175 24798 1724 3500 5131 C ATOM 12030 C HIS N 22 80.546 55.976 12.214 1.00258.01 C ANISOU12030 C HIS N 22 37500 36073 24457 1343 3432 5127 C ATOM 12031 O HIS N 22 80.759 56.193 13.430 1.00249.19 O ANISOU12031 O HIS N 22 36041 35165 23473 1127 3135 5240 O ATOM 12032 CB HIS N 22 77.946 56.397 12.213 1.00274.69 C ANISOU12032 CB HIS N 22 40284 38571 25513 1936 2949 5291 C ATOM 12033 CG HIS N 22 76.757 57.068 11.545 1.00280.31 C ANISOU12033 CG HIS N 22 41641 39265 25599 2343 2934 5239 C ATOM 12034 ND1 HIS N 22 76.662 58.435 11.365 1.00283.97 N ANISOU12034 ND1 HIS N 22 42720 39534 25642 2423 3204 5206 N ATOM 12035 CD2 HIS N 22 75.603 56.553 11.047 1.00279.70 C ANISOU12035 CD2 HIS N 22 41653 39325 25295 2711 2633 5193 C ATOM 12036 CE1 HIS N 22 75.517 58.730 10.769 1.00282.31 C ANISOU12036 CE1 HIS N 22 42965 39321 24979 2859 3021 5174 C ATOM 12037 NE2 HIS N 22 74.857 57.604 10.563 1.00279.36 N ANISOU12037 NE2 HIS N 22 42257 39168 24716 3038 2660 5139 N ATOM 12038 N PHE N 23 81.367 55.244 11.469 1.00257.75 N ANISOU12038 N PHE N 23 37222 35785 24923 1264 3698 4965 N ATOM 12039 CA PHE N 23 82.623 54.767 11.994 1.00260.46 C ANISOU12039 CA PHE N 23 36853 36032 26076 957 3665 4884 C ATOM 12040 C PHE N 23 83.508 55.943 12.321 1.00267.18 C ANISOU12040 C PHE N 23 37787 36734 26991 660 4025 4703 C ATOM 12041 O PHE N 23 83.791 56.780 11.455 1.00271.73 O ANISOU12041 O PHE N 23 38921 36995 27327 604 4685 4475 O ATOM 12042 CB PHE N 23 83.281 53.822 10.999 1.00259.61 C ANISOU12042 CB PHE N 23 36484 35616 26539 938 3985 4656 C ATOM 12043 CG PHE N 23 82.591 52.508 10.913 1.00255.65 C ANISOU12043 CG PHE N 23 35691 35264 26177 1161 3575 4813 C ATOM 12044 CD1 PHE N 23 81.853 52.041 11.995 1.00252.00 C ANISOU12044 CD1 PHE N 23 34960 35156 25631 1253 2908 5145 C ATOM 12045 CD2 PHE N 23 82.674 51.731 9.774 1.00256.60 C ANISOU12045 CD2 PHE N 23 35829 35156 26509 1235 3904 4599 C ATOM 12046 CE1 PHE N 23 81.201 50.824 11.940 1.00250.87 C ANISOU12046 CE1 PHE N 23 34562 35112 25642 1426 2592 5267 C ATOM 12047 CE2 PHE N 23 82.028 50.503 9.716 1.00255.27 C ANISOU12047 CE2 PHE N 23 35362 35115 26513 1419 3554 4707 C ATOM 12048 CZ PHE N 23 81.288 50.052 10.795 1.00252.69 C ANISOU12048 CZ PHE N 23 34762 35118 26130 1521 2907 5044 C ATOM 12049 N LYS N 24 83.884 56.034 13.592 1.00270.11 N ANISOU12049 N LYS N 24 37673 37332 27622 458 3588 4806 N ATOM 12050 CA LYS N 24 84.832 57.056 14.030 1.00278.98 C ANISOU12050 CA LYS N 24 38718 38346 28933 126 3872 4570 C ATOM 12051 C LYS N 24 86.295 56.725 13.648 1.00295.18 C ANISOU12051 C LYS N 24 40199 40052 31904 -125 4208 4192 C ATOM 12052 O LYS N 24 87.082 57.639 13.363 1.00306.44 O ANISOU12052 O LYS N 24 41752 41204 33475 -387 4818 3832 O ATOM 12053 CB LYS N 24 84.629 57.437 15.504 1.00268.43 C ANISOU12053 CB LYS N 24 37179 37401 27411 -24 3306 4764 C ATOM 12054 CG LYS N 24 83.440 58.373 15.704 1.00260.16 C ANISOU12054 CG LYS N 24 36810 36534 25503 102 3365 4905 C ATOM 12055 CD LYS N 24 83.636 59.687 14.951 1.00259.49 C ANISOU12055 CD LYS N 24 37352 36114 25129 51 4129 4645 C ATOM 12056 CE LYS N 24 82.367 60.172 14.259 1.00254.91 C ANISOU12056 CE LYS N 24 37561 35483 23809 419 4295 4776 C ATOM 12057 NZ LYS N 24 81.564 61.095 15.109 1.00253.47 N ANISOU12057 NZ LYS N 24 37647 35521 23139 420 4143 4865 N ATOM 12058 N ASP N 25 86.651 55.435 13.599 1.00302.69 N ANISOU12058 N ASP N 25 40519 40964 33523 -53 3873 4225 N ATOM 12059 CA ASP N 25 87.842 55.004 12.824 1.00314.49 C ANISOU12059 CA ASP N 25 41557 42027 35908 -217 4360 3787 C ATOM 12060 C ASP N 25 87.409 54.377 11.475 1.00322.55 C ANISOU12060 C ASP N 25 42956 42809 36789 -32 4823 3718 C ATOM 12061 O ASP N 25 86.586 53.463 11.457 1.00313.76 O ANISOU12061 O ASP N 25 41820 41882 35509 240 4388 4018 O ATOM 12062 CB ASP N 25 88.766 54.055 13.619 1.00311.99 C ANISOU12062 CB ASP N 25 40197 41719 36626 -289 3736 3757 C ATOM 12063 CG ASP N 25 90.165 53.902 12.978 1.00316.91 C ANISOU12063 CG ASP N 25 40229 41865 38316 -532 4296 3157 C ATOM 12064 OD1 ASP N 25 90.425 54.423 11.862 1.00319.38 O ANISOU12064 OD1 ASP N 25 40978 41822 38550 -689 5248 2762 O ATOM 12065 OD2 ASP N 25 91.019 53.240 13.595 1.00317.90 O ANISOU12065 OD2 ASP N 25 39453 41940 39392 -573 3783 3059 O ATOM 12066 N ASP N 26 87.936 54.891 10.355 1.00340.99 N ANISOU12066 N ASP N 26 45692 44727 39140 -213 5733 3303 N ATOM 12067 CA ASP N 26 87.633 54.346 9.013 1.00358.81 C ANISOU12067 CA ASP N 26 48379 46733 41217 -108 6236 3172 C ATOM 12068 C ASP N 26 88.365 53.039 8.626 1.00386.59 C ANISOU12068 C ASP N 26 51113 50011 45761 -174 6295 2901 C ATOM 12069 O ASP N 26 88.104 52.500 7.532 1.00405.52 O ANISOU12069 O ASP N 26 53837 52221 48021 -119 6709 2760 O ATOM 12070 CB ASP N 26 87.835 55.403 7.920 1.00349.70 C ANISOU12070 CB ASP N 26 48143 45190 39534 -301 7226 2865 C ATOM 12071 CG ASP N 26 86.534 56.025 7.461 1.00339.96 C ANISOU12071 CG ASP N 26 47984 44103 37080 8 7187 3200 C ATOM 12072 OD1 ASP N 26 85.449 55.612 7.943 1.00331.02 O ANISOU12072 OD1 ASP N 26 46822 43385 35563 360 6441 3599 O ATOM 12073 OD2 ASP N 26 86.610 56.933 6.607 1.00339.97 O ANISOU12073 OD2 ASP N 26 48872 43766 36533 -104 7916 3041 O ATOM 12074 N LYS N 27 89.257 52.543 9.508 1.00405.86 N ANISOU12074 N LYS N 27 52546 52445 49216 -281 5859 2817 N ATOM 12075 CA LYS N 27 89.985 51.238 9.331 1.00413.79 C ANISOU12075 CA LYS N 27 52648 53194 51379 -291 5767 2585 C ATOM 12076 C LYS N 27 89.036 50.013 9.340 1.00412.58 C ANISOU12076 C LYS N 27 52421 53246 51093 54 5197 2991 C ATOM 12077 O LYS N 27 89.282 48.997 8.644 1.00424.44 O ANISOU12077 O LYS N 27 53576 54474 53218 69 5435 2762 O ATOM 12078 CB LYS N 27 91.094 51.038 10.393 1.00405.57 C ANISOU12078 CB LYS N 27 50551 52109 51436 -408 5240 2457 C ATOM 12079 CG LYS N 27 92.296 51.973 10.329 1.00393.73 C ANISOU12079 CG LYS N 27 48800 50313 50483 -801 5848 1864 C ATOM 12080 CD LYS N 27 93.252 51.683 11.481 1.00381.86 C ANISOU12080 CD LYS N 27 46204 48849 50033 -834 5085 1779 C ATOM 12081 CE LYS N 27 94.001 52.924 11.943 1.00377.60 C ANISOU12081 CE LYS N 27 45582 48303 49584 -1165 5332 1408 C ATOM 12082 NZ LYS N 27 94.823 52.666 13.159 1.00377.56 N ANISOU12082 NZ LYS N 27 44556 48421 50476 -1159 4407 1364 N ATOM 12083 N THR N 28 87.971 50.143 10.149 1.00392.34 N ANISOU12083 N THR N 28 50171 51140 47759 292 4508 3538 N ATOM 12084 CA THR N 28 86.818 49.217 10.254 1.00361.78 C ANISOU12084 CA THR N 28 46404 47528 43525 601 4000 3943 C ATOM 12085 C THR N 28 86.138 48.850 8.869 1.00346.57 C ANISOU12085 C THR N 28 45027 45488 41164 709 4551 3755 C ATOM 12086 O THR N 28 85.574 49.713 8.169 1.00346.81 O ANISOU12086 O THR N 28 45906 45566 40300 732 4967 3690 O ATOM 12087 CB THR N 28 85.807 49.751 11.343 1.00350.25 C ANISOU12087 CB THR N 28 45301 46556 41221 741 3354 4443 C ATOM 12088 OG1 THR N 28 86.514 50.182 12.525 1.00341.34 O ANISOU12088 OG1 THR N 28 43755 45525 40412 578 2920 4545 O ATOM 12089 CG2 THR N 28 84.784 48.710 11.740 1.00343.41 C ANISOU12089 CG2 THR N 28 44353 45928 40199 988 2778 4829 C ATOM 12090 N LYS N 29 86.258 47.582 8.461 1.00323.42 N ANISOU12090 N LYS N 29 41616 42370 38896 768 4550 3644 N ATOM 12091 CA LYS N 29 85.359 47.002 7.461 1.00301.80 C ANISOU12091 CA LYS N 29 39305 39663 35702 920 4786 3569 C ATOM 12092 C LYS N 29 84.551 45.945 8.202 1.00296.12 C ANISOU12092 C LYS N 29 38212 39190 35108 1165 4054 3966 C ATOM 12093 O LYS N 29 84.826 45.632 9.363 1.00299.38 O ANISOU12093 O LYS N 29 38092 39670 35988 1186 3454 4281 O ATOM 12094 CB LYS N 29 86.114 46.437 6.239 1.00292.47 C ANISOU12094 CB LYS N 29 37969 38027 35128 717 5556 3018 C ATOM 12095 CG LYS N 29 86.213 47.373 5.028 1.00281.77 C ANISOU12095 CG LYS N 29 37496 36491 33072 524 6417 2646 C ATOM 12096 CD LYS N 29 85.147 47.095 3.953 1.00268.98 C ANISOU12096 CD LYS N 29 36611 34992 30595 681 6594 2588 C ATOM 12097 CE LYS N 29 85.235 48.030 2.747 1.00261.28 C ANISOU12097 CE LYS N 29 36664 33802 28805 495 7393 2281 C ATOM 12098 NZ LYS N 29 84.205 47.759 1.693 1.00252.24 N ANISOU12098 NZ LYS N 29 36269 32792 26776 668 7456 2218 N ATOM 12099 N VAL N 30 83.523 45.420 7.567 1.00286.36 N ANISOU12099 N VAL N 30 37304 38091 33408 1338 4086 3952 N ATOM 12100 CA VAL N 30 82.713 44.432 8.250 1.00272.71 C ANISOU12100 CA VAL N 30 35257 36562 31797 1527 3492 4280 C ATOM 12101 C VAL N 30 82.795 43.112 7.470 1.00272.22 C ANISOU12101 C VAL N 30 34806 36228 32394 1532 3752 4004 C ATOM 12102 O VAL N 30 82.596 43.106 6.247 1.00282.86 O ANISOU12102 O VAL N 30 36533 37501 33438 1501 4289 3615 O ATOM 12103 CB VAL N 30 81.256 44.931 8.443 1.00261.70 C ANISOU12103 CB VAL N 30 34474 35617 29342 1735 3193 4498 C ATOM 12104 CG1 VAL N 30 80.502 44.042 9.430 1.00254.36 C ANISOU12104 CG1 VAL N 30 33203 34879 28562 1845 2602 4853 C ATOM 12105 CG2 VAL N 30 81.234 46.386 8.900 1.00257.41 C ANISOU12105 CG2 VAL N 30 34412 35262 28129 1704 3145 4635 C ATOM 12106 N SER N 31 83.130 42.014 8.162 1.00260.53 N ANISOU12106 N SER N 31 32608 34569 31811 1559 3382 4198 N ATOM 12107 CA SER N 31 83.062 40.662 7.569 1.00249.67 C