>>4OIN:HELIX   84  84 GLU D  907  SER D  945  1                                  39    
EKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 84 84 GLU D 907 SER D 945 1 39 ATOM 19538 N GLU D 907 -24.109 4.029 100.100 1.00 9.99 N ATOM 19539 CA GLU D 907 -23.258 3.183 99.269 1.00 11.50 C ATOM 19540 C GLU D 907 -23.021 3.875 97.920 1.00 12.68 C ATOM 19541 O GLU D 907 -23.423 5.026 97.746 1.00 13.04 O ATOM 19542 CB GLU D 907 -23.852 1.768 99.128 1.00 10.98 C ATOM 19543 CG GLU D 907 -24.738 1.512 97.911 1.00 12.38 C ATOM 19544 CD GLU D 907 -25.971 2.377 97.889 1.00 13.87 C ATOM 19545 OE1 GLU D 907 -26.917 2.084 98.648 1.00 21.43 O ATOM 19546 OE2 GLU D 907 -25.996 3.353 97.114 1.00 14.06 O ATOM 19547 N LYS D 908 -22.349 3.197 96.991 1.00 10.44 N ATOM 19548 CA LYS D 908 -21.993 3.784 95.696 1.00 9.46 C ATOM 19549 C LYS D 908 -23.161 4.462 94.969 1.00 11.76 C ATOM 19550 O LYS D 908 -23.040 5.607 94.522 1.00 15.22 O ATOM 19551 CB LYS D 908 -21.336 2.728 94.795 1.00 11.19 C ATOM 19552 CG LYS D 908 -20.843 3.257 93.452 1.00 11.80 C ATOM 19553 CD LYS D 908 -19.720 2.395 92.882 1.00 11.49 C ATOM 19554 CE LYS D 908 -20.140 0.939 92.711 1.00 24.89 C ATOM 19555 NZ LYS D 908 -18.993 0.042 92.351 1.00 17.25 N ATOM 19556 N ASN D 909 -24.292 3.768 94.870 1.00 10.43 N ATOM 19557 CA ASN D 909 -25.443 4.294 94.137 1.00 13.21 C ATOM 19558 C ASN D 909 -26.078 5.539 94.755 1.00 13.80 C ATOM 19559 O ASN D 909 -26.317 6.526 94.061 1.00 14.66 O ATOM 19560 CB ASN D 909 -26.503 3.210 93.938 1.00 11.23 C ATOM 19561 CG ASN D 909 -26.023 2.090 93.042 1.00 26.24 C ATOM 19562 OD1 ASN D 909 -25.233 2.312 92.121 1.00 26.78 O ATOM 19563 ND2 ASN D 909 -26.496 0.873 93.307 1.00 26.77 N ATOM 19564 N SER D 910 -26.356 5.493 96.053 1.00 12.67 N ATOM 19565 CA SER D 910 -26.998 6.618 96.720 1.00 12.30 C ATOM 19566 C SER D 910 -26.087 7.841 96.709 1.00 13.23 C ATOM 19567 O SER D 910 -26.557 8.976 96.604 1.00 15.86 O ATOM 19568 CB SER D 910 -27.387 6.257 98.155 1.00 9.69 C ATOM 19569 OG SER D 910 -26.248 6.189 98.990 1.00 8.04 O ATOM 19570 N LEU D 911 -24.783 7.606 96.809 1.00 10.44 N ATOM 19571 CA LEU D 911 -23.816 8.692 96.780 1.00 7.33 C ATOM 19572 C LEU D 911 -23.741 9.294 95.384 1.00 7.99 C ATOM 19573 O LEU D 911 -23.682 10.515 95.225 1.00 8.78 O ATOM 19574 CB LEU D 911 -22.444 8.200 97.235 1.00 6.60 C ATOM 19575 CG LEU D 911 -22.319 