>>4OIR:HELIX   84  84 GLU D  907  SER D  945  1                                  39    
EKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 84 84 GLU D 907 SER D 945 1 39 ATOM 19538 N GLU D 907 -23.391 3.769 100.437 1.00 29.64 N ATOM 19539 CA GLU D 907 -22.545 2.922 99.604 1.00 26.79 C ATOM 19540 C GLU D 907 -22.355 3.560 98.227 1.00 30.32 C ATOM 19541 O GLU D 907 -22.733 4.711 98.021 1.00 31.27 O ATOM 19542 CB GLU D 907 -23.119 1.504 99.495 1.00 24.38 C ATOM 19543 CG GLU D 907 -24.635 1.431 99.463 1.00 25.48 C ATOM 19544 CD GLU D 907 -25.212 1.879 98.138 1.00 37.44 C ATOM 19545 OE1 GLU D 907 -24.510 1.752 97.111 1.00 36.17 O ATOM 19546 OE2 GLU D 907 -26.366 2.359 98.124 1.00 41.65 O ATOM 19547 N LYS D 908 -21.768 2.815 97.294 1.00 32.87 N ATOM 19548 CA LYS D 908 -21.416 3.351 95.978 1.00 26.93 C ATOM 19549 C LYS D 908 -22.594 3.987 95.245 1.00 28.55 C ATOM 19550 O LYS D 908 -22.479 5.100 94.730 1.00 30.95 O ATOM 19551 CB LYS D 908 -20.776 2.264 95.109 1.00 27.51 C ATOM 19552 CG LYS D 908 -20.232 2.766 93.779 1.00 29.40 C ATOM 19553 CD LYS D 908 -19.326 1.728 93.128 1.00 32.97 C ATOM 19554 CE LYS D 908 -20.024 0.379 93.003 1.00 44.17 C ATOM 19555 NZ LYS D 908 -19.119 -0.694 92.493 1.00 41.10 N ATOM 19556 N ASN D 909 -23.723 3.284 95.212 1.00 29.48 N ATOM 19557 CA ASN D 909 -24.905 3.755 94.492 1.00 31.97 C ATOM 19558 C ASN D 909 -25.557 4.973 95.131 1.00 32.88 C ATOM 19559 O ASN D 909 -25.857 5.963 94.453 1.00 35.09 O ATOM 19560 CB ASN D 909 -25.933 2.633 94.352 1.00 31.62 C ATOM 19561 CG ASN D 909 -25.492 1.558 93.384 1.00 42.06 C ATOM 19562 OD1 ASN D 909 -24.859 1.845 92.366 1.00 43.33 O ATOM 19563 ND2 ASN D 909 -25.826 0.310 93.694 1.00 44.50 N ATOM 19564 N SER D 910 -25.780 4.897 96.438 1.00 25.60 N ATOM 19565 CA SER D 910 -26.403 5.998 97.153 1.00 32.89 C ATOM 19566 C SER D 910 -25.537 7.254 97.092 1.00 32.68 C ATOM 19567 O SER D 910 -26.048 8.356 96.893 1.00 41.08 O ATOM 19568 CB SER D 910 -26.694 5.609 98.601 1.00 29.82 C ATOM 19569 OG SER D 910 -25.514 5.197 99.259 1.00 30.39 O ATOM 19570 N LEU D 911 -24.228 7.086 97.246 1.00 26.93 N ATOM 19571 CA LEU D 911 -23.310 8.218 97.182 1.00 23.52 C ATOM 19572 C LEU D 911 -23.220 8.778 95.766 1.00 23.86 C ATOM 19573 O LEU D 911 -23.100 9.988 95.578 1.00 28.43 O ATOM 19574 CB LEU D 911 -21.924 7.834 97.704 1.00 22.17 C ATOM 19575 CG LEU D 911 -21.837 7.489 99.194 1.00 21.07 C ATOM 19576 CD1 LEU D 911 -20.440 7.022 99.555 1.00 20.85 C ATOM 19577 CD2 LEU D 911 -22.245 8.670 100.059 1.00 24.89 C ATOM 19578 N LYS D 912 -23.283 7.898 94.772 1.00 24.10 N ATOM 19579 CA LYS D 912 -23.313 8.334 93.380 1.00 27.74 C ATOM 19580 C LYS D 912 -24.529 9.233 93.153 1.00 32.22 C ATOM 19581 O LYS D 912 -24.402 10.373 92.670 1.00 28.02 O ATOM 19582 CB LYS D 912 -23.351 7.122 92.444 1.00 26.79 C ATOM 19583 CG LYS D 912 -23.158 7.446 90.973 1.00 26.03 C ATOM 19584 CD LYS D 912 -22.828 6.192 90.165 