ANISOU12107 CA SER N 31 30827 32930 31105 1586 3573 3981 C ATOM 12108 C SER N 31 81.623 40.347 7.075 1.00243.45 C ANISOU12108 C SER N 31 30489 32458 29550 1733 3576 3933 C ATOM 12109 O SER N 31 80.631 40.821 7.666 1.00235.35 O ANISOU12109 O SER N 31 29841 31829 27752 1864 3180 4227 O ATOM 12110 CB SER N 31 83.602 39.587 8.539 1.00246.67 C ANISOU12110 CB SER N 31 29664 32268 31791 1636 3078 4294 C ATOM 12111 OG SER N 31 82.641 39.218 9.519 1.00238.98 O ANISOU12111 OG SER N 31 28793 31557 30451 1777 2478 4793 O ATOM 12112 N GLY N 32 81.507 39.582 5.984 1.00245.65 N ANISOU12112 N GLY N 32 30710 32564 30062 1694 4038 3500 N ATOM 12113 CA GLY N 32 80.199 39.265 5.365 1.00246.38 C ANISOU12113 CA GLY N 32 31183 32950 29479 1821 4061 3326 C ATOM 12114 C GLY N 32 79.148 38.689 6.312 1.00245.31 C ANISOU12114 C GLY N 32 30892 33057 29258 1980 3504 3683 C ATOM 12115 O GLY N 32 77.999 39.135 6.318 1.00244.36 O ANISOU12115 O GLY N 32 31211 33336 28297 2119 3301 3697 O ATOM 12116 N ASP N 33 79.550 37.705 7.118 1.00247.90 N ANISOU12116 N ASP N 33 30605 33103 30481 1954 3268 3956 N ATOM 12117 CA ASP N 33 78.667 37.095 8.102 1.00247.69 C ANISOU12117 CA ASP N 33 30470 33211 30429 2036 2814 4325 C ATOM 12118 C ASP N 33 78.204 38.079 9.158 1.00244.52 C ANISOU12118 C ASP N 33 30439 33173 29291 2076 2353 4747 C ATOM 12119 O ASP N 33 77.038 38.034 9.522 1.00242.49 O ANISOU12119 O ASP N 33 30398 33209 28528 2133 2169 4812 O ATOM 12120 CB ASP N 33 79.318 35.878 8.765 1.00250.96 C ANISOU12120 CB ASP N 33 30248 33158 31948 2003 2640 4597 C ATOM 12121 CG ASP N 33 79.351 34.664 7.862 1.00253.26 C ANISOU12121 CG ASP N 33 30152 33110 32962 1971 3081 4177 C ATOM 12122 OD1 ASP N 33 78.673 34.660 6.812 1.00253.43 O ANISOU12122 OD1 ASP N 33 30422 33332 32538 1959 3466 3686 O ATOM 12123 OD2 ASP N 33 80.058 33.700 8.213 1.00254.07 O ANISOU12123 OD2 ASP N 33 29703 32729 34101 1963 3015 4330 O ATOM 12124 N ALA N 34 79.108 38.955 9.632 1.00243.08 N ANISOU12124 N ALA N 34 30299 32962 29096 2018 2213 4962 N ATOM 12125 CA ALA N 34 78.769 40.016 10.591 1.00239.96 C ANISOU12125 CA ALA N 34 30276 32909 27988 2014 1839 5304 C ATOM 12126 C ALA N 34 77.783 40.982 9.969 1.00238.55 C ANISOU12126 C ALA N 34 30693 33117 26828 2117 2005 5044 C ATOM 12127 O ALA N 34 76.875 41.444 10.644 1.00235.04 O ANISOU12127 O ALA N 34 30520 32990 25793 2158 1733 5215 O ATOM 12128 CB ALA N 34 80.005 40.756 11.088 1.00238.85 C ANISOU12128 CB ALA N 34 30018 32643 28090 1911 1712 5479 C ATOM 12129 N LEU N 35 77.951 41.249 8.675 1.00242.21 N ANISOU12129 N LEU N 35 31371 33520 27135 2157 2449 4615 N ATOM 12130 CA LEU N 35 77.001 42.032 7.915 1.00245.39 C ANISOU12130 CA LEU N 35 32373 34228 26636 2313 2554 4351 C ATOM 12131 C LEU N 35 75.653 41.325 7.853 1.00255.83 C ANISOU12131 C LEU N 35 33651 35779 27772 2449 2384 4206 C ATOM 12132 O LEU N 35 74.608 41.955 8.075 1.00256.96 O ANISOU12132 O LEU N 35 34117 36255 27258 2596 2150 4196 O ATOM 12133 CB LEU N 35 77.528 42.291 6.509 1.00239.09 C ANISOU12133 CB LEU N 35 31873 33251 25716 2287 3074 3934 C ATOM 12134 CG LEU N 35 76.596 43.128 5.650 1.00233.09 C ANISOU12134 CG LEU N 35 31838 32762 23963 2488 3108 3696 C ATOM 12135 CD1 LEU N 35 76.416 44.486 6.312 1.00228.87 C ANISOU12135 CD1 LEU N 35 31722 32418 22817 2569 2873 3977 C ATOM 12136 CD2 LEU N 35 77.133 43.240 4.237 1.00235.29 C ANISOU12136 CD2 LEU N 35 32505 32819 24073 2409 3652 3296 C ATOM 12137 N GLN N 36 75.672 40.017 7.573 1.00267.77 N ANISOU12137 N GLN N 36 34720 37087 29930 2394 2521 4050 N ATOM 12138 CA AGLN N 36 74.421 39.254 7.469 0.50269.28 C ANISOU12138 CA AGLN N 36 34806 37462 30044 2481 2433 3826 C ATOM 12139 CA BGLN N 36 74.424 39.242 7.473 0.50269.25 C ANISOU12139 CA BGLN N 36 34797 37455 30048 2480 2433 3827 C ATOM 12140 C GLN N 36 73.701 39.110 8.836 1.00264.91 C ANISOU12140 C GLN N 36 34129 37057 29465 2442 2066 4180 C ATOM 12141 O GLN N 36 72.469 38.975 8.901 1.00265.77 O ANISOU12141 O GLN N 36 34284 37421 29273 2520 1966 3967 O ATOM 12142 CB AGLN N 36 74.606 37.907 6.721 0.50277.36 C ANISOU12142 CB AGLN N 36 35414 38205 31763 2404 2759 3494 C ATOM 12143 CB BGLN N 36 74.624 37.880 6.760 0.50277.26 C ANISOU12143 CB BGLN N 36 35384 38182 31778 2399 2755 3509 C ATOM 12144 CG AGLN N 36 74.872 38.035 5.210 0.50283.22 C ANISOU12144 CG AGLN N 36 36412 38904 32292 2419 3168 2982 C ATOM 12145 CG BGLN N 36 74.929 37.972 5.253 0.50283.10 C ANISOU12145 CG BGLN N 36 36357 38864 32344 2407 3174 2999 C ATOM 12146 CD AGLN N 36 74.002 37.133 4.351 0.50287.13 C ANISOU12146 CD AGLN N 36 36796 39492 32806 2454 3318 2458 C ATOM 12147 CD BGLN N 36 74.056 37.082 4.386 0.50286.94 C ANISOU12147 CD BGLN N 36 36740 39445 32839 2443 3327 2473 C ATOM 12148 OE1AGLN N 36 72.870 37.490 3.998 0.50289.24 O ANISOU12148 OE1AGLN N 36 37367 40134 32394 2634 3108 2195 O ATOM 12149 OE1BGLN N 36 72.916 37.436 4.060 0.50289.10 O ANISOU12149 OE1BGLN N 36 37312 40094 32438 2621 3114 2219 O ATOM 12150 NE2AGLN N 36 74.542 35.983 3.963 0.50288.61 N ANISOU12150 NE2AGLN N 36 36528 39327 33803 2290 3677 2250 N ATOM 12151 NE2BGLN N 36 74.604 35.953 3.951 0.50288.42 N ANISOU12151 NE2BGLN N 36 36487 39279 33819 2280 3697 2250 N ATOM 12152 N LEU N 37 74.453 39.180 9.934 1.00255.17 N ANISOU12152 N LEU N 37 32764 35665 28521 2303 1867 4681 N ATOM 12153 CA LEU N 37 73.828 39.207 11.281 1.00244.71 C ANISOU12153 CA LEU N 37 31481 34484 27012 2204 1546 5043 C ATOM 12154 C LEU N 37 73.085 40.509 11.618 1.00242.96 C ANISOU12154 C LEU N 37 31695 34660 25956 2271 1390 5020 C ATOM 12155 O LEU N 37 72.124 40.493 12.384 1.00245.89 O ANISOU12155 O LEU N 37 32127 35215 26083 2204 1262 5058 O ATOM 12156 CB LEU N 37 74.823 38.850 12.420 1.00240.84 C ANISOU12156 CB LEU N 37 30784 33709 27014 2029 1290 5611 C ATOM 12157 CG LEU N 37 74.757 37.476 13.135 1.00242.09 C ANISOU12157 CG LEU N 37 30643 33552 27787 1906 1189 5895 C ATOM 12158 CD1 LEU N 37 75.746 37.359 14.302 1.00245.79 C ANISOU12158 CD1 LEU N 37 31039 33773 28577 1784 782 6505 C ATOM 12159 CD2 LEU N 37 73.345 37.113 13.585 1.00241.27 C ANISOU12159 CD2 LEU N 37 30682 33637 27353 1823 1235 5795 C ATOM 12160 N MET N 38 73.521 41.627 11.054 1.00239.19 N ANISOU12160 N MET N 38 31530 34272 25079 2381 1449 4933 N ATOM 12161 CA MET N 38 72.897 42.907 11.363 1.00232.75 C ANISOU12161 CA MET N 38 31126 33764 23541 2466 1311 4923 C ATOM 12162 C MET N 38 71.559 43.129 10.693 1.00234.39 C ANISOU12162 C MET N 38 31513 34235 23306 2708 1299 4476 C ATOM 12163 O MET N 38 70.719 43.846 11.224 1.00230.78 O ANISOU12163 O MET N 38 31235 34017 22434 2761 1139 4438 O ATOM 12164 CB MET N 38 73.828 44.055 11.039 1.00225.63 C ANISOU12164 CB MET N 38 30538 32809 22381 2490 1404 4999 C ATOM 12165 CG MET N 38 74.598 44.520 12.248 1.00218.36 C ANISOU12165 CG MET N 38 29573 31855 21538 2266 1224 5427 C ATOM 12166 SD MET N 38 73.447 44.864 13.580 1.00209.84 S ANISOU12166 SD MET N 38 28623 31087 20018 2161 944 5588 S ATOM 12167 CE MET N 38 72.836 46.472 13.082 1.00208.08 C ANISOU12167 CE MET N 38 28919 31096 19047 2386 1018 5325 C ATOM 12168 N VAL N 39 71.368 42.522 9.527 1.00237.34 N ANISOU12168 N VAL N 39 31819 34560 23797 2852 1454 4097 N ATOM 12169 CA VAL N 39 70.054 42.511 8.890 1.00236.52 C ANISOU12169 CA VAL N 39 31783 34708 23375 3093 1355 3614 C ATOM 12170 C VAL N 39 69.086 41.854 9.859 1.00237.00 C ANISOU12170 C VAL N 39 31493 34877 23679 2960 1262 3572 C ATOM 12171 O VAL N 39 67.978 42.349 10.067 1.00233.08 O ANISOU12171 O VAL N 39 31057 34631 22871 3089 1098 3316 O ATOM 12172 CB VAL N 39 70.080 41.746 7.552 1.00238.12 C ANISOU12172 CB VAL N 39 31919 34830 23724 3194 1539 3199 C ATOM 12173 CG1 VAL N 39 68.672 41.452 7.032 1.00239.55 C ANISOU12173 CG1 VAL N 39 32012 35280 23725 3410 1367 2653 C ATOM 12174 CG2 VAL N 39 70.897 42.518 6.526 1.00236.72 C ANISOU12174 CG2 VAL N 39 32233 34546 23162 3295 1695 3175 C ATOM 12175 N GLU N 40 69.541 40.750 10.457 1.00239.92 N ANISOU12175 N GLU N 40 31510 35007 24638 2694 1389 3818 N ATOM 12176 CA GLU N 40 68.803 40.026 11.495 1.00240.12 C ANISOU12176 CA GLU N 40 31288 35029 24916 2471 1394 3872 C ATOM 12177 C GLU N 40 68.585 40.879 12.777 1.00239.82 C ANISOU12177 C GLU N 40 31480 35129 24511 2311 1240 4191 C ATOM 12178 O GLU N 40 67.459 40.930 13.292 1.00240.24 O ANISOU12178 O GLU N 40 31496 35353 24432 2242 1254 3943 O ATOM 12179 CB GLU N 40 69.446 38.629 11.789 1.00237.43 C ANISOU12179 CB GLU N 40 30611 34309 25292 2244 1556 4130 C ATOM 12180 CG GLU N 40 69.979 37.829 10.582 1.00233.39 C ANISOU12180 CG GLU N 40 29861 33586 25229 2344 1770 3867 C ATOM 12181 CD GLU N 40 69.062 36.657 10.145 1.00232.98 C ANISOU12181 CD GLU N 40 29467 33500 25554 2312 1986 3383 C ATOM 12182 OE1 GLU N 40 69.568 35.737 9.491 1.00234.18 O ANISOU12182 OE1 GLU N 40 29358 33385 26236 2285 2211 3258 O ATOM 12183 OE2 GLU N 40 67.838 36.623 10.453 1.00232.19 O ANISOU12183 OE2 GLU N 40 29315 33617 25287 2291 1973 3069 O ATOM 12184 N LEU N 41 69.634 41.567 13.263 1.00237.46 N ANISOU12184 N LEU N 41 31398 34759 24068 2230 1126 4659 N ATOM 12185 