7.909 98.730 1.00 5.61 C ATOM 19576 CD1 LEU D 911 -20.950 7.347 99.055 1.00 7.31 C ATOM 19577 CD2 LEU D 911 -22.583 9.168 99.537 1.00 6.42 C ATOM 19578 N LYS D 912 -23.757 8.434 94.372 1.00 9.75 N ATOM 19579 CA LYS D 912 -23.777 8.898 92.988 1.00 9.61 C ATOM 19580 C LYS D 912 -25.017 9.764 92.724 1.00 12.24 C ATOM 19581 O LYS D 912 -24.920 10.853 92.143 1.00 12.67 O ATOM 19582 CB LYS D 912 -23.730 7.708 92.026 1.00 8.03 C ATOM 19583 CG LYS D 912 -23.614 8.096 90.567 1.00 9.65 C ATOM 19584 CD LYS D 912 -23.516 6.874 89.666 1.00 15.32 C ATOM 19585 CE LYS D 912 -24.693 5.932 89.872 1.00 24.21 C ATOM 19586 NZ LYS D 912 -26.001 6.586 89.591 1.00 26.68 N ATOM 19587 N ASP D 913 -26.174 9.280 93.170 1.00 11.04 N ATOM 19588 CA ASP D 913 -27.425 10.010 93.016 1.00 9.84 C ATOM 19589 C ASP D 913 -27.356 11.346 93.740 1.00 11.49 C ATOM 19590 O ASP D 913 -27.831 12.363 93.231 1.00 10.56 O ATOM 19591 CB ASP D 913 -28.601 9.192 93.551 1.00 13.65 C ATOM 19592 CG ASP D 913 -28.817 7.904 92.780 1.00 22.32 C ATOM 19593 OD1 ASP D 913 -28.460 7.849 91.583 1.00 23.73 O ATOM 19594 OD2 ASP D 913 -29.349 6.943 93.374 1.00 30.29 O ATOM 19595 N LEU D 914 -26.765 11.335 94.931 1.00 10.33 N ATOM 19596 CA LEU D 914 -26.569 12.559 95.697 1.00 7.97 C ATOM 19597 C LEU D 914 -25.766 13.568 94.888 1.00 10.62 C ATOM 19598 O LEU D 914 -26.143 14.737 94.791 1.00 9.60 O ATOM 19599 CB LEU D 914 -25.856 12.264 97.015 1.00 6.32 C ATOM 19600 CG LEU D 914 -25.452 13.497 97.821 1.00 6.28 C ATOM 19601 CD1 LEU D 914 -26.679 14.329 98.160 1.00 12.12 C ATOM 19602 CD2 LEU D 914 -24.704 13.099 99.082 1.00 5.96 C ATOM 19603 N VAL D 915 -24.664 13.105 94.299 1.00 10.65 N ATOM 19604 CA VAL D 915 -23.816 13.971 93.485 1.00 7.59 C ATOM 19605 C VAL D 915 -24.576 14.545 92.285 1.00 9.00 C ATOM 19606 O VAL D 915 -24.489 15.742 92.000 1.00 6.78 O ATOM 19607 CB VAL D 915 -22.547 13.235 93.011 1.00 5.50 C ATOM 19608 CG1 VAL D 915 -21.752 14.100 92.048 1.00 3.81 C ATOM 19609 CG2 VAL D 915 -21.692 12.840 94.205 1.00 4.76 C ATOM 19610 N TYR D 916 -25.334 13.695 91.597 1.00 8.19 N ATOM 19611 CA TYR D 916 -26.090 14.140 90.428 1.00 6.33 C ATOM 19612 C TYR D 916 -27.151 15.186 90.782 1.00 7.70 C ATOM 19613 O TYR D 916 -27.237 16.245 90.146 1.00 7.72 O ATOM 19614 CB TYR D 916 -26.732 12.948 89.718 1.00 4.41 C ATOM 19615 CG TYR D 916 -27.568 13.332 88.523 1.00 4.10 C