1.00 33.33 C ATOM 19585 CE LYS D 912 -23.996 5.212 90.119 1.00 44.56 C ATOM 19586 NZ LYS D 912 -25.060 5.630 89.159 1.00 40.44 N ATOM 19587 N ASP D 913 -25.700 8.720 93.531 1.00 30.62 N ATOM 19588 CA ASP D 913 -26.952 9.464 93.407 1.00 33.96 C ATOM 19589 C ASP D 913 -26.886 10.793 94.149 1.00 30.42 C ATOM 19590 O ASP D 913 -27.413 11.801 93.682 1.00 30.58 O ATOM 19591 CB ASP D 913 -28.129 8.637 93.924 1.00 40.31 C ATOM 19592 CG ASP D 913 -28.460 7.467 93.020 1.00 46.61 C ATOM 19593 OD1 ASP D 913 -28.154 7.542 91.811 1.00 46.45 O ATOM 19594 OD2 ASP D 913 -29.030 6.473 93.517 1.00 48.22 O ATOM 19595 N LEU D 914 -26.237 10.781 95.309 1.00 30.59 N ATOM 19596 CA LEU D 914 -26.007 11.999 96.077 1.00 28.18 C ATOM 19597 C LEU D 914 -25.210 13.017 95.264 1.00 29.37 C ATOM 19598 O LEU D 914 -25.593 14.186 95.176 1.00 27.18 O ATOM 19599 CB LEU D 914 -25.272 11.676 97.379 1.00 21.93 C ATOM 19600 CG LEU D 914 -24.847 12.855 98.253 1.00 18.34 C ATOM 19601 CD1 LEU D 914 -26.057 13.665 98.673 1.00 32.31 C ATOM 19602 CD2 LEU D 914 -24.086 12.366 99.471 1.00 21.61 C ATOM 19603 N VAL D 915 -24.108 12.570 94.666 1.00 32.65 N ATOM 19604 CA VAL D 915 -23.267 13.463 93.870 1.00 28.18 C ATOM 19605 C VAL D 915 -24.045 14.043 92.690 1.00 24.46 C ATOM 19606 O VAL D 915 -23.934 15.236 92.392 1.00 18.64 O ATOM 19607 CB VAL D 915 -21.979 12.767 93.371 1.00 20.33 C ATOM 19608 CG1 VAL D 915 -21.119 13.742 92.588 1.00 19.62 C ATOM 19609 CG2 VAL D 915 -21.190 12.219 94.539 1.00 18.24 C ATOM 19610 N TYR D 916 -24.846 13.205 92.037 1.00 25.28 N ATOM 19611 CA TYR D 916 -25.640 13.664 90.896 1.00 23.75 C ATOM 19612 C TYR D 916 -26.702 14.692 91.295 1.00 26.69 C ATOM 19613 O TYR D 916 -26.829 15.752 90.667 1.00 23.64 O ATOM 19614 CB TYR D 916 -26.293 12.481 90.177 1.00 19.61 C ATOM 19615 CG TYR D 916 -27.117 12.884 88.973 1.00 25.35 C ATOM 19616 CD1 TYR D 916 -28.456 12.524 88.870 1.00 28.91 C ATOM 19617 CD2 TYR D 916 -26.558 13.634 87.943 1.00 24.05 C ATOM 19618 CE1 TYR D 916 -29.215 12.890 87.770 1.00 24.31 C ATOM 19619 CE2 TYR D 916 -27.308 14.006 86.840 1.00 22.65 C ATOM 19620 CZ TYR D 916 -28.636 13.632 86.760 1.00 24.41 C ATOM 19621 OH TYR D 916 -29.388 14.001 85.667 1.00 24.59 O ATOM 19622 N GLN D 917 -27.462 14.374 92.340 1.00 31.32 N ATOM 19623 CA GLN D 917 -28.517 15.263 92.814 1.00 29.23 C ATOM 19624 C GLN D 917 -27.926 16.588 93.254 1.00 28.37 C ATOM 19625 O GLN D 917 -28.484 17.648 92.978 1.00 33.86 O ATOM 19626 CB GLN D 917 -29.299 14.627 93.964 1.00 28.52 C ATOM 19627 CG GLN D 917 -30.119 13.415 93.555 1.00 31.02 C ATOM 19628 CD GLN D 917 -31.062 13.716 92.410 1.00 31.86 C ATOM 19629 OE1 GLN D 917 -31.706 14.766 92.381 1.00 36.55 O ATOM 19630 NE2 GLN D 917 -31.142 12.799 91.453 1.00 30.67 N ATOM 19631 N ALA D 918 -26.786 16.520 93.928 1.00 26.06 N ATOM 19632 CA ALA D 918 -26.088 17.722 94.356 1.00 31.01 C ATOM 19633 C ALA D 918 -25.612 18.530 93.153 