CA LEU N 41 69.531 42.474 14.452 1.00231.50 C ANISOU12185 CA LEU N 41 30900 34149 22909 2048 989 4940 C ATOM 12186 C LEU N 41 68.636 43.679 14.186 1.00228.95 C ANISOU12186 C LEU N 41 30809 34122 22060 2262 946 4575 C ATOM 12187 O LEU N 41 67.795 44.030 15.015 1.00231.42 O ANISOU12187 O LEU N 41 31174 34589 22166 2121 947 4481 O ATOM 12188 CB LEU N 41 70.913 42.921 15.013 1.00226.75 C ANISOU12188 CB LEU N 41 30427 33410 22316 1905 848 5469 C ATOM 12189 CG LEU N 41 71.180 44.134 15.963 1.00221.24 C ANISOU12189 CG LEU N 41 30040 32869 21149 1749 704 5727 C ATOM 12190 CD1 LEU N 41 70.252 44.344 17.162 1.00218.73 C ANISOU12190 CD1 LEU N 41 29875 32728 20503 1480 687 5753 C ATOM 12191 CD2 LEU N 41 72.614 44.093 16.476 1.00221.59 C ANISOU12191 CD2 LEU N 41 30041 32719 21432 1584 526 6201 C ATOM 12192 N LEU N 42 68.813 44.304 13.032 1.00223.41 N ANISOU12192 N LEU N 42 30271 33460 21152 2594 924 4358 N ATOM 12193 CA LEU N 42 67.940 45.396 12.654 1.00220.57 C ANISOU12193 CA LEU N 42 30153 33318 20335 2880 816 4015 C ATOM 12194 C LEU N 42 66.498 44.916 12.471 1.00229.93 C ANISOU12194 C LEU N 42 31067 34668 21628 3006 776 3472 C ATOM 12195 O LEU N 42 65.566 45.638 12.820 1.00238.31 O ANISOU12195 O LEU N 42 32165 35899 22483 3096 685 3210 O ATOM 12196 CB LEU N 42 68.473 46.119 11.423 1.00213.90 C ANISOU12196 CB LEU N 42 29660 32419 19191 3201 797 3947 C ATOM 12197 CG LEU N 42 69.694 47.007 11.695 1.00211.61 C ANISOU12197 CG LEU N 42 29680 31995 18726 3080 877 4360 C ATOM 12198 CD1 LEU N 42 70.157 47.658 10.397 1.00215.70 C ANISOU12198 CD1 LEU N 42 30624 32400 18929 3355 964 4246 C ATOM 12199 CD2 LEU N 42 69.415 48.048 12.783 1.00208.64 C ANISOU12199 CD2 LEU N 42 29467 31747 18059 2962 801 4503 C ATOM 12200 N LYS N 43 66.329 43.689 11.972 1.00237.08 N ANISOU12200 N LYS N 43 31650 35501 22928 2986 871 3263 N ATOM 12201 CA LYS N 43 65.018 43.028 11.887 1.00246.33 C ANISOU12201 CA LYS N 43 32460 36800 24334 3021 892 2700 C ATOM 12202 C LYS N 43 64.307 42.900 13.251 1.00251.90 C ANISOU12202 C LYS N 43 33011 37537 25162 2665 1041 2695 C ATOM 12203 O LYS N 43 63.167 43.363 13.399 1.00259.72 O ANISOU12203 O LYS N 43 33883 38707 26090 2762 994 2217 O ATOM 12204 CB LYS N 43 65.148 41.659 11.224 1.00249.42 C ANISOU12204 CB LYS N 43 32532 37052 25182 2973 1051 2527 C ATOM 12205 CG LYS N 43 63.975 41.279 10.346 1.00255.65 C ANISOU12205 CG LYS N 43 33039 38024 26071 3222 967 1782 C ATOM 12206 CD LYS N 43 64.299 40.005 9.580 1.00261.55 C ANISOU12206 CD LYS N 43 33524 38616 27236 3160 1159 1624 C ATOM 12207 CE LYS N 43 63.751 40.024 8.159 1.00268.86 C ANISOU12207 CE LYS N 43 34436 39735 27980 3533 951 1007 C ATOM 12208 NZ LYS N 43 64.676 40.647 7.163 1.00271.73 N ANISOU12208 NZ LYS N 43 35285 40059 27900 3758 843 1213 N ATOM 12209 N VAL N 44 64.982 42.293 14.233 1.00251.85 N ANISOU12209 N VAL N 44 33029 37331 25330 2253 1214 3205 N ATOM 12210 CA VAL N 44 64.473 42.167 15.623 1.00252.60 C ANISOU12210 CA VAL N 44 33144 37406 25424 1820 1403 3305 C ATOM 12211 C VAL N 44 64.135 43.536 16.269 1.00261.19 C ANISOU12211 C VAL N 44 34486 38689 26064 1801 1330 3275 C ATOM 12212 O VAL N 44 63.092 43.721 16.911 1.00257.57 O ANISOU12212 O VAL N 44 33936 38325 25602 1619 1503 2901 O ATOM 12213 CB VAL N 44 65.493 41.434 16.529 1.00246.60 C ANISOU12213 CB VAL N 44 32528 36370 24795 1433 1467 3999 C ATOM 12214 CG1 VAL N 44 64.906 41.195 17.907 1.00246.85 C ANISOU12214 CG1 VAL N 44 32696 36352 24742 945 1695 4091 C ATOM 12215 CG2 VAL N 44 65.921 40.117 15.931 1.00243.63 C ANISOU12215 CG2 VAL N 44 31895 35733 24940 1461 1552 4062 C ATOM 12216 N PHE N 45 65.043 44.488 16.071 1.00275.06 N ANISOU12216 N PHE N 45 36542 40472 27495 1968 1127 3624 N ATOM 12217 CA PHE N 45 64.958 45.863 16.571 1.00285.55 C ANISOU12217 CA PHE N 45 38147 41939 28409 1977 1061 3651 C ATOM 12218 C PHE N 45 63.639 46.595 16.203 1.00284.52 C ANISOU12218 C PHE N 45 37888 41986 28231 2276 1020 2985 C ATOM 12219 O PHE N 45 62.835 46.921 17.096 1.00276.15 O ANISOU12219 O PHE N 45 36769 40997 27156 2030 1192 2736 O ATOM 12220 CB PHE N 45 66.246 46.590 16.097 1.00290.14 C ANISOU12220 CB PHE N 45 39027 42457 28754 2155 894 4072 C ATOM 12221 CG PHE N 45 66.328 48.051 16.446 1.00291.43 C ANISOU12221 CG PHE N 45 39504 42714 28510 2198 849 4117 C ATOM 12222 CD1 PHE N 45 66.480 48.475 17.765 1.00292.48 C ANISOU12222 CD1 PHE N 45 39786 42891 28449 1773 940 4357 C ATOM 12223 CD2 PHE N 45 66.309 49.010 15.434 1.00290.90 C ANISOU12223 CD2 PHE N 45 39644 42660 28223 2648 725 3937 C ATOM 12224 CE1 PHE N 45 66.557 49.827 18.072 1.00291.59 C ANISOU12224 CE1 PHE N 45 39941 42849 27999 1793 944 4350 C ATOM 12225 CE2 PHE N 45 66.395 50.364 15.734 1.00290.95 C ANISOU12225 CE2 PHE N 45 39958 42692 27897 2694 722 3980 C ATOM 12226 CZ PHE N 45 66.517 50.775 17.055 1.00290.17 C ANISOU12226 CZ PHE N 45 39925 42650 27675 2263 849 4164 C ATOM 12227 N VAL N 46 63.413 46.805 14.897 1.00284.31 N ANISOU12227 N VAL N 46 37817 42006 28199 2794 787 2675 N ATOM 12228 CA VAL N 46 62.285 47.613 14.357 1.00278.23 C ANISOU12228 CA VAL N 46 36960 41372 27379 3221 579 2079 C ATOM 12229 C VAL N 46 60.941 46.937 14.596 1.00284.49 C ANISOU12229 C VAL N 46 37240 42254 28600 3135 693 1416 C ATOM 12230 O VAL N 46 59.971 47.591 14.934 1.00287.74 O ANISOU12230 O VAL N 46 37488 42745 29093 3211 681 954 O ATOM 12231 CB VAL N 46 62.436 47.934 12.828 1.00269.05 C ANISOU12231 CB VAL N 46 35991 40215 26019 3807 227 1958 C ATOM 12232 CG1 VAL N 46 61.142 48.461 12.204 1.00263.63 C ANISOU12232 CG1 VAL N 46 35135 39655 25375 4297 -109 1288 C ATOM 12233 CG2 VAL N 46 63.583 48.906 12.572 1.00262.39 C ANISOU12233 CG2 VAL N 46 35706 39254 24736 3910 181 2481 C ATOM 12234 N VAL N 47 60.876 45.630 14.408 1.00287.28 N ANISOU12234 N VAL N 47 37303 42562 29289 2969 842 1316 N ATOM 12235 CA VAL N 47 59.596 44.972 14.513 1.00288.64 C ANISOU12235 CA VAL N 47 36957 42797 29914 2889 992 599 C ATOM 12236 C VAL N 47 59.164 44.829 15.965 1.00285.35 C ANISOU12236 C VAL N 47 36475 42314 29630 2295 1453 572 C ATOM 12237 O VAL N 47 57.979 44.829 16.243 1.00286.22 O ANISOU12237 O VAL N 47 36204 42481 30063 2224 1620 -115 O ATOM 12238 CB VAL N 47 59.550 43.653 13.737 1.00291.79 C ANISOU12238 CB VAL N 47 37049 43157 30662 2920 1033 385 C ATOM 12239 CG1 VAL N 47 58.330 42.836 14.137 1.00292.33 C ANISOU12239 CG1 VAL N 47 36574 43232 31265 2656 1352 -316 C ATOM 12240 CG2 VAL N 47 59.545 43.952 12.244 1.00295.90 C ANISOU12240 CG2 VAL N 47 37607 43801 31020 3532 559 136 C ATOM 12241 N GLU N 48 60.106 44.755 16.895 1.00278.82 N ANISOU12241 N GLU N 48 36033 41361 28545 1861 1651 1277 N ATOM 12242 CA GLU N 48 59.705 44.777 18.289 1.00280.59 C ANISOU12242 CA GLU N 48 36343 41528 28739 1276 2071 1270 C ATOM 12243 C GLU N 48 59.342 46.139 18.823 1.00279.93 C ANISOU12243 C GLU N 48 36394 41558 28407 1285 2066 1096 C ATOM 12244 O GLU N 48 58.485 46.258 19.699 1.00283.68 O ANISOU12244 O GLU N 48 36754 42026 29004 903 2450 679 O ATOM 12245 CB GLU N 48 60.700 44.065 19.165 1.00282.74 C ANISOU12245 CB GLU N 48 36985 41611 28832 775 2250 2030 C ATOM 12246 CG GLU N 48 60.393 42.579 19.183 1.00292.37 C ANISOU12246 CG GLU N 48 37980 42636 30471 518 2547 1916 C ATOM 12247 CD GLU N 48 59.181 42.204 20.037 1.00299.71 C ANISOU12247 CD GLU N 48 38752 43499 31623 29 3095 1353 C ATOM 12248 OE1 GLU N 48 58.925 42.869 21.084 1.00305.68 O ANISOU12248 OE1 GLU N 48 39773 44282 32088 -356 3334 1355 O ATOM 12249 OE2 GLU N 48 58.493 41.214 19.675 1.00300.17 O ANISOU12249 OE2 GLU N 48 38426 43458 32164 -18 3348 873 O ATOM 12250 N ALA N 49 59.966 47.174 18.283 1.00276.47 N ANISOU12250 N ALA N 49 36203 41190 27651 1697 1693 1365 N ATOM 12251 CA ALA N 49 59.392 48.514 18.399 1.00283.83 C ANISOU12251 CA ALA N 49 37146 42204 28490 1909 1617 1012 C ATOM 12252 C ALA N 49 57.925 48.604 17.847 1.00298.63 C ANISOU12252 C ALA N 49 38466 44148 30852 2269 1536 68 C ATOM 12253 O ALA N 49 57.072 49.238 18.478 1.00301.02 O ANISOU12253 O ALA N 49 38582 44457 31332 2138 1745 -427 O ATOM 12254 CB ALA N 49 60.302 49.533 17.731 1.00274.30 C ANISOU12254 CB ALA N 49 36326 41000 26895 2341 1241 1443 C ATOM 12255 N ALA N 50 57.649 47.965 16.689 1.00312.67 N ANISOU12255 N ALA N 50 39955 45971 32873 2704 1230 -217 N ATOM 12256 CA ALA N 50 56.303 47.909 16.015 1.00324.59 C ANISOU12256 CA ALA N 50 40873 47568 34888 3108 1022 -1153 C ATOM 12257 C ALA N 50 55.254 47.090 16.772 1.00330.75 C ANISOU12257 C ALA N 50 41122 48321 36227 2617 1542 -1822 C ATOM 12258 O ALA N 50 54.125 47.556 16.953 1.00342.41 O ANISOU12258 O ALA N 50 42152 49822 38124 2707 1589 -2605 O ATOM 12259 CB ALA N 50 56.416 47.403 14.570 1.00321.26 C ANISOU12259 CB ALA N 50 40366 47220 34475 3652 538 -1238 C ATOM 12260 N VAL N 51 55.636 45.876 17.188 1.00323.82 N ANISOU12260 N VAL N 51 40294 47349 35392 2106 1946 -1535 N ATOM 12261 CA VAL N 51 54.846 45.018 18.095 1.00318.97 C ANISOU12261 CA VAL N 51 39370 46622 35198 1471 2605 -2003 C ATOM 12262 C VAL N 51 54.419 45.738 19.396 1.00319.62 C ANISOU12262 C VAL N 51 39576 46643 