ATOM 19616 CD1 TYR D 916 -28.950 13.225 88.556 1.00 4.62 C ATOM 19617 CD2 TYR D 916 -26.975 13.813 87.364 1.00 5.10 C ATOM 19618 CE1 TYR D 916 -29.719 13.577 87.467 1.00 4.78 C ATOM 19619 CE2 TYR D 916 -27.738 14.174 86.267 1.00 5.27 C ATOM 19620 CZ TYR D 916 -29.110 14.055 86.326 1.00 6.21 C ATOM 19621 OH TYR D 916 -29.877 14.409 85.239 1.00 7.40 O ATOM 19622 N GLN D 917 -27.954 14.884 91.800 1.00 8.85 N ATOM 19623 CA GLN D 917 -29.009 15.790 92.247 1.00 8.52 C ATOM 19624 C GLN D 917 -28.416 17.106 92.728 1.00 10.27 C ATOM 19625 O GLN D 917 -28.973 18.175 92.483 1.00 10.93 O ATOM 19626 CB GLN D 917 -29.838 15.155 93.365 1.00 7.52 C ATOM 19627 CG GLN D 917 -30.615 13.923 92.948 1.00 7.42 C ATOM 19628 CD GLN D 917 -31.646 14.214 91.876 1.00 8.21 C ATOM 19629 OE1 GLN D 917 -32.364 15.213 91.941 1.00 10.08 O ATOM 19630 NE2 GLN D 917 -31.723 13.340 90.878 1.00 8.30 N ATOM 19631 N ALA D 918 -27.280 17.022 93.411 1.00 9.92 N ATOM 19632 CA ALA D 918 -26.582 18.215 93.866 1.00 8.84 C ATOM 19633 C ALA D 918 -26.085 19.036 92.678 1.00 10.30 C ATOM 19634 O ALA D 918 -26.070 20.260 92.730 1.00 13.55 O ATOM 19635 CB ALA D 918 -25.429 17.843 94.783 1.00 7.52 C ATOM 19636 N PHE D 919 -25.673 18.361 91.610 1.00 10.27 N ATOM 19637 CA PHE D 919 -25.287 19.059 90.392 1.00 8.65 C ATOM 19638 C PHE D 919 -26.494 19.831 89.874 1.00 10.24 C ATOM 19639 O PHE D 919 -26.416 21.043 89.651 1.00 11.82 O ATOM 19640 CB PHE D 919 -24.776 18.077 89.333 1.00 6.52 C ATOM 19641 CG PHE D 919 -24.094 18.738 88.165 1.00 5.60 C ATOM 19642 CD1 PHE D 919 -22.720 18.938 88.170 1.00 7.50 C ATOM 19643 CD2 PHE D 919 -24.820 19.153 87.062 1.00 4.95 C ATOM 19644 CE1 PHE D 919 -22.085 19.543 87.097 1.00 6.04 C ATOM 19645 CE2 PHE D 919 -24.194 19.758 85.989 1.00 6.03 C ATOM 19646 CZ PHE D 919 -22.823 19.954 86.007 1.00 6.90 C ATOM 19647 N LEU D 920 -27.614 19.127 89.719 1.00 8.71 N ATOM 19648 CA LEU D 920 -28.838 19.733 89.197 1.00 7.88 C ATOM 19649 C LEU D 920 -29.312 20.949 90.000 1.00 11.84 C ATOM 19650 O LEU D 920 -29.592 22.005 89.435 1.00 16.17 O ATOM 19651 CB LEU D 920 -29.968 18.702 89.136 1.00 6.98 C ATOM 19652 CG LEU D 920 -29.801 17.456 88.265 1.00 6.62 C ATOM 19653 CD1 LEU D 920 -31.097 16.668 88.248 1.00 5.62 C ATOM 19654 CD2 LEU D 920 -29.376 17.822 86.853 1.00 7.05 C ATOM 19655 N ARG D 921 -29.432 20.791 91.312 1.00 12.26 N ATOM 19656 