1.00 28.50 C ATOM 19634 O ALA D 918 -25.627 19.758 93.181 1.00 28.32 O ATOM 19635 CB ALA D 918 -24.919 17.366 95.259 1.00 36.80 C ATOM 19636 N PHE D 919 -25.188 17.839 92.099 1.00 27.66 N ATOM 19637 CA PHE D 919 -24.792 18.514 90.867 1.00 27.94 C ATOM 19638 C PHE D 919 -25.970 19.309 90.326 1.00 32.03 C ATOM 19639 O PHE D 919 -25.864 20.520 90.105 1.00 32.16 O ATOM 19640 CB PHE D 919 -24.307 17.506 89.822 1.00 27.76 C ATOM 19641 CG PHE D 919 -23.675 18.138 88.608 1.00 21.27 C ATOM 19642 CD1 PHE D 919 -22.313 18.393 88.573 1.00 20.33 C ATOM 19643 CD2 PHE D 919 -24.439 18.459 87.499 1.00 16.31 C ATOM 19644 CE1 PHE D 919 -21.729 18.966 87.462 1.00 20.20 C ATOM 19645 CE2 PHE D 919 -23.860 19.031 86.385 1.00 18.68 C ATOM 19646 CZ PHE D 919 -22.505 19.287 86.367 1.00 21.63 C ATOM 19647 N LEU D 920 -27.095 18.620 90.139 1.00 33.83 N ATOM 19648 CA LEU D 920 -28.307 19.241 89.603 1.00 32.16 C ATOM 19649 C LEU D 920 -28.781 20.434 90.426 1.00 38.26 C ATOM 19650 O LEU D 920 -28.958 21.535 89.900 1.00 44.75 O ATOM 19651 CB LEU D 920 -29.440 18.217 89.511 1.00 25.63 C ATOM 19652 CG LEU D 920 -29.236 17.052 88.547 1.00 22.41 C ATOM 19653 CD1 LEU D 920 -30.478 16.184 88.491 1.00 20.24 C ATOM 19654 CD2 LEU D 920 -28.879 17.575 87.171 1.00 23.37 C ATOM 19655 N ARG D 921 -29.002 20.206 91.715 1.00 35.11 N ATOM 19656 CA ARG D 921 -29.570 21.230 92.579 1.00 35.94 C ATOM 19657 C ARG D 921 -28.602 22.357 92.932 1.00 34.28 C ATOM 19658 O ARG D 921 -28.917 23.531 92.753 1.00 45.41 O ATOM 19659 CB ARG D 921 -30.098 20.582 93.855 1.00 37.10 C ATOM 19660 CG ARG D 921 -31.048 19.425 93.595 1.00 43.56 C ATOM 19661 CD ARG D 921 -32.420 19.919 93.173 1.00 58.09 C ATOM 19662 NE ARG D 921 -33.020 20.764 94.202 1.00 71.00 N ATOM 19663 CZ ARG D 921 -33.651 20.299 95.277 1.00 73.62 C ATOM 19664 NH1 ARG D 921 -33.768 18.990 95.469 1.00 68.11 N ATOM 19665 NH2 ARG D 921 -34.162 21.143 96.163 1.00 68.62 N ATOM 19666 N LEU D 922 -27.431 22.001 93.444 1.00 30.50 N ATOM 19667 CA LEU D 922 -26.487 23.003 93.932 1.00 31.40 C ATOM 19668 C LEU D 922 -25.345 23.416 92.995 1.00 32.08 C ATOM 19669 O LEU D 922 -24.573 24.314 93.331 1.00 37.74 O ATOM 19670 CB LEU D 922 -25.928 22.562 95.282 1.00 31.60 C ATOM 19671 CG LEU D 922 -27.037 22.293 96.292 1.00 32.27 C ATOM 19672 CD1 LEU D 922 -26.568 21.303 97.330 1.00 37.07 C ATOM 19673 CD2 LEU D 922 -27.478 23.593 96.943 1.00 46.19 C ATOM 19674 N GLY D 923 -25.229 22.785 91.831 1.00 25.23 N ATOM 19675 CA GLY D 923 -24.174 23.161 90.902 1.00 29.27 C ATOM 19676 C GLY D 923 -22.790 22.587 91.174 1.00 31.36 C ATOM 19677 O GLY D 923 -22.491 22.090 92.270 1.00 38.00 O ATOM 19678 N MET D 924 -21.925 22.680 90.167 1.00 30.46 N ATOM 19679 CA MET D 924 -20.656 21.956 90.181 1.00 28.76 C ATOM 19680 C MET D 924 -19.641 22.419 91.226 1.00 30.93 C ATOM 19681 O MET D 924 -18.814 21.626 91.668 1.00 36.96 O ATOM 19682 CB MET D 924 -20.025 21.904 