35221 966 3083 -2165 C ATOM 12263 O VAL N 51 53.249 45.629 19.786 1.00331.01 O ANISOU12263 O VAL N 51 40540 48047 37181 727 3488 -3023 O ATOM 12264 CB VAL N 51 55.572 43.671 18.406 1.00311.99 C ANISOU12264 CB VAL N 51 38730 45562 34248 1000 2940 -1433 C ATOM 12265 CG1 VAL N 51 55.013 42.990 19.660 1.00315.83 C ANISOU12265 CG1 VAL N 51 39224 45847 34927 202 3715 -1644 C ATOM 12266 CG2 VAL N 51 55.511 42.734 17.209 1.00306.36 C ANISOU12266 CG2 VAL N 51 37656 44879 33867 1363 2695 -1678 C ATOM 12267 N ARG N 52 55.347 46.464 20.040 1.00306.94 N ANISOU12267 N ARG N 52 38574 45024 33023 783 3065 -1420 N ATOM 12268 CA ARG N 52 55.057 47.258 21.260 1.00297.81 C ANISOU12268 CA ARG N 52 37615 43827 31708 288 3503 -1538 C ATOM 12269 C ARG N 52 54.125 48.463 21.066 1.00294.46 C ANISOU12269 C ARG N 52 36794 43470 31615 670 3372 -2296 C ATOM 12270 O ARG N 52 53.339 48.755 21.964 1.00300.58 O ANISOU12270 O ARG N 52 37405 44175 32625 213 3910 -2855 O ATOM 12271 CB ARG N 52 56.335 47.685 21.974 1.00292.35 C ANISOU12271 CB ARG N 52 37656 43126 30299 -9 3471 -572 C ATOM 12272 CG ARG N 52 56.735 46.733 23.068 1.00292.96 C ANISOU12272 CG ARG N 52 38151 43054 30106 -789 3949 -108 C ATOM 12273 CD ARG N 52 58.206 46.852 23.377 1.00294.05 C ANISOU12273 CD ARG N 52 38911 43193 29618 -880 3650 923 C ATOM 12274 NE ARG N 52 58.750 45.542 23.723 1.00301.67 N ANISOU12274 NE ARG N 52 40136 43978 30506 -1251 3772 1457 N ATOM 12275 CZ ARG N 52 59.984 45.317 24.172 1.00305.70 C ANISOU12275 CZ ARG N 52 41160 44422 30568 -1438 3546 2341 C ATOM 12276 NH1 ARG N 52 60.855 46.321 24.346 1.00303.54 N ANISOU12276 NH1 ARG N 52 41189 44279 29861 -1334 3218 2779 N ATOM 12277 NH2 ARG N 52 60.344 44.071 24.462 1.00311.25 N ANISOU12277 NH2 ARG N 52 42058 44898 31302 -1730 3644 2765 N ATOM 12278 N GLY N 53 54.235 49.154 19.921 1.00284.09 N ANISOU12278 N GLY N 53 35373 42253 30315 1482 2683 -2304 N ATOM 12279 CA GLY N 53 53.228 50.139 19.460 1.00276.23 C ANISOU12279 CA GLY N 53 33904 41274 29775 2029 2389 -3094 C ATOM 12280 C GLY N 53 51.795 49.602 19.393 1.00276.80 C ANISOU12280 C GLY N 53 33154 41332 30684 2005 2604 -4220 C ATOM 12281 O GLY N 53 50.861 50.252 19.876 1.00277.90 O ANISOU12281 O GLY N 53 32891 41400 31299 1934 2847 -4969 O ATOM 12282 N VAL N 54 51.629 48.406 18.814 1.00274.13 N ANISOU12282 N VAL N 54 32530 41040 30584 2033 2560 -4393 N ATOM 12283 CA VAL N 54 50.328 47.697 18.720 1.00275.52 C ANISOU12283 CA VAL N 54 31885 41202 31597 1943 2817 -5497 C ATOM 12284 C VAL N 54 49.779 47.196 20.069 1.00278.26 C ANISOU12284 C VAL N 54 32128 41376 32219 991 3837 -5903 C ATOM 12285 O VAL N 54 48.598 47.409 20.359 1.00279.40 O ANISOU12285 O VAL N 54 31620 41455 33081 883 4156 -6949 O ATOM 12286 CB VAL N 54 50.390 46.499 17.734 1.00274.32 C ANISOU12286 CB VAL N 54 31502 41137 31589 2172 2547 -5547 C ATOM 12287 CG1 VAL N 54 49.072 45.731 17.738 1.00278.98 C ANISOU12287 CG1 VAL N 54 31224 41699 33075 1981 2907 -6733 C ATOM 12288 CG2 VAL N 54 50.748 46.959 16.323 1.00274.03 C ANISOU12288 CG2 VAL N 54 31549 41265 31303 3088 1572 -5324 C ATOM 12289 N ARG N 55 50.627 46.524 20.864 1.00279.44 N ANISOU12289 N ARG N 55 32928 41426 31820 312 4333 -5106 N ATOM 12290 CA ARG N 55 50.304 46.079 22.235 1.00286.10 C ANISOU12290 CA ARG N 55 33962 42066 32675 -669 5317 -5273 C ATOM 12291 C ARG N 55 49.823 47.241 23.088 1.00288.46 C ANISOU12291 C ARG N 55 34253 42321 33024 -926 5661 -5684 C ATOM 12292 O ARG N 55 49.024 47.062 23.996 1.00296.10 O ANISOU12292 O ARG N 55 35051 43125 34329 -1614 6488 -6355 O ATOM 12293 CB ARG N 55 51.533 45.510 22.949 1.00285.60 C ANISOU12293 CB ARG N 55 34801 41907 31804 -1213 5538 -4112 C ATOM 12294 CG ARG N 55 51.986 44.112 22.567 1.00286.45 C ANISOU12294 CG ARG N 55 35014 41919 31903 -1299 5549 -3700 C ATOM 12295 CD ARG N 55 52.752 43.492 23.738 1.00285.77 C ANISOU12295 CD ARG N 55 35752 41612 31212 -2097 6057 -2862 C ATOM 12296 NE ARG N 55 53.954 42.728 23.354 1.00279.51 N ANISOU12296 NE ARG N 55 35376 40768 30054 -1936 5658 -1874 N ATOM 12297 CZ ARG N 55 55.193 42.969 23.796 1.00272.23 C ANISOU12297 CZ ARG N 55 35154 39842 28438 -2026 5378 -840 C ATOM 12298 NH1 ARG N 55 55.423 43.955 24.656 1.00270.39 N ANISOU12298 NH1 ARG N 55 35341 39680 27715 -2303 5453 -619 N ATOM 12299 NH2 ARG N 55 56.211 42.215 23.390 1.00265.92 N ANISOU12299 NH2 ARG N 55 34600 38957 27480 -1852 5029 -71 N ATOM 12300 N GLN N 56 50.347 48.428 22.818 1.00281.73 N ANISOU12300 N GLN N 56 33630 41585 31830 -421 5094 -5281 N ATOM 12301 CA GLN N 56 49.936 49.606 23.552 1.00278.52 C ANISOU12301 CA GLN N 56 33199 41120 31505 -605 5385 -5671 C ATOM 12302 C GLN N 56 48.617 50.191 23.044 1.00285.02 C ANISOU12302 C GLN N 56 33079 41911 33303 -101 5228 -6893 C ATOM 12303 O GLN N 56 47.752 50.527 23.865 1.00291.36 O ANISOU12303 O GLN N 56 33549 42568 34587 -585 5907 -7712 O ATOM 12304 CB GLN N 56 51.049 50.649 23.579 1.00268.27 C ANISOU12304 CB GLN N 56 32556 39904 29468 -349 4941 -4760 C ATOM 12305 CG GLN N 56 50.884 51.683 24.680 1.00264.48 C ANISOU12305 CG GLN N 56 32284 39340 28866 -841 5460 -4961 C ATOM 12306 CD GLN N 56 50.699 51.064 26.054 1.00265.36 C ANISOU12306 CD GLN N 56 32724 39333 28768 -1954 6445 -5068 C ATOM 12307 OE1 GLN N 56 51.325 50.054 26.385 1.00260.32 O ANISOU12307 OE1 GLN N 56 32586 38684 27637 -2401 6615 -4422 O ATOM 12308 NE2 GLN N 56 49.835 51.671 26.861 1.00270.89 N ANISOU12308 NE2 GLN N 56 33176 39905 29844 -2416 7113 -5894 N ATOM 12309 N ALA N 57 48.468 50.302 21.716 1.00284.74 N ANISOU12309 N ALA N 57 32633 41994 33561 842 4340 -7037 N ATOM 12310 CA ALA N 57 47.197 50.672 21.076 1.00293.80 C ANISOU12310 CA ALA N 57 32818 43118 35694 1432 4002 -8215 C ATOM 12311 C ALA N 57 46.068 49.812 21.628 1.00307.16 C ANISOU12311 C ALA N 57 33810 44694 38201 806 4812 -9312 C ATOM 12312 O ALA N 57 45.063 50.334 22.095 1.00313.14 O ANISOU12312 O ALA N 57 33957 45307 39714 659 5203 -10320 O ATOM 12313 CB ALA N 57 47.284 50.519 19.571 1.00288.18 C ANISOU12313 CB ALA N 57 31898 42572 35023 2402 2955 -8121 C ATOM 12314 N GLN N 58 46.263 48.493 21.612 1.00318.28 N ANISOU12314 N GLN N 58 35326 46123 39481 394 5137 -9124 N ATOM 12315 CA GLN N 58 45.358 47.529 22.286 1.00341.22 C ANISOU12315 CA GLN N 58 37771 48856 43020 -398 6116 -10019 C ATOM 12316 C GLN N 58 45.106 47.715 23.836 1.00363.22 C ANISOU12316 C GLN N 58 40876 51400 45731 -1472 7301 -10244 C ATOM 12317 O GLN N 58 43.952 47.586 24.275 1.00381.62 O ANISOU12317 O GLN N 58 42517 53555 48926 -1890 8010 -11453 O ATOM 12318 CB GLN N 58 45.767 46.074 21.948 1.00333.04 C ANISOU12318 CB GLN N 58 36928 47838 41771 -622 6227 -9613 C ATOM 12319 CG GLN N 58 45.639 45.701 20.467 1.00326.73 C ANISOU12319 CG GLN N 58 35597 47251 41292 268 5291 -9827 C ATOM 12320 CD GLN N 58 46.280 44.361 20.112 1.00322.91 C ANISOU12320 CD GLN N 58 35432 46775 40483 74 5365 -9240 C ATOM 12321 OE1 GLN N 58 47.168 43.873 20.814 1.00315.19 O ANISOU12321 OE1 GLN N 58 35254 45669 38832 -511 5821 -8307 O ATOM 12322 NE2 GLN N 58 45.836 43.767 19.004 1.00328.87 N ANISOU12322 NE2 GLN N 58 35552 47669 41733 586 4873 -9801 N ATOM 12323 N ALA N 59 46.152 48.028 24.634 1.00371.68 N ANISOU12323 N ALA N 59 42959 52458 45803 -1921 7511 -9165 N ATOM 12324 CA ALA N 59 46.088 48.108 26.135 1.00378.88 C ANISOU12324 CA ALA N 59 44404 53161 46391 -3022 8613 -9202 C ATOM 12325 C ALA N 59 45.192 49.203 26.719 1.00386.20 C ANISOU12325 C ALA N 59 44859 53967 47911 -3203 9073 -10199 C ATOM 12326 O ALA N 59 44.370 48.927 27.593 1.00387.96 O ANISOU12326 O ALA N 59 44890 53959 48558 -4039 10129 -11052 O ATOM 12327 CB ALA N 59 47.485 48.196 26.751 1.00369.66 C ANISOU12327 CB ALA N 59 44418 52052 43983 -3363 8538 -7788 C ATOM 12328 N GLU N 60 45.363 50.435 26.238 1.00388.23 N ANISOU12328 N GLU N 60 44959 54337 48211 -2445 8330 -10099 N ATOM 12329 CA GLU N 60 44.580 51.596 26.705 1.00395.67 C ANISOU12329 CA GLU N 60 45423 55134 49779 -2489 8658 -11006 C ATOM 12330 C GLU N 60 43.261 51.796 25.918 1.00408.47 C ANISOU12330 C GLU N 60 45740 56679 52779 -1820 8346 -12384 C ATOM 12331 O GLU N 60 42.644 52.876 25.946 1.00408.79 O ANISOU12331 O GLU N 60 45233 56596 53491 -1492 8257 -13107 O ATOM 12332 CB GLU N 60 45.437 52.856 26.636 1.00384.10 C ANISOU12332 CB GLU N 60 44480 53763 47697 -2030 8056 -10203 C ATOM 12333 CG GLU N 60 45.836 53.192 25.222 1.00368.60 C ANISOU12333 CG GLU N 60 42347 51969 45733 -810 6771 -9740 C ATOM 12334 CD GLU N 60 46.888 54.270 25.160 1.00354.72 C ANISOU12334 CD GLU N 60 41292 50279 43206 -458 6262 -8767 C ATOM 12335 OE1 GLU N 60 46.573 55.392 24.710 1.00349.44 O ANISOU12335 OE1 GLU N 60 40281 49522 42967 228 5777 -9091 O ATOM 12336 OE2 GLU N 60 48.034 53.992 25.561 1.00345.45 O ANISOU12336 OE2 GLU N 60 41004 49218 41031 -862 6341 -7694 O ATOM 12337 N ASP N 61 42.870 50.743 25.185 1.00421.82 N ANISOU12337 N ASP N 61 46929 58437 54903 -1584 8120 -12732 N ATOM 12338 CA ASP N 61 41.571 50.638 24.476 1.00443.15 C ANISOU12338 CA ASP N 61 48338 61085 58951 -1066 7872 -14141 C ATOM 12339 C ASP N 61 41.372 51.556 