CA ARG D 921 -29.953 21.867 92.145 1.00 12.62 C ATOM 19657 C ARG D 921 -28.944 22.976 92.449 1.00 15.68 C ATOM 19658 O ARG D 921 -29.248 24.157 92.308 1.00 24.48 O ATOM 19659 CB ARG D 921 -30.486 21.289 93.457 1.00 13.13 C ATOM 19660 CG ARG D 921 -31.556 20.226 93.278 1.00 13.07 C ATOM 19661 CD ARG D 921 -32.915 20.855 93.053 1.00 21.42 C ATOM 19662 NE ARG D 921 -33.244 21.801 94.117 1.00 34.58 N ATOM 19663 CZ ARG D 921 -33.729 21.452 95.305 1.00 38.77 C ATOM 19664 NH1 ARG D 921 -33.945 20.172 95.589 1.00 34.72 N ATOM 19665 NH2 ARG D 921 -33.998 22.382 96.211 1.00 32.26 N ATOM 19666 N LEU D 922 -27.756 22.590 92.898 1.00 12.25 N ATOM 19667 CA LEU D 922 -26.765 23.558 93.365 1.00 11.37 C ATOM 19668 C LEU D 922 -25.635 23.961 92.407 1.00 11.13 C ATOM 19669 O LEU D 922 -24.847 24.853 92.726 1.00 10.72 O ATOM 19670 CB LEU D 922 -26.187 23.069 94.692 1.00 11.56 C ATOM 19671 CG LEU D 922 -27.317 22.540 95.575 1.00 14.18 C ATOM 19672 CD1 LEU D 922 -26.778 21.818 96.784 1.00 12.44 C ATOM 19673 CD2 LEU D 922 -28.239 23.676 95.987 1.00 12.83 C ATOM 19674 N GLY D 923 -25.554 23.338 91.236 1.00 9.78 N ATOM 19675 CA GLY D 923 -24.472 23.653 90.314 1.00 9.94 C ATOM 19676 C GLY D 923 -23.113 23.041 90.634 1.00 11.19 C ATOM 19677 O GLY D 923 -22.900 22.441 91.696 1.00 11.62 O ATOM 19678 N MET D 924 -22.171 23.213 89.711 1.00 11.73 N ATOM 19679 CA MET D 924 -20.902 22.493 89.779 1.00 10.81 C ATOM 19680 C MET D 924 -19.909 22.995 90.831 1.00 13.55 C ATOM 19681 O MET D 924 -19.071 22.229 91.295 1.00 18.23 O ATOM 19682 CB MET D 924 -20.238 22.411 88.396 1.00 8.29 C ATOM 19683 CG MET D 924 -19.953 23.747 87.746 1.00 10.87 C ATOM 19684 SD MET D 924 -19.425 23.574 86.028 1.00 9.68 S ATOM 19685 CE MET D 924 -20.891 22.849 85.304 1.00 10.85 C ATOM 19686 N GLU D 925 -19.982 24.268 91.202 1.00 12.72 N ATOM 19687 CA GLU D 925 -19.083 24.780 92.232 1.00 11.69 C ATOM 19688 C GLU D 925 -19.414 24.126 93.573 1.00 12.69 C ATOM 19689 O GLU D 925 -18.552 23.522 94.245 1.00 12.24 O ATOM 19690 CB GLU D 925 -19.190 26.302 92.329 1.00 11.32 C ATOM 19691 CG GLU D 925 -18.202 26.936 93.295 1.00 18.11 C ATOM 19692 CD GLU D 925 -18.138 28.449 93.164 1.00 19.70 C ATOM 19693 OE1 GLU D 925 -18.820 29.005 92.276 1.00 13.74 O ATOM 19694 OE2 GLU D 925 -17.399 29.081 93.949 1.00 22.37 O ATOM 19695 N LYS D 926 -20.685 24.232 93.944 1.00 14.01 N