88.780 1.00 23.52 C ATOM 19683 CG MET D 924 -19.660 23.246 88.178 1.00 30.89 C ATOM 19684 SD MET D 924 -19.117 23.078 86.460 1.00 33.89 S ATOM 19685 CE MET D 924 -20.581 22.336 85.738 1.00 32.16 C ATOM 19686 N GLU D 925 -19.698 23.682 91.630 1.00 32.03 N ATOM 19687 CA GLU D 925 -18.755 24.174 92.631 1.00 33.64 C ATOM 19688 C GLU D 925 -19.041 23.532 93.985 1.00 33.47 C ATOM 19689 O GLU D 925 -18.158 22.932 94.629 1.00 36.69 O ATOM 19690 CB GLU D 925 -18.837 25.697 92.743 1.00 30.74 C ATOM 19691 CG GLU D 925 -17.852 26.289 93.740 1.00 39.35 C ATOM 19692 CD GLU D 925 -17.819 27.803 93.699 1.00 39.53 C ATOM 19693 OE1 GLU D 925 -18.803 28.406 93.219 1.00 40.43 O ATOM 19694 OE2 GLU D 925 -16.805 28.387 94.142 1.00 34.54 O ATOM 19695 N LYS D 926 -20.294 23.645 94.404 1.00 28.78 N ATOM 19696 CA LYS D 926 -20.711 23.072 95.667 1.00 31.61 C ATOM 19697 C LYS D 926 -20.619 21.557 95.605 1.00 30.90 C ATOM 19698 O LYS D 926 -20.342 20.908 96.614 1.00 32.13 O ATOM 19699 CB LYS D 926 -22.119 23.538 96.040 1.00 37.98 C ATOM 19700 CG LYS D 926 -22.191 25.026 96.364 1.00 49.40 C ATOM 19701 CD LYS D 926 -23.468 25.384 97.103 1.00 53.09 C ATOM 19702 CE LYS D 926 -23.407 26.804 97.644 1.00 56.70 C ATOM 19703 NZ LYS D 926 -24.587 27.120 98.497 1.00 66.54 N ATOM 19704 N THR D 927 -20.825 20.991 94.418 1.00 27.98 N ATOM 19705 CA THR D 927 -20.669 19.549 94.269 1.00 26.16 C ATOM 19706 C THR D 927 -19.212 19.130 94.463 1.00 23.79 C ATOM 19707 O THR D 927 -18.933 18.098 95.071 1.00 24.89 O ATOM 19708 CB THR D 927 -21.185 19.047 92.920 1.00 23.37 C ATOM 19709 OG1 THR D 927 -22.496 19.573 92.693 1.00 24.50 O ATOM 19710 CG2 THR D 927 -21.253 17.529 92.915 1.00 22.54 C ATOM 19711 N ALA D 928 -18.287 19.937 93.956 1.00 22.59 N ATOM 19712 CA ALA D 928 -16.865 19.688 94.163 1.00 23.67 C ATOM 19713 C ALA D 928 -16.521 19.775 95.646 1.00 27.70 C ATOM 19714 O ALA D 928 -15.759 18.950 96.169 1.00 28.49 O ATOM 19715 CB ALA D 928 -16.024 20.667 93.363 1.00 23.12 C ATOM 19716 N ARG D 929 -17.087 20.768 96.329 1.00 30.00 N ATOM 19717 CA ARG D 929 -16.858 20.876 97.770 1.00 31.62 C ATOM 19718 C ARG D 929 -17.375 19.648 98.523 1.00 28.01 C ATOM 19719 O ARG D 929 -16.690 19.106 99.404 1.00 28.57 O ATOM 19720 CB ARG D 929 -17.457 22.165 98.336 1.00 35.85 C ATOM 19721 CG ARG D 929 -16.605 23.395 98.057 1.00 44.03 C ATOM 19722 CD ARG D 929 -16.734 24.431 99.162 1.00 49.03 C ATOM 19723 NE ARG D 929 -18.065 25.025 99.203 1.00 66.29 N ATOM 19724 CZ ARG D 929 -18.452 26.037 98.433 1.00 74.80 C ATOM 19725 NH1 ARG D 929 -17.605 26.566 97.557 1.00 62.84 N ATOM 19726 NH2 ARG D 929 -19.685 26.518 98.534 1.00 71.43 N ATOM 19727 N LEU D 930 -18.575 19.207 98.157 1.00 25.41 N ATOM 19728 CA LEU D 930 -19.160 17.997 98.723 1.00 26.89 C ATOM 19729 C LEU D 930 -18.234 16.805 98.512 1.00 28.53 C ATOM 19730 O LEU D 930 -18.000 16.017 99.431 1.00 28.18 O ATOM 19731 CB LEU D 930 -20.521 17.712