23.226 1.00455.60 C ANISOU12339 C ASP N 61 49343 62783 60978 282 6500 -14300 C ATOM 12340 O ASP N 61 40.639 52.546 23.310 1.00474.79 O ANISOU12340 O ASP N 61 51144 65049 64203 597 6411 -15125 O ATOM 12341 CB ASP N 61 40.401 50.757 25.474 1.00446.20 C ANISOU12341 CB ASP N 61 48064 61166 60305 -1873 9063 -15539 C ATOM 12342 CG ASP N 61 39.196 49.940 25.037 1.00455.44 C ANISOU12342 CG ASP N 61 48068 62259 62718 -1839 9261 -16929 C ATOM 12343 OD1 ASP N 61 39.396 48.872 24.416 1.00460.70 O ANISOU12343 OD1 ASP N 61 48758 63072 63214 -1718 8990 -16656 O ATOM 12344 OD2 ASP N 61 38.052 50.366 25.270 1.00458.37 O ANISOU12344 OD2 ASP N 61 47442 62418 64297 -1906 9662 -18342 O ATOM 12345 N ALA N 62 41.976 51.198 22.071 1.00451.62 N ANISOU12345 N ALA N 62 49060 62527 60008 1053 5463 -13567 N ATOM 12346 CA ALA N 62 42.034 52.070 20.855 1.00441.10 C ANISOU12346 CA ALA N 62 47537 61303 58756 2317 4099 -13405 C ATOM 12347 C ALA N 62 41.700 51.488 19.447 1.00431.00 C ANISOU12347 C ALA N 62 45717 60229 57810 3191 3058 -13707 C ATOM 12348 O ALA N 62 41.671 50.262 19.242 1.00433.36 O ANISOU12348 O ALA N 62 45895 60650 58109 2872 3295 -13807 O ATOM 12349 CB ALA N 62 43.369 52.813 20.801 1.00432.65 C ANISOU12349 CB ALA N 62 47588 60300 56496 2547 3683 -11958 C ATOM 12350 N LEU N 63 41.509 52.431 18.499 1.00414.56 N ANISOU12350 N LEU N 63 43416 58162 55934 4285 1898 -13782 N ATOM 12351 CA LEU N 63 41.042 52.227 17.099 1.00405.02 C ANISOU12351 CA LEU N 63 41669 57126 55095 5292 688 -14200 C ATOM 12352 C LEU N 63 42.174 52.003 16.062 1.00398.71 C ANISOU12352 C LEU N 63 41788 56565 53138 5813 -148 -12943 C ATOM 12353 O LEU N 63 41.929 51.549 14.937 1.00405.06 O ANISOU12353 O LEU N 63 42305 57560 54038 6447 -1002 -13186 O ATOM 12354 CB LEU N 63 40.268 53.464 16.607 1.00401.11 C ANISOU12354 CB LEU N 63 40587 56459 55356 6264 -225 -14864 C ATOM 12355 CG LEU N 63 39.372 54.361 17.456 1.00403.30 C ANISOU12355 CG LEU N 63 40149 56403 56681 6115 260 -15853 C ATOM 12356 CD1 LEU N 63 39.570 55.804 17.031 1.00400.41 C ANISOU12356 CD1 LEU N 63 40118 55840 56177 7029 -640 -15416 C ATOM 12357 CD2 LEU N 63 37.922 53.930 17.333 1.00412.90 C ANISOU12357 CD2 LEU N 63 39919 57565 59396 6216 254 -17548 C ATOM 12358 N ARG N 64 43.408 52.353 16.448 1.00388.49 N ANISOU12358 N ARG N 64 41582 55251 50773 5526 112 -11660 N ATOM 12359 CA ARG N 64 44.580 52.466 15.547 1.00381.11 C ANISOU12359 CA ARG N 64 41601 54459 48744 6027 -619 -10431 C ATOM 12360 C ARG N 64 45.919 52.760 16.304 1.00374.76 C ANISOU12360 C ARG N 64 41869 53602 46920 5452 -37 -9166 C ATOM 12361 O ARG N 64 45.888 53.163 17.476 1.00378.06 O ANISOU12361 O ARG N 64 42339 53865 47439 4815 758 -9229 O ATOM 12362 CB ARG N 64 44.298 53.553 14.500 1.00384.89 C ANISOU12362 CB ARG N 64 42065 54871 49305 7178 -1834 -10509 C ATOM 12363 CG ARG N 64 43.837 54.905 15.064 1.00392.09 C ANISOU12363 CG ARG N 64 42792 55477 50707 7396 -1813 -10840 C ATOM 12364 CD ARG N 64 44.629 56.013 14.398 1.00399.01 C ANISOU12364 CD ARG N 64 44573 56230 50803 8124 -2584 -9875 C ATOM 12365 NE ARG N 64 45.262 55.446 13.204 1.00405.48 N ANISOU12365 NE ARG N 64 45941 57273 50848 8566 -3308 -9234 N ATOM 12366 CZ ARG N 64 46.467 55.763 12.737 1.00410.02 C ANISOU12366 CZ ARG N 64 47595 57848 50345 8723 -3535 -8060 C ATOM 12367 NH1 ARG N 64 47.215 56.682 13.346 1.00417.03 N ANISOU12367 NH1 ARG N 64 49147 58530 50772 8512 -3150 -7349 N ATOM 12368 NH2 ARG N 64 46.917 55.154 11.645 1.00409.34 N ANISOU12368 NH2 ARG N 64 47905 57958 49666 9064 -4115 -7659 N ATOM 12369 N VAL N 65 47.081 52.564 15.653 1.00369.76 N ANISOU12369 N VAL N 65 42064 53092 45335 5648 -417 -8085 N ATOM 12370 CA VAL N 65 48.433 52.780 16.304 1.00366.63 C ANISOU12370 CA VAL N 65 42636 52661 44005 5129 57 -6901 C ATOM 12371 C VAL N 65 49.120 54.169 16.055 1.00362.55 C ANISOU12371 C VAL N 65 42806 52006 42939 5631 -393 -6204 C ATOM 12372 O VAL N 65 49.717 54.433 14.992 1.00359.69 O ANISOU12372 O VAL N 65 42951 51672 42043 6263 -1109 -5636 O ATOM 12373 CB VAL N 65 49.415 51.584 16.060 1.00361.91 C ANISOU12373 CB VAL N 65 42503 52223 42782 4772 219 -6145 C ATOM 12374 CG1 VAL N 65 50.774 51.829 16.719 1.00357.17 C ANISOU12374 CG1 VAL N 65 42795 51578 41334 4296 608 -5016 C ATOM 12375 CG2 VAL N 65 48.813 50.272 16.556 1.00361.27 C ANISOU12375 CG2 VAL N 65 41857 52188 43220 4125 869 -6752 C ATOM 12376 N ASP N 66 49.051 55.028 17.082 1.00356.61 N ANISOU12376 N ASP N 66 42109 51082 42304 5267 122 -6268 N ATOM 12377 CA ASP N 66 49.419 56.455 17.010 1.00339.42 C ANISOU12377 CA ASP N 66 40401 48701 39860 5698 -176 -5876 C ATOM 12378 C ASP N 66 50.707 56.775 17.796 1.00326.37 C ANISOU12378 C ASP N 66 39587 47036 37381 5086 369 -4896 C ATOM 12379 O ASP N 66 51.180 55.939 18.573 1.00322.78 O ANISOU12379 O ASP N 66 39282 46713 36644 4289 1003 -4609 O ATOM 12380 CB ASP N 66 48.257 57.279 17.573 1.00340.94 C ANISOU12380 CB ASP N 66 39904 48671 40964 5781 -8 -6856 C ATOM 12381 CG ASP N 66 47.849 58.398 16.661 1.00338.81 C ANISOU12381 CG ASP N 66 39594 48178 40958 6825 -920 -7025 C ATOM 12382 OD1 ASP N 66 48.750 59.105 16.172 1.00327.92 O ANISOU12382 OD1 ASP N 66 39035 46701 38857 7197 -1291 -6158 O ATOM 12383 OD2 ASP N 66 46.633 58.573 16.445 1.00347.48 O ANISOU12383 OD2 ASP N 66 39850 49168 43008 7268 -1258 -8037 O ATOM 12384 N VAL N 67 51.251 57.987 17.621 1.00319.50 N ANISOU12384 N VAL N 67 39256 45984 36154 5452 119 -4415 N ATOM 12385 CA VAL N 67 52.500 58.431 18.297 1.00317.11 C ANISOU12385 CA VAL N 67 39719 45664 35102 4936 564 -3540 C ATOM 12386 C VAL N 67 52.524 58.239 19.825 1.00321.52 C ANISOU12386 C VAL N 67 40205 46276 35680 3916 1496 -3671 C ATOM 12387 O VAL N 67 53.549 57.841 20.400 1.00322.84 O ANISOU12387 O VAL N 67 40885 46569 35210 3309 1857 -2974 O ATOM 12388 CB VAL N 67 52.808 59.922 18.016 1.00316.83 C ANISOU12388 CB VAL N 67 40136 45349 34896 5447 278 -3259 C ATOM 12389 CG1 VAL N 67 54.310 60.163 17.991 1.00310.18 C ANISOU12389 CG1 VAL N 67 40167 44523 33162 5233 383 -2223 C ATOM 12390 CG2 VAL N 67 52.189 60.375 16.701 1.00319.02 C ANISOU12390 CG2 VAL N 67 40304 45457 35450 6511 -632 -3519 C ATOM 12391 N ASP N 68 51.386 58.545 20.461 1.00328.38 N ANISOU12391 N ASP N 68 40446 47028 37292 3741 1858 -4598 N ATOM 12392 CA ASP N 68 51.213 58.495 21.920 1.00327.97 C ANISOU12392 CA ASP N 68 40331 46977 37302 2761 2798 -4889 C ATOM 12393 C ASP N 68 51.615 57.151 22.537 1.00320.94 C ANISOU12393 C ASP N 68 39622 46299 36019 1953 3291 -4582 C ATOM 12394 O ASP N 68 52.360 57.089 23.521 1.00312.75 O ANISOU12394 O ASP N 68 39115 45323 34389 1201 3808 -4078 O ATOM 12395 CB ASP N 68 49.736 58.750 22.273 1.00341.63 C ANISOU12395 CB ASP N 68 41189 48538 40076 2753 3096 -6133 C ATOM 12396 CG ASP N 68 49.289 60.192 22.028 1.00353.98 C ANISOU12396 CG ASP N 68 42564 49807 42123 3387 2789 -6507 C ATOM 12397 OD1 ASP N 68 50.048 61.025 21.489 1.00357.03 O ANISOU12397 OD1 ASP N 68 43516 50097 42040 3896 2312 -5820 O ATOM 12398 OD2 ASP N 68 48.141 60.497 22.416 1.00367.03 O ANISOU12398 OD2 ASP N 68 43478 51281 44696 3343 3085 -7549 O ATOM 12399 N GLN N 69 51.073 56.085 21.962 1.00323.10 N ANISOU12399 N GLN N 69 39445 46660 36656 2123 3108 -4930 N ATOM 12400 CA GLN N 69 51.273 54.730 22.450 1.00325.23 C ANISOU12400 CA GLN N 69 39806 47055 36710 1430 3569 -4750 C ATOM 12401 C GLN N 69 52.739 54.330 22.319 1.00323.33 C ANISOU12401 C GLN N 69 40338 46939 35571 1322 3354 -3568 C ATOM 12402 O GLN N 69 53.336 53.802 23.264 1.00328.03 O ANISOU12402 O GLN N 69 41370 47574 35691 556 3848 -3106 O ATOM 12403 CB GLN N 69 50.360 53.765 21.688 1.00329.09 C ANISOU12403 CB GLN N 69 39589 47584 37863 1749 3353 -5440 C ATOM 12404 CG GLN N 69 48.901 53.811 22.132 1.00340.83 C ANISOU12404 CG GLN N 69 40236 48941 40320 1549 3821 -6715 C ATOM 12405 CD GLN N 69 48.080 54.898 21.459 1.00352.39 C ANISOU12405 CD GLN N 69 41122 50286 42485 2397 3240 -7419 C ATOM 12406 OE1 GLN N 69 48.283 55.202 20.282 1.00362.08 O ANISOU12406 OE1 GLN N 69 42391 51557 43626 3292 2327 -7151 O ATOM 12407 NE2 GLN N 69 47.138 55.481 22.200 1.00357.66 N ANISOU12407 NE2 GLN N 69 41267 50766 43860 2114 3769 -8341 N ATOM 12408 N LEU N 70 53.314 54.600 21.150 1.00320.74 N ANISOU12408 N LEU N 70 40195 46648 35024 2089 2610 -3104 N ATOM 12409 CA LEU N 70 54.732 54.353 20.912 1.00313.50 C ANISOU12409 CA LEU N 70 39943 45812 33360 2060 2390 -2063 C ATOM 12410 C LEU N 70 55.642 55.034 21.957 1.00321.26 C ANISOU12410 C LEU N 70 41516 46781 33767 1502 2750 -1488 C ATOM 12411 O LEU N 70 56.534 54.383 22.519 1.00326.54 O ANISOU12411 O LEU N 70 42590 47525 33954 973 2944 -857 O ATOM 12412 CB LEU N 70 55.128 54.774 19.492 1.00296.06 C ANISOU12412 CB LEU N 70 37885 43589 31015 2955 1622 -1769 C ATOM 12413 CG LEU N 70 56.624 54.629 19.197 1.00279.60 C ANISOU12413 CG LEU N 70 36453 41544 28237 2924 1454 -776 C ATOM 12414 CD1 LEU N 70 56.957 53.185 18.857 1.00268.90 C ANISOU12414 CD1 LEU N 70 35025 40291 26851 2773 1428 -539 C ATOM 12415 CD2 LEU N 70 57.063 55.577 18.096 1.00276.48 C ANISOU12415 CD2 LEU N 70 