ATOM 19696 CA LYS D 926 -21.165 23.657 95.188 1.00 13.35 C ATOM 19697 C LYS D 926 -21.062 22.142 95.156 1.00 9.66 C ATOM 19698 O LYS D 926 -20.751 21.517 96.173 1.00 10.77 O ATOM 19699 CB LYS D 926 -22.597 24.104 95.480 1.00 12.36 C ATOM 19700 CG LYS D 926 -22.709 25.563 95.901 1.00 14.28 C ATOM 19701 CD LYS D 926 -24.092 25.868 96.457 1.00 25.04 C ATOM 19702 CE LYS D 926 -24.142 27.235 97.119 1.00 18.92 C ATOM 19703 NZ LYS D 926 -25.390 27.402 97.911 1.00 22.57 N ATOM 19704 N THR D 927 -21.306 21.550 93.990 1.00 9.91 N ATOM 19705 CA THR D 927 -21.158 20.103 93.867 1.00 8.18 C ATOM 19706 C THR D 927 -19.707 19.686 94.075 1.00 8.17 C ATOM 19707 O THR D 927 -19.438 18.655 94.683 1.00 9.09 O ATOM 19708 CB THR D 927 -21.673 19.576 92.524 1.00 7.38 C ATOM 19709 OG1 THR D 927 -23.062 19.896 92.395 1.00 10.14 O ATOM 19710 CG2 THR D 927 -21.513 18.070 92.451 1.00 6.50 C ATOM 19711 N ALA D 928 -18.776 20.499 93.586 1.00 6.94 N ATOM 19712 CA ALA D 928 -17.352 20.236 93.776 1.00 7.49 C ATOM 19713 C ALA D 928 -16.973 20.316 95.255 1.00 8.67 C ATOM 19714 O ALA D 928 -16.245 19.449 95.775 1.00 9.31 O ATOM 19715 CB ALA D 928 -16.521 21.204 92.961 1.00 8.59 C ATOM 19716 N ARG D 929 -17.467 21.350 95.934 1.00 9.36 N ATOM 19717 CA ARG D 929 -17.238 21.458 97.375 1.00 9.70 C ATOM 19718 C ARG D 929 -17.777 20.236 98.117 1.00 9.59 C ATOM 19719 O ARG D 929 -17.112 19.683 99.008 1.00 6.94 O ATOM 19720 CB ARG D 929 -17.853 22.738 97.939 1.00 12.35 C ATOM 19721 CG ARG D 929 -16.940 23.944 97.829 1.00 23.02 C ATOM 19722 CD ARG D 929 -17.382 25.065 98.752 1.00 30.14 C ATOM 19723 NE ARG D 929 -18.557 25.770 98.246 1.00 33.51 N ATOM 19724 CZ ARG D 929 -18.505 26.771 97.372 1.00 38.93 C ATOM 19725 NH1 ARG D 929 -17.334 27.182 96.897 1.00 30.57 N ATOM 19726 NH2 ARG D 929 -19.625 27.360 96.969 1.00 37.57 N ATOM 19727 N LEU D 930 -18.982 19.820 97.734 1.00 9.00 N ATOM 19728 CA LEU D 930 -19.604 18.629 98.298 1.00 7.70 C ATOM 19729 C LEU D 930 -18.710 17.411 98.103 1.00 9.33 C ATOM 19730 O LEU D 930 -18.475 16.645 99.037 1.00 7.72 O ATOM 19731 CB LEU D 930 -20.962 18.377 97.647 1.00 7.22 C ATOM 19732 CG LEU D 930 -21.614 17.042 98.011 1.00 6.85 C ATOM 19733 CD1 LEU D 930 -21.829 16.945 99.515 1.00 6.46 C ATOM 19734 CD2 LEU D 930 -22.924 16.855 97.263 1.00 5.44 C ATOM 19735 N LEU D 931 -18.218 17.245 96.879 1.00 8.98 N ATOM 19736 CA LEU D 931 -17.359 16.124 96.529 1.00 6.41 C ATOM 19737 C LEU D 931 -16.133 16.095 97.425 1.00 6.65 C ATOM 19738 O LEU D 931 -15.814 15.055 98.005 1.00 6.27 O ATOM 19739 CB LEU D 931 -16.955 16.191 95.055 1.00 5.57 C ATOM 19740 CG LEU D 931 -17.967 15.659 94.037 1.00 6.30 C ATOM 19741 CD1 LEU D 931 -17.482 15.877 92.612 1.00 3.85 C ATOM 19742 CD2 LEU D 931 -18.252 14.186 94.283 1.00 4.06 C ATOM 19743 N ASP D 932 -15.462 17.237 97.561 1.00 6.60 N ATOM 19744 CA ASP D 932 -14.291 17.295 98.440 1.00 7.10 C ATOM 19745 C ASP D 932 -14.630 16.978 99.903 1.00 6.78 C ATOM 19746 O ASP D 932 -13.871 16.288 100.584 1.00 6.37 O ATOM 19747 CB ASP D 932 -13.559 18.636 98.316 1.00 8.34 C ATOM 19748 CG ASP D 932 -12.409 18.584 97.315 1.00 12.20 C ATOM 19749 OD1 ASP D 932 -11.655 17.586 97.323 1.00 9.58 O ATOM 19750 OD2 ASP D 932 -12.259 19.538 96.518 1.00 11.50 O ATOM 19751 N ALA D 933 -15.774 17.468 100.377 1.00 9.11 N ATOM 19752 CA ALA D 933 -16.222 17.166 101.739 1.00 7.69 C ATOM 19753 C ALA D 933 -16.405 15.660 101.959 1.00 9.21 C ATOM 19754 O ALA D 933 -15.851 15.078 102.911 1.00 11.41 O ATOM 19755 CB ALA D 933 -17.511 17.908 102.048 1.00 6.68 C ATOM 19756 N LEU D 934 -17.188 15.045 101.073 1.00 6.05 N ATOM 19757 CA LEU D 934 -17.407 13.602 101.076 1.00 6.20 C ATOM 19758 C LEU D 934 -16.082 12.851 101.064 1.00 8.77 C ATOM 19759 O LEU D 934 -15.915 11.863 101.777 1.00 9.06 O ATOM 19760 CB LEU D 934 -18.246 13.183 99.866 1.00 6.07 C ATOM 19761 CG LEU D 934 -19.701 13.653 99.798 1.00 4.51 C ATOM 19762 CD1 LEU D 934 -20.299 13.293 98.461 1.00 3.52 C ATOM 19763 CD2 LEU D 934 -20.521 13.048 100.919 1.00 3.93 C ATOM 19764 N LYS D 935 -15.146 13.328 100.248 1.00 7.00 N ATOM 19765 CA LYS D 935 -13.810 12.753 100.188 1.00 5.97 C ATOM 19766 C LYS D 935 -13.157 12.767 101.568 1.00 8.80 C ATOM 19767 O LYS D 935 -12.728 11.725 102.086 1.00 10.88 O ATOM 19768 CB LYS D 935 -12.947 13.544 99.203 1.00 5.76 C ATOM 19769 CG LYS D 935 -11.482 13.137 99.187 1.00 9.07 C ATOM 19770 CD LYS D 935 -10.597 14.265 98.680 1.00 6.50 C ATOM 19771 CE LYS D 935 -10.675 15.467 99.606 1.00 7.45 C ATOM 19772 NZ LYS D 935 -9.799 16.582 99.159 1.00 9.14 N ATOM 19773 N TYR D 936 -13.102 13.958 102.157 1.00 9.84 N ATOM 19774 CA TYR D 936 -12.450 14.172 103.444 1.00 8.04 C ATOM 19775 C TYR D 936 -13.019 13.272 104.538 1.00 8.45 C ATOM 19776 O TYR D 936 -12.286 12.503 105.177 1.00 7.77 O ATOM 19777 CB TYR D 936 -12.578 15.645 103.850 1.00 7.09 C ATOM 19778 CG TYR D 936 -12.004 15.968 105.211 1.00 10.96 C ATOM 19779 CD1 TYR D 936 -10.641 16.170 105.381 1.00 14.60 C ATOM 19780 CD2 TYR D 936 -12.826 16.078 106.324 1.00 12.75 C ATOM 19781 CE1 TYR D 936 -10.113 16.467 106.623 1.00 19.40 C ATOM 19782 CE2 TYR D 936 -12.308 16.371 107.568 1.00 15.61 C ATOM 19783 CZ TYR D 936 -10.950 16.565 107.714 1.00 23.01 C ATOM 19784 OH TYR D 936 -10.430 16.861 108.956 1.00 25.79 O ATOM 19785 N TYR D 937 -14.329 13.358 104.746 1.00 8.06 N ATOM 19786 CA TYR D 937 -14.937 12.587 105.824 1.00 9.02 C ATOM 19787 C TYR D 937 -14.889 11.088 105.552 1.00 9.24 C ATOM 19788 O TYR D 937 -14.704 10.292 106.471 1.00 9.16 O ATOM 19789 CB TYR D 937 -16.362 13.061 106.109 1.00 12.02 C ATOM 19790 CG TYR D 937 -16.405 14.434 106.739 1.00 14.20 C ATOM 19791 CD1 TYR D 937 -16.829 15.539 106.012 1.00 13.08 C ATOM 19792 CD2 TYR D 937 -15.999 14.629 108.055 1.00 10.09 C ATOM 19793 CE1 TYR D 937 -16.863 16.797 106.580 1.00 14.94 C ATOM 19794 CE2 TYR D 937 -16.026 15.884 108.630 1.00 12.35 C ATOM 19795 CZ TYR D 937 -16.460 16.966 107.888 1.00 16.34 C ATOM 19796 OH TYR D 937 -16.492 18.222 108.451 1.00 16.22 O ATOM 19797 N GLY D 938 -15.035 10.711 104.287 1.00 8.89 N ATOM 19798 CA GLY D 938 -14.906 9.322 103.890 1.00 6.71 C ATOM 19799 C GLY D 938 -13.557 8.748 104.281 1.00 7.15 C ATOM 19800 O GLY D 938 -13.491 7.736 104.981 1.00 9.78 O ATOM 19801 N PHE D 939 -12.481 9.400 103.849 1.00 6.71 N ATOM 19802 CA PHE D 939 -11.137 8.937 104.196 1.00 9.73 C ATOM 19803 C PHE D 939 -10.944 8.898 105.712 1.00 10.07 C ATOM 19804 O PHE D 939 -10.464 7.894 106.273 1.00 10.74 O ATOM 19805 CB PHE D 939 -10.066 9.824 103.549 1.00 10.79 C ATOM 19806 CG PHE D 939 -9.868 9.572 102.079 1.00 8.67 C ATOM 19807 CD1 PHE D 939 -9.426 10.585 101.245 1.00 6.43 C ATOM 19808 CD2 PHE D 939 -10.121 8.323 101.532 1.00 7.92 C ATOM 19809 CE1 PHE D 939 -9.242 10.357 99.893 1.00 6.28 C ATOM 19810 CE2 PHE D 939 -9.937 8.091 100.178 1.00 5.09 C ATOM 19811 CZ PHE D 939 -9.497 9.107 99.361 1.00 6.28 C ATOM 19812 N THR D 940 -11.338 9.991 106.366 1.00 10.19 N ATOM 19813 CA THR D 940 -11.198 10.113 107.815 1.00 10.56 C ATOM 19814 C THR D 940 -11.838 8.942 108.559 1.00 11.86 C ATOM 19815 O THR D 940 -11.183 8.271 109.359 1.00 10.84 O