36401 41046 27603 3670 899 -494 C ATOM 12416 N GLU N 71 55.417 56.321 22.227 1.00323.81 N ANISOU12416 N GLU N 71 41873 46994 34163 1621 2816 -1727 N ATOM 12417 CA GLU N 71 56.271 57.064 23.180 1.00313.21 C ANISOU12417 CA GLU N 71 41071 45652 32282 1102 3144 -1253 C ATOM 12418 C GLU N 71 56.148 56.632 24.653 1.00313.05 C ANISOU12418 C GLU N 71 41167 45695 32083 96 3865 -1369 C ATOM 12419 O GLU N 71 57.027 56.914 25.495 1.00301.46 O ANISOU12419 O GLU N 71 40223 44290 30024 -441 4081 -856 O ATOM 12420 CB GLU N 71 56.107 58.556 22.977 1.00308.21 C ANISOU12420 CB GLU N 71 40469 44844 31792 1532 3024 -1465 C ATOM 12421 CG GLU N 71 56.659 58.949 21.626 1.00294.82 C ANISOU12421 CG GLU N 71 39001 43067 29949 2384 2339 -1032 C ATOM 12422 CD GLU N 71 56.229 60.339 21.222 1.00289.98 C ANISOU12422 CD GLU N 71 38367 42195 29615 2968 2138 -1339 C ATOM 12423 OE1 GLU N 71 55.306 60.898 21.855 1.00293.15 O ANISOU12423 OE1 GLU N 71 38391 42479 30512 2822 2467 -2031 O ATOM 12424 OE2 GLU N 71 56.812 60.884 20.266 1.00279.62 O ANISOU12424 OE2 GLU N 71 37440 40754 28046 3568 1681 -903 O ATOM 12425 N LYS N 72 55.067 55.901 24.922 1.00320.42 N ANISOU12425 N LYS N 72 41634 46602 33506 -161 4223 -2056 N ATOM 12426 CA LYS N 72 54.883 55.161 26.170 1.00322.61 C ANISOU12426 CA LYS N 72 42084 46902 33590 -1129 4926 -2153 C ATOM 12427 C LYS N 72 55.741 53.868 26.237 1.00313.84 C ANISOU12427 C LYS N 72 41371 45879 31994 -1420 4816 -1378 C ATOM 12428 O LYS N 72 56.196 53.485 27.317 1.00311.93 O ANISOU12428 O LYS N 72 41635 45659 31225 -2191 5199 -1004 O ATOM 12429 CB LYS N 72 53.381 54.910 26.434 1.00335.76 C ANISOU12429 CB LYS N 72 43096 48447 36031 -1337 5454 -3262 C ATOM 12430 CG LYS N 72 52.572 56.212 26.546 1.00345.18 C ANISOU12430 CG LYS N 72 43886 49502 37763 -1128 5616 -4049 C ATOM 12431 CD LYS N 72 51.309 56.127 27.403 1.00363.55 C ANISOU12431 CD LYS N 72 45748 51685 40698 -1750 6458 -5124 C ATOM 12432 CE LYS N 72 50.807 57.515 27.819 1.00374.55 C ANISOU12432 CE LYS N 72 46921 52919 42470 -1742 6739 -5744 C ATOM 12433 NZ LYS N 72 49.982 57.502 29.065 1.00386.60 N ANISOU12433 NZ LYS N 72 48319 54316 44253 -2707 7794 -6574 N ATOM 12434 N VAL N 73 55.969 53.219 25.088 1.00303.94 N ANISOU12434 N VAL N 73 39918 44655 30911 -801 4275 -1141 N ATOM 12435 CA VAL N 73 56.835 52.005 24.991 1.00288.46 C ANISOU12435 CA VAL N 73 38264 42727 28607 -961 4111 -410 C ATOM 12436 C VAL N 73 58.324 52.319 24.677 1.00271.37 C ANISOU12436 C VAL N 73 36585 40633 25887 -722 3606 527 C ATOM 12437 O VAL N 73 59.157 51.393 24.555 1.00266.43 O ANISOU12437 O VAL N 73 36182 40007 25039 -795 3410 1151 O ATOM 12438 CB VAL N 73 56.266 50.924 24.007 1.00292.05 C ANISOU12438 CB VAL N 73 38217 43154 29593 -561 3926 -729 C ATOM 12439 CG1 VAL N 73 54.776 50.688 24.242 1.00300.91 C ANISOU12439 CG1 VAL N 73 38754 44199 31377 -757 4415 -1774 C ATOM 12440 CG2 VAL N 73 56.530 51.275 22.541 1.00290.21 C ANISOU12440 CG2 VAL N 73 37781 42978 29505 365 3214 -638 C ATOM 12441 N LEU N 74 58.636 53.621 24.545 1.00257.01 N ANISOU12441 N LEU N 74 34893 38836 23919 -446 3435 568 N ATOM 12442 CA LEU N 74 60.001 54.140 24.240 1.00243.08 C ANISOU12442 CA LEU N 74 33548 37110 21698 -231 3041 1318 C ATOM 12443 C LEU N 74 61.013 53.797 25.337 1.00239.18 C ANISOU12443 C LEU N 74 33556 36682 20638 -921 3164 1960 C ATOM 12444 O LEU N 74 62.129 53.354 25.047 1.00236.63 O ANISOU12444 O LEU N 74 33442 36373 20092 -827 2817 2614 O ATOM 12445 CB LEU N 74 60.010 55.675 23.993 1.00237.71 C ANISOU12445 CB LEU N 74 32928 36384 21007 125 2959 1142 C ATOM 12446 CG LEU N 74 59.551 56.372 22.699 1.00237.17 C ANISOU12446 CG LEU N 74 32614 36203 21295 998 2576 828 C ATOM 12447 CD1 LEU N 74 60.099 57.793 22.669 1.00235.68 C ANISOU12447 CD1 LEU N 74 32751 35917 20878 1181 2529 1000 C ATOM 12448 CD2 LEU N 74 59.895 55.624 21.415 1.00235.35 C ANISOU12448 CD2 LEU N 74 32322 35973 21126 1562 2097 1098 C ATOM 12449 N PRO N 75 60.626 54.011 26.598 1.00240.41 N ANISOU12449 N PRO N 75 33908 36865 20569 -1621 3644 1744 N ATOM 12450 CA PRO N 75 61.454 53.560 27.705 1.00239.71 C ANISOU12450 CA PRO N 75 34350 36838 19891 -2313 3715 2323 C ATOM 12451 C PRO N 75 61.946 52.122 27.523 1.00232.94 C ANISOU12451 C PRO N 75 33567 35919 19019 -2337 3474 2848 C ATOM 12452 O PRO N 75 63.133 51.838 27.680 1.00228.66 O ANISOU12452 O PRO N 75 33334 35400 18144 -2403 3106 3548 O ATOM 12453 CB PRO N 75 60.483 53.603 28.875 1.00250.93 C ANISOU12453 CB PRO N 75 35884 38240 21216 -3044 4383 1793 C ATOM 12454 CG PRO N 75 59.516 54.693 28.531 1.00253.50 C ANISOU12454 CG PRO N 75 35781 38528 22009 -2734 4621 997 C ATOM 12455 CD PRO N 75 59.420 54.743 27.043 1.00245.50 C ANISOU12455 CD PRO N 75 34310 37468 21501 -1799 4131 922 C ATOM 12456 N GLN N 76 61.022 51.240 27.170 1.00228.52 N ANISOU12456 N GLN N 76 32674 35257 18893 -2265 3680 2455 N ATOM 12457 CA GLN N 76 61.272 49.822 27.113 1.00224.84 C ANISOU12457 CA GLN N 76 32271 34674 18483 -2375 3600 2838 C ATOM 12458 C GLN N 76 62.217 49.423 26.004 1.00217.93 C ANISOU12458 C GLN N 76 31246 33780 17778 -1762 3022 3328 C ATOM 12459 O GLN N 76 63.063 48.554 26.177 1.00215.71 O ANISOU12459 O GLN N 76 31191 33406 17361 -1892 2795 3947 O ATOM 12460 CB GLN N 76 59.945 49.099 26.947 1.00227.70 C ANISOU12460 CB GLN N 76 32238 34924 19353 -2449 4046 2142 C ATOM 12461 CG GLN N 76 60.008 47.617 27.240 1.00233.57 C ANISOU12461 CG GLN N 76 33155 35478 20112 -2796 4191 2456 C ATOM 12462 CD GLN N 76 61.010 47.262 28.324 1.00240.27 C ANISOU12462 CD GLN N 76 34733 36264 20295 -3354 4095 3279 C ATOM 12463 OE1 GLN N 76 60.902 47.700 29.472 1.00248.96 O ANISOU12463 OE1 GLN N 76 36303 37396 20894 -3983 4417 3273 O ATOM 12464 NE2 GLN N 76 61.997 46.471 27.962 1.00240.52 N ANISOU12464 NE2 GLN N 76 34863 36195 20326 -3125 3627 3968 N ATOM 12465 N LEU N 77 62.054 50.060 24.859 1.00215.79 N ANISOU12465 N LEU N 77 30611 33563 17814 -1095 2793 3028 N ATOM 12466 CA LEU N 77 62.888 49.776 23.701 1.00213.09 C ANISOU12466 CA LEU N 77 30147 33190 17624 -524 2328 3391 C ATOM 12467 C LEU N 77 64.364 50.150 23.904 1.00210.77 C ANISOU12467 C LEU N 77 30203 32913 16964 -571 2008 4089 C ATOM 12468 O LEU N 77 65.234 49.389 23.482 1.00209.21 O ANISOU12468 O LEU N 77 29995 32625 16869 -431 1731 4543 O ATOM 12469 CB LEU N 77 62.319 50.458 22.443 1.00213.03 C ANISOU12469 CB LEU N 77 29796 33219 17926 175 2159 2895 C ATOM 12470 CG LEU N 77 62.955 50.218 21.057 1.00208.14 C ANISOU12470 CG LEU N 77 29072 32557 17452 788 1755 3108 C ATOM 12471 CD1 LEU N 77 62.860 48.770 20.610 1.00204.87 C ANISOU12471 CD1 LEU N 77 28413 32064 17364 811 1739 3130 C ATOM 12472 CD2 LEU N 77 62.339 51.135 20.014 1.00208.14 C ANISOU12472 CD2 LEU N 77 28916 32583 17582 1416 1572 2640 C ATOM 12473 N LEU N 78 64.618 51.313 24.533 1.00210.65 N ANISOU12473 N LEU N 78 30441 32998 16596 -770 2068 4103 N ATOM 12474 CA LEU N 78 65.969 51.825 24.899 1.00209.45 C ANISOU12474 CA LEU N 78 30596 32888 16096 -903 1807 4651 C ATOM 12475 C LEU N 78 66.682 50.859 25.808 1.00217.21 C ANISOU12475 C LEU N 78 31836 33834 16859 -1381 1655 5209 C ATOM 12476 O LEU N 78 67.905 50.716 25.729 1.00221.58 O ANISOU12476 O LEU N 78 32457 34354 17376 -1316 1282 5708 O ATOM 12477 CB LEU N 78 65.894 53.120 25.715 1.00204.67 C ANISOU12477 CB LEU N 78 30232 32402 15128 -1217 2015 4468 C ATOM 12478 CG LEU N 78 65.284 54.429 25.234 1.00199.20 C ANISOU12478 CG LEU N 78 29427 31716 14545 -881 2191 3957 C ATOM 12479 CD1 LEU N 78 65.283 55.477 26.335 1.00199.78 C ANISOU12479 CD1 LEU N 78 29771 31886 14250 -1378 2465 3819 C ATOM 12480 CD2 LEU N 78 66.030 54.923 24.003 1.00193.24 C ANISOU12480 CD2 LEU N 78 28621 30873 13926 -263 1899 4129 C ATOM 12481 N LEU N 79 65.896 50.273 26.720 1.00222.39 N ANISOU12481 N LEU N 79 32659 34471 17367 -1883 1961 5087 N ATOM 12482 CA LEU N 79 66.352 49.297 27.716 1.00226.82 C ANISOU12482 CA LEU N 79 33601 34943 17637 -2396 1854 5611 C ATOM 12483 C LEU N 79 66.839 47.998 27.086 1.00231.17 C ANISOU12483 C LEU N 79 33969 35281 18582 -2112 1563 5999 C ATOM 12484 O LEU N 79 67.779 47.360 27.585 1.00228.75 O ANISOU12484 O LEU N 79 33908 34863 18140 -2284 1197 6613 O ATOM 12485 CB LEU N 79 65.237 49.007 28.739 1.00227.43 C ANISOU12485 CB LEU N 79 33958 34992 17460 -3022 2394 5294 C ATOM 12486 CG LEU N 79 65.356 49.704 30.106 1.00228.85 C ANISOU12486 CG LEU N 79 34694 35308 16948 -3703 2549 5365 C ATOM 12487 CD1 LEU N 79 63.993 49.995 30.727 1.00231.72 C ANISOU12487 CD1 LEU N 79 35135 35681 17228 -4179 3278 4677 C ATOM 12488 CD2 LEU N 79 66.231 48.910 31.071 1.00232.05 C ANISOU12488 CD2 LEU N 79 35678 35628 16859 -4150 2197 6110 C ATOM 12489 N ASP N 80 66.192 47.620 25.988 1.00238.53 N ANISOU12489 N ASP N 80 34457 36145 20025 -1666 1700 5613 N ATOM 12490 CA ASP N 80 66.564 46.420 25.257 1.00246.74 C ANISOU12490 CA ASP N 80 35260 36975 21512 -1378 1504 5865 C ATOM 12491 C ASP N 80 67.742 46.605 24.288 1.00246.94 C ANISOU12491 C ASP N 80 35065 36977 21782 -878 1079 6146 C ATOM 12492 O ASP N 80 68.427 45.635 23.943 1.00247.96 O ANISOU12492 