ATOM 19816 CB THR D 940 -11.804 11.432 108.333 1.00 8.90 C ATOM 19817 OG1 THR D 940 -11.046 12.539 107.830 1.00 10.85 O ATOM 19818 CG2 THR D 940 -11.783 11.469 109.846 1.00 6.35 C ATOM 19819 N PHE D 941 -13.112 8.689 108.278 1.00 10.43 N ATOM 19820 CA PHE D 941 -13.852 7.640 108.971 1.00 10.64 C ATOM 19821 C PHE D 941 -13.378 6.253 108.575 1.00 12.08 C ATOM 19822 O PHE D 941 -13.434 5.321 109.378 1.00 13.91 O ATOM 19823 CB PHE D 941 -15.352 7.777 108.712 1.00 10.06 C ATOM 19824 CG PHE D 941 -15.949 9.012 109.305 1.00 8.74 C ATOM 19825 CD1 PHE D 941 -16.906 9.733 108.616 1.00 9.30 C ATOM 19826 CD2 PHE D 941 -15.547 9.453 110.554 1.00 10.63 C ATOM 19827 CE1 PHE D 941 -17.452 10.874 109.161 1.00 13.42 C ATOM 19828 CE2 PHE D 941 -16.087 10.592 111.107 1.00 11.66 C ATOM 19829 CZ PHE D 941 -17.041 11.306 110.410 1.00 16.58 C ATOM 19830 N SER D 942 -12.918 6.115 107.335 1.00 11.02 N ATOM 19831 CA SER D 942 -12.394 4.837 106.879 1.00 9.99 C ATOM 19832 C SER D 942 -11.144 4.487 107.675 1.00 10.17 C ATOM 19833 O SER D 942 -10.919 3.324 108.005 1.00 11.67 O ATOM 19834 CB SER D 942 -12.074 4.883 105.388 1.00 8.82 C ATOM 19835 OG SER D 942 -10.979 5.744 105.141 1.00 11.40 O ATOM 19836 N THR D 943 -10.335 5.495 107.989 1.00 8.51 N ATOM 19837 CA THR D 943 -9.133 5.262 108.791 1.00 8.12 C ATOM 19838 C THR D 943 -9.413 4.592 110.143 1.00 9.83 C ATOM 19839 O THR D 943 -8.793 3.589 110.485 1.00 12.98 O ATOM 19840 CB THR D 943 -8.352 6.567 109.046 1.00 11.12 C ATOM 19841 OG1 THR D 943 -7.924 7.126 107.798 1.00 9.78 O ATOM 19842 CG2 THR D 943 -7.133 6.296 109.918 1.00 9.71 C ATOM 19843 N THR D 944 -10.349 5.148 110.905 1.00 13.60 N ATOM 19844 CA THR D 944 -10.609 4.693 112.272 1.00 12.47 C ATOM 19845 C THR D 944 -11.732 3.662 112.373 1.00 13.53 C ATOM 19846 O THR D 944 -12.065 3.208 113.466 1.00 13.87 O ATOM 19847 CB THR D 944 -10.985 5.876 113.183 1.00 11.72 C ATOM 19848 OG1 THR D 944 -12.226 6.441 112.740 1.00 9.67 O ATOM 19849 CG2 THR D 944 -9.901 6.945 113.151 1.00 9.91 C ATOM 19850 N SER D 945 -12.316 3.306 111.234 1.00 16.15 N ATOM 19851 CA SER D 945 -13.453 2.386 111.187 1.00 16.59 C ATOM 19852 C SER D 945 -13.144 1.011 111.770 1.00 17.04 C ATOM 19853 O SER D 945 -14.029 0.342 112.301 1.00 18.07 O ATOM 19854 CB SER D 945 -13.920 2.211 109.743 1.00 22.57 C ATOM 19855 OG SER D 945 -12.892 1.634 108.948 1.00 19.58 O