O ASP N 80 35069 36902 22240 -742 849 6502 O ATOM 12493 CB ASP N 80 65.339 45.856 24.552 1.00249.63 C ANISOU12493 CB ASP N 80 35253 37287 22305 -1189 1856 5272 C ATOM 12494 CG ASP N 80 64.353 45.275 25.530 1.00256.73 C ANISOU12494 CG ASP N 80 36359 38095 23090 -1762 2328 5061 C ATOM 12495 OD1 ASP N 80 64.789 44.837 26.620 1.00263.16 O ANISOU12495 OD1 ASP N 80 37667 38789 23532 -2266 2309 5565 O ATOM 12496 OD2 ASP N 80 63.145 45.266 25.231 1.00259.42 O ANISOU12496 OD2 ASP N 80 36396 38466 23706 -1726 2718 4372 O ATOM 12497 N PHE N 81 67.997 47.848 23.878 1.00245.80 N ANISOU12497 N PHE N 81 34891 36998 21502 -637 1024 5970 N ATOM 12498 CA PHE N 81 69.030 48.127 22.873 1.00239.92 C ANISOU12498 CA PHE N 81 33969 36203 20985 -197 755 6128 C ATOM 12499 C PHE N 81 70.026 49.195 23.306 1.00242.21 C ANISOU12499 C PHE N 81 34462 36589 20977 -311 576 6357 C ATOM 12500 O PHE N 81 71.213 48.925 23.442 1.00242.36 O ANISOU12500 O PHE N 81 34463 36515 21104 -350 263 6772 O ATOM 12501 CB PHE N 81 68.383 48.496 21.531 1.00229.42 C ANISOU12501 CB PHE N 81 32392 34899 19877 329 893 5631 C ATOM 12502 CG PHE N 81 67.668 47.348 20.874 1.00220.52 C ANISOU12502 CG PHE N 81 30974 33670 19140 506 989 5398 C ATOM 12503 CD1 PHE N 81 68.393 46.283 20.360 1.00216.37 C ANISOU12503 CD1 PHE N 81 30273 32948 18988 622 844 5681 C ATOM 12504 CD2 PHE N 81 66.270 47.324 20.781 1.00216.19 C ANISOU12504 CD2 PHE N 81 30279 33208 18655 542 1239 4838 C ATOM 12505 CE1 PHE N 81 67.744 45.222 19.753 1.00213.53 C ANISOU12505 CE1 PHE N 81 29636 32488 19006 756 970 5428 C ATOM 12506 CE2 PHE N 81 65.613 46.258 20.177 1.00212.82 C ANISOU12506 CE2 PHE N 81 29543 32697 18621 680 1337 4557 C ATOM 12507 CZ PHE N 81 66.358 45.207 19.673 1.00213.07 C ANISOU12507 CZ PHE N 81 29444 32541 18970 773 1214 4867 C TER 12508 PHE N 81 ATOM 12509 N SER Q 14 66.099 -36.929 10.126 1.00277.85 N ANISOU12509 N SER Q 14 34245 39619 31705 -1462 1058 4890 N ATOM 12510 CA SER Q 14 67.335 -36.084 10.153 1.00274.54 C ANISOU12510 CA SER Q 14 33626 39227 31459 -1451 1058 5094 C ATOM 12511 C SER Q 14 68.639 -36.908 10.236 1.00281.23 C ANISOU12511 C SER Q 14 34583 40223 32046 -1334 1038 4912 C ATOM 12512 O SER Q 14 68.630 -38.151 10.026 1.00284.37 O ANISOU12512 O SER Q 14 35175 40782 32088 -1251 1023 4668 O ATOM 12513 CB SER Q 14 67.251 -35.051 11.292 1.00264.96 C ANISOU12513 CB SER Q 14 32403 37576 30691 -1545 1066 5118 C ATOM 12514 OG SER Q 14 68.405 -34.231 11.351 1.00250.70 O ANISOU12514 OG SER Q 14 30399 35771 29084 -1538 1061 5300 O ATOM 12515 N TYR Q 15 69.734 -36.202 10.553 1.00286.91 N ANISOU12515 N TYR Q 15 35173 40876 32961 -1329 1035 5028 N ATOM 12516 CA TYR Q 15 71.083 -36.766 10.648 1.00297.24 C ANISOU12516 CA TYR Q 15 36540 42313 34085 -1225 1016 4899 C ATOM 12517 C TYR Q 15 71.175 -38.119 11.401 1.00295.95 C ANISOU12517 C TYR Q 15 36746 42039 33659 -1149 994 4469 C ATOM 12518 O TYR Q 15 71.649 -39.114 10.848 1.00298.21 O ANISOU12518 O TYR Q 15 37104 42608 33592 -1049 979 4347 O ATOM 12519 CB TYR Q 15 72.078 -35.724 11.205 1.00305.43 C ANISOU12519 CB TYR Q 15 37416 43168 35463 -1252 1012 5037 C ATOM 12520 CG TYR Q 15 73.435 -35.848 10.532 1.00318.07 C ANISOU12520 CG TYR Q 15 38862 45088 36901 -1160 1008 5147 C ATOM 12521 CD1 TYR Q 15 73.796 -35.007 9.467 1.00323.12 C ANISOU12521 CD1 TYR Q 15 39144 46004 37620 -1172 1036 5547 C ATOM 12522 CD2 TYR Q 15 74.345 -36.855 10.906 1.00320.32 C ANISOU12522 CD2 TYR Q 15 39354 45421 36932 -1054 981 4858 C ATOM 12523 CE1 TYR Q 15 75.033 -35.155 8.821 1.00323.22 C ANISOU12523 CE1 TYR Q 15 39010 46327 37469 -1083 1041 5652 C ATOM 12524 CE2 TYR Q 15 75.584 -37.007 10.263 1.00321.94 C ANISOU12524 CE2 TYR Q 15 39414 45931 36975 -966 979 4952 C ATOM 12525 CZ TYR Q 15 75.938 -36.159 9.218 1.00320.23 C ANISOU12525 CZ TYR Q 15 38841 45988 36842 -980 1011 5348 C ATOM 12526 OH TYR Q 15 77.176 -36.330 8.581 1.00312.84 O ANISOU12526 OH TYR Q 15 37761 45363 35740 -889 1017 5442 O ATOM 12527 N GLN Q 16 70.692 -38.157 12.640 1.00295.24 N ANISOU12527 N GLN Q 16 36885 41547 33743 -1193 994 4245 N ATOM 12528 CA GLN Q 16 70.752 -39.360 13.492 1.00297.40 C ANISOU12528 CA GLN Q 16 37514 41670 33813 -1125 980 3852 C ATOM 12529 C GLN Q 16 70.022 -40.578 12.929 1.00292.90 C ANISOU12529 C GLN Q 16 37103 41286 32899 -1082 982 3686 C ATOM 12530 O GLN Q 16 70.547 -41.682 13.009 1.00293.67 O ANISOU12530 O GLN Q 16 37386 41475 32717 -984 963 3445 O ATOM 12531 CB GLN Q 16 70.177 -39.082 14.888 1.00308.95 C ANISOU12531 CB GLN Q 16 39174 42672 35540 -1185 990 3679 C ATOM 12532 CG GLN Q 16 70.506 -37.728 15.506 1.00330.96 C ANISOU12532 CG GLN Q 16 41795 45214 38741 -1253 986 3840 C ATOM 12533 CD GLN Q 16 69.291 -37.032 16.106 1.00348.15 C ANISOU12533 CD GLN Q 16 43987 47076 41215 -1364 1011 3870 C ATOM 12534 OE1 GLN Q 16 68.149 -37.450 15.901 1.00349.34 O ANISOU12534 OE1 GLN Q 16 44233 47224 41276 -1401 1037 3825 O ATOM 12535 NE2 GLN Q 16 69.535 -35.953 16.836 1.00363.08 N ANISOU12535 NE2 GLN Q 16 45776 48703 43472 -1415 1001 3944 N ATOM 12536 N GLN Q 17 68.812 -40.383 12.385 1.00286.88 N ANISOU12536 N GLN Q 17 36265 40565 32168 -1152 1001 3804 N ATOM 12537 CA GLN Q 17 67.942 -41.504 11.915 1.00282.66 C ANISOU12537 CA GLN Q 17 35881 40164 31352 -1122 999 3628 C ATOM 12538 C GLN Q 17 68.463 -42.343 10.732 1.00289.11 C ANISOU12538 C GLN Q 17 36629 41431 31788 -1015 971 3619 C ATOM 12539 O GLN Q 17 68.091 -43.513 10.569 1.00288.35 O ANISOU12539 O GLN Q 17 36713 41414 31432 -959 956 3377 O ATOM 12540 CB GLN Q 17 66.556 -40.996 11.533 1.00272.86 C ANISOU12540 CB GLN Q 17 34539 38882 30252 -1222 1020 3779 C ATOM 12541 CG GLN Q 17 65.605 -40.834 12.689 1.00264.28 C ANISOU12541 CG GLN Q 17 33642 37362 29410 -1307 1050 3637 C ATOM 12542 CD GLN Q 17 64.906 -39.509 12.604 1.00264.49 C ANISOU12542 CD GLN Q 17 33449 37270 29774 -1424 1070 3920 C ATOM 12543 OE1 GLN Q 17 64.685 -38.971 11.509 1.00267.48 O ANISOU12543 OE1 GLN Q 17 33566 37915 30149 -1446 1064 4198 O ATOM 12544 NE2 GLN Q 17 64.550 -38.965 13.754 1.00262.28 N ANISOU12544 NE2 GLN Q 17 33268 36594 29789 -1493 1093 3854 N ATOM 12545 N ARG Q 18 69.266 -41.717 9.882 1.00296.83 N ANISOU12545 N ARG Q 18 37332 42703 32745 -988 965 3890 N ATOM 12546 CA ARG Q 18 69.870 -42.378 8.736 1.00300.62 C ANISOU12546 CA ARG Q 18 37713 43636 32873 -879 941 3912 C ATOM 12547 C ARG Q 18 70.991 -43.352 9.194 1.00294.82 C ANISOU12547 C ARG Q 18 37174 42914 31930 -769 916 3633 C ATOM 12548 O ARG Q 18 71.104 -44.473 8.677 1.00293.49 O ANISOU12548 O ARG Q 18 37101 42979 31430 -674 889 3444 O ATOM 12549 CB ARG Q 18 70.357 -41.290 7.784 1.00309.53 C ANISOU12549 CB ARG Q 18 38479 45044 34084 -890 955 4317 C ATOM 12550 CG ARG Q 18 70.823 -41.743 6.429 1.00315.43 C ANISOU12550 CG ARG Q 18 39060 46304 34485 -784 940 4418 C ATOM 12551 CD ARG Q 18 72.009 -40.892 6.023 1.00318.95 C ANISOU12551 CD ARG Q 18 39238 46931 35014 -761 960 4713 C ATOM 12552 NE ARG Q 18 73.199 -41.021 6.881 1.00321.42 N ANISOU12552 NE ARG Q 18 39662 47072 35390 -724 954 4564 N ATOM 12553 CZ ARG Q 18 74.051 -42.053 6.885 1.00319.87 C ANISOU12553 CZ ARG Q 18 39607 47019 34909 -609 927 4321 C ATOM 12554 NH1 ARG Q 18 75.097 -42.038 7.688 1.00322.82 N ANISOU12554 NH1 ARG Q 18 40061 47218 35377 -583 919 4212 N ATOM 12555 NH2 ARG Q 18 73.854 -43.113 6.105 1.00316.17 N ANISOU12555 NH2 ARG Q 18 39200 46861 34069 -518 903 4173 N ATOM 12556 N LEU Q 19 71.767 -42.928 10.200 1.00286.98 N ANISOU12556 N LEU Q 19 36245 41651 31142 -781 921 3594 N ATOM 12557 CA LEU Q 19 72.769 -43.756 10.886 1.00280.90 C ANISOU12557 CA LEU Q 19 35687 40807 30233 -688 896 3317 C ATOM 12558 C LEU Q 19 72.097 -44.928 11.596 1.00285.64 C ANISOU12558 C LEU Q 19 36629 41196 30704 -665 889 2958 C ATOM 12559 O LEU Q 19 72.569 -46.054 11.522 1.00290.27 O ANISOU12559 O LEU Q 19 37370 41902 31017 -564 863 2724 O ATOM 12560 CB LEU Q 19 73.573 -42.917 11.894 1.00270.56 C ANISOU12560 CB LEU Q 19 34365 39214 29221 -717 898 3358 C ATOM 12561 CG LEU Q 19 74.592 -41.920 11.342 1.00264.94 C ANISOU12561 CG LEU Q 19 33339 38690 28634 -715 901 3664 C ATOM 12562 CD1 LEU Q 19 74.919 -40.805 12.326 1.00261.32 C ANISOU12562 CD1 LEU Q 19 32825 37886 28578 -787 904 3749 C ATOM 12563 CD2 LEU Q 19 75.850 -42.636 10.865 1.00262.67 C ANISOU12563 CD2 LEU Q 19 33040 38701 28062 -588 876 3583 C ATOM 12564 N LYS Q 20 70.987 -44.650 12.274 1.00286.99 N ANISOU12564 N LYS Q 20 36907 41050 31083 -760 916 2923 N ATOM 12565 CA LYS Q 20 70.152 -45.687 12.868 1.00283.51 C ANISOU12565 CA LYS Q 20 36764 40409 30548 -753 924 2624 C ATOM 12566 C LYS Q 20 69.691 -46.725 11.826 1.00286.21 C ANISOU12566 C LYS Q 20 37113 41058 30573 -696 903 2528 C ATOM 12567 O LYS Q 20 69.640 -47.904 12.139 1.00286.74 O ANISOU12567 O LYS Q 20 37417 41071 30458 -631 891 2239 O ATOM 12568 CB LYS Q 20 68.922 -45.082 13.561 1.00279.77 C ANISOU12568 CB LYS Q 20 36347 39594 30359 -872 964 2659 C ATOM 12569 CG LYS Q 20 69.160 -44.155 14.752 1.00275.42 C ANISOU12569 CG LYS Q 20 35829 38683 30132 -929 982 2693 C ATOM 12570 CD LYS Q 20 67.806 -43.624 15.232 1.00271.44 C ANISOU12570 CD LYS Q 20 35359 37898 29877 -1044 1023 2733 C ATOM 12571 CE LYS Q 20 67.876 -42.317 16.018 1.00266.55 C ANISOU12571 CE LYS Q 20 34644 37002 29630 -1122 1037 2878 C ATOM 12572 NZ LYS Q 20 66.520 -41.723 16.197 1.00259.65 N ANISOU12572 NZ LYS Q 20 33740 35927 28985 -1237 1074 2965 N ATOM 12573 N ALA Q 21 69.361 -46.296 10.601 1.00287.98 N ANISOU12573 N ALA Q 21 37077 41604 30736 -713 895 2766 N ATOM 12574 CA ALA Q 21 68.842 -47.209 9.564 1.00287.52 C ANISOU12574 CA ALA Q 21 37002 41853 30386 -656 867 2676 C ATOM 12575 C ALA Q 21 69.917 -48.132 8.976 1.00294.95 C ANISOU12575 C ALA Q 21 37952 43116 30996 -517 825 2540 C ATOM 12576 O ALA Q 21 69.671 -49.317 8.696 1.00291.97 O ANISOU12576 O ALA Q 21 37711 42841 30379 -446 794 2291 O ATOM 12577 CB ALA Q 21 68.158 -46.422 8.462 1.00281.73 C ANISOU12577 CB ALA Q 21 35984 41371 29687 -709 869 2976 C ATOM 12578 N ALA Q 22 71.107 -47.585 8.783 1.00305.84 N ANISOU12578 N ALA Q 22 39178 44652 32373 -476 822 2702 N ATOM 12579 CA ALA Q 22 72.240 -48.402 8.394 1.00315.13 C ANISOU12579 CA ALA Q 22 40375 46092 33266 -345 787 2565 C ATOM 12580 C ALA Q 22 72.604 -49.380 9.525 1.00322.92 C ANISOU12580 C ALA Q 22 41691 46789 34216 -296 775 2215 C ATOM 12581 O ALA Q 22 72.953 -50.523 9.246 1.00328.00 O ANISOU12581 O ALA Q 22 42445 47589 34589 -191 739 1982 O ATOM 12582 CB ALA Q 22 73.417 -47.529 8.008 1.00310.58 C ANISOU12582 CB ALA Q 22 39554 45717 32732 -321 795 2830 C ATOM 12583 N VAL Q 23 72.504 -48.928 10.788 1.00325.58 N ANISOU12583 N VAL Q 23 42175 46708 34821 -365 804 2178 N ATOM 12584 CA VAL Q 23 72.596 -49.792 12.003 1.00320.23 C ANISOU12584 CA VAL Q 23 41831 45698 34142 -331 803 1857 C ATOM 12585 C VAL Q 23 71.611 -50.977 11.883 1.00327.03 C ANISOU12585 C VAL Q 23 42880 46532 34845 -312 797 1612 C ATOM 12586 O VAL Q 23 72.017 -52.136 12.038 1.00329.83 O ANISOU12586 O VAL Q 23 43417 46906 34998 -216 770 1348 O ATOM 12587 CB VAL Q 23 72.418 -48.983 13.348 1.00308.44 C ANISOU12587 CB VAL Q 23 40445 43764 32981 -416 839 1882 C ATOM 12588 CG1 VAL Q 23 72.093 -49.858 14.558 1.00301.13 C ANISOU12588 CG1 VAL Q 23 39867 42488 32061 -394 853 1575 C ATOM 12589 CG2 VAL Q 23 73.655 -48.165 13.662 1.00302.15 C ANISOU12589 CG2 VAL Q 23 39529 42963 32309 -398 828 2014 C ATOM 12590 N HIS Q 24 70.341 -50.670 11.574 1.00329.00 N ANISOU12590 N HIS Q 24 43068 46742 35195 -402 819 1704 N ATOM 12591 CA HIS Q 24 69.238 -51.654 11.410 1.00322.08 C ANISOU12591 CA HIS Q 24 42332 45823 34218 -404 817 1500 C ATOM 12592 C HIS Q 24 69.614 -52.743 10.417 1.00310.94 C ANISOU12592 C HIS Q 24 40895 44772 32474 -286 760 1346 C ATOM 12593 O HIS Q 24 69.292 -53.923 10.600 1.00304.24 O ANISOU12593 O HIS Q 24 40244 43847 31505 -237 745 1066 O ATOM 12594 CB HIS Q 24 67.953 -50.933 10.937 1.00326.70 C ANISOU12594 CB HIS Q 24 42765 46408 34956 -515 839 1692 C ATOM 12595 CG HIS Q 24 66.698 -51.749 11.048 1.00328.60 C ANISOU12595 CG HIS Q 24 43163 46499 35189 -545 848 1493 C ATOM 12596 ND1 HIS Q 24 66.316 -52.379 12.216 1.00329.64 N ANISOU12596 ND1 HIS Q 24 43585 46249 35415 -559 885 1261 N ATOM 12597 CD2 HIS Q 24 65.716 -51.998 10.149 1.00328.20 C ANISOU12597 CD2 HIS Q 24 43012 46624 35064 -563 827 1501 C ATOM 12598 CE1 HIS Q 24 65.166 -53.001 12.023 1.00326.34 C ANISOU12598 CE1 HIS Q 24 43234 45772 34989 -588 890 1136 C ATOM 12599 NE2 HIS Q 24 64.782 -52.786 10.777 1.00326.84 N ANISOU12599 NE2 HIS Q 24 43063 46167 34953 -592 851 1268 N ATOM 12600 N TYR Q 25 70.310 -52.328 9.369 1.00302.21 N ANISOU12600 N TYR Q 25 39536 44059 31228 -238 731 1534 N ATOM 12601 CA TYR Q 25 70.780 -53.246 8.364 1.00295.84 C ANISOU12601 CA TYR Q 25 38671 43636 30097 -115 675 1409 C ATOM 12602 C TYR Q 25 71.695 -54.335 8.950 1.00286.63 C ANISOU12602 C TYR Q 25 37730 42391 28785 -9 650 1114 C ATOM 12603 O TYR Q 25 71.341 -55.509 8.860 1.00278.83 O ANISOU12603 O TYR Q 25 36889 41402 27648 47 620 844 O ATOM 12604 CB TYR Q 25 71.438 -52.483 7.214 1.00306.01 C ANISOU12604 CB TYR Q 25 39638 45355 31275 -80 662 1696 C ATOM 12605 CG TYR Q 25 72.232 -53.352 6.254 1.00318.91 C ANISOU12605 CG TYR Q 25 41203 47406 32562 65 607 1574 C ATOM 12606 CD1 TYR Q 25 71.607 -54.079 5.227 1.00328.86 C ANISOU12606 CD1 TYR Q 25 42399 48960 33592 124 560 1466 C ATOM 12607 CD2 TYR Q 25 73.619 -53.450 6.369 1.00321.40 C ANISOU12607 CD2 TYR Q 25 41511 47828 32779 149 598 1557 C ATOM 12608 CE1 TYR Q 25 72.345 -54.877 4.339 1.00335.82 C ANISOU12608 CE1 TYR Q 25 43209 50235 34150 267 506 1341 C ATOM 12609 CE2 TYR Q 25 74.369 -54.236 5.493 1.00325.59 C ANISOU12609 CE2 TYR Q 25 41971 48745 32991 287 549 1442 C ATOM 12610 CZ TYR Q 25 73.741 -54.950 4.482 1.00331.57 C ANISOU12610 CZ TYR Q 25 42666 49796 33518 348 504 1332 C ATOM 12611 OH TYR Q 25 74.520 -55.721 3.637 1.00329.03 O ANISOU12611 OH TYR Q 25 42273 49863 32881 493 453 1206 O ATOM 12612 N THR Q 26 72.831 -53.954 9.559 1.00282.97 N ANISOU12612 N THR Q 26 37289 41846 28379 15 660 1160 N ATOM 12613 CA THR Q 26 73.833 -54.932 10.047 1.00276.46 C ANISOU12613 CA THR Q 26 36654 40983 27404 127 630 901 C ATOM 12614 C THR Q 26 73.268 -55.825 11.130 1.00277.39 C ANISOU12614 C THR Q 26 37094 40713 27587 121 644 619 C ATOM 12615 O THR Q 26 73.608 -57.005 11.205 1.00274.72 O ANISOU12615 O THR Q 26 36916 40391 27073 218 610 353 O ATOM 12616 CB THR Q 26 75.132 -54.312 10.596 1.00267.15 C ANISOU12616 CB THR Q 26 35444 39757 26302 153 636 999 C ATOM 12617 OG1 THR Q 26 75.560 -53.225 9.772 1.00266.35 O ANISOU12617 OG1 THR Q 26 35032 39937 26230 129 644 1319 O ATOM 12618 CG2 THR Q 26 76.218 -55.374 10.614 1.00259.83 C ANISOU12618 CG2 THR Q 26 34633 38948 25142 291 590 758 C ATOM 12619 N VAL Q 27 72.409 -55.246 11.966 1.00281.49 N ANISOU12619 N VAL Q 27 37703 40885 28366 9 697 684 N ATOM 12620 CA VAL Q 27 71.658 -56.008 12.970 1.00282.56 C ANISOU12620 CA VAL Q 27 38129 40645 28584 -9 726 452 C ATOM 12621 C VAL Q 27 70.847 -57.128 12.306 1.00282.03 C ANISOU12621 C VAL Q 27 38109 40688 28360 21 700 258 C ATOM 12622 O VAL Q 27 70.879 -58.272 12.771 1.00291.04 O ANISOU12622 O VAL Q 27 39473 41687 29422 86 692 -10 O ATOM 12623 CB VAL Q 27 70.764 -55.103 13.870 1.00279.54 C ANISOU12623 CB VAL Q 27 37800 39904 28508 -139 792 578 C ATOM 12624 CG1 VAL Q 27 70.028 -55.915 14.926 1.00275.94 C ANISOU12624 CG1 VAL Q 27 37645 39069 28127 -149 833 346 C ATOM 12625 CG2 VAL Q 27 71.607 -54.065 14.587 1.00277.55 C ANISOU12625 CG2 VAL Q 27 37509 39525 28420 -159 807 731 C ATOM 12626 N GLY Q 28 70.156 -56.816 11.208 1.00271.59 N ANISOU12626 N GLY Q 28 36570 39624 26994 -16 683 389 N ATOM 12627 CA GLY Q 28 69.383 -57.834 10.486 1.00261.81 C ANISOU12627 CA GLY Q 28 35346 38518 25610 18 646 201 C ATOM 12628 C GLY Q 28 70.271 -58.993 10.082 1.00260.16 C ANISOU12628 C GLY Q 28 35192 38523 25134 161 584 -34 C ATOM 12629 O GLY Q 28 69.897 -60.167 10.158 1.00257.41 O ANISOU12629 O GLY Q 28 34998 38091 24714 209 562 -304 O ATOM 12630 N CYS Q 29 71.477 -58.635 9.679 1.00261.99 N ANISOU12630 N CYS Q 29 35288 39018 25235 230 557 72 N ATOM 12631 CA CYS Q 29 72.449 -59.579 9.189 1.00264.02 C ANISOU12631 CA CYS Q 29 35554 39529 25230 371 496 -116 C ATOM 12632 C CYS Q 29 73.047 -60.439 10.282 1.00254.04 C ANISOU12632 C CYS Q 29 34572 37974 23974 431 499 -362 C ATOM 12633 O CYS Q 29 73.058 -61.663 10.174 1.00253.77 O ANISOU12633 O CYS Q 29 34662 37955 23804 515 459 -634 O ATOM 12634 CB CYS Q 29 73.550 -58.818 8.468 1.00275.60 C ANISOU12634 CB CYS Q 29 36778 41356 26579 418 479 104 C ATOM 12635 SG CYS Q 29 72.873 -57.693 7.227 1.00305.78 S ANISOU12635 SG CYS Q 29 40259 45517 30405 349 485 441 S ATOM 12636 N LEU Q 30 73.557 -59.809 11.332 1.00243.75 N ANISOU12636 N LEU Q 30 33368 36409 22834 394 543 -271 N ATOM 12637 CA LEU Q 30 74.231 -60.578 12.372 1.00238.68 C ANISOU12637 CA LEU Q 30 32987 35514 22185 466 543 -489 C ATOM 12638 C LEU Q 30 73.221 -61.372 13.249 1.00252.59 C ANISOU12638 C LEU Q 30 35016 36889 24065 432 580 -689 C ATOM 12639 O LEU Q 30 73.558 -62.421 13.816 1.00254.45 O ANISOU12639 O LEU Q 30 35467 36973 24238 513 568 -929 O ATOM 12640 CB LEU Q 30 75.243 -59.707 13.146 1.00222.35 C ANISOU12640 CB LEU Q 30 30925 33335 20223 462 563 -348 C ATOM 12641 CG LEU Q 30 76.153 -58.743 12.346 1.00213.02 C ANISOU12641 CG LEU Q 30 29457 32495 18984 473 542 -104 C ATOM 12642 CD1 LEU Q 30 77.045 -57.969 13.295 1.00208.07 C ANISOU12642 CD1 LEU Q 30 28868 31678 18509 464 560 -6 C ATOM 12643 CD2 LEU Q 30 77.012 -59.399 11.270 1.00209.81 C ANISOU12643 CD2 LEU Q 30 28922 32505 18290 597 479 -186 C ATOM 12644 N CYS Q 31 71.968 -60.904 13.303 1.00271.69 N ANISOU12644 N CYS Q 31 37411 39161 26654 316 627 -588 N ATOM 12645 CA CYS Q 31 70.866 -61.690 13.894 1.00285.50 C ANISOU12645 CA CYS Q 31 39369 40597 28508 280 665 -766 C ATOM 12646 C CYS Q 31 70.540 -62.919 13.055 1.00293.33 C ANISOU12646 C CYS Q 31 40354 41765 29331 351 608 -994 C ATOM 12647 O CYS Q 31 70.061 -63.935 13.574 1.00289.33 O ANISOU12647 O CYS Q 31 40051 41017 28862 371 624 -1214 O ATOM 12648 CB CYS Q 31 69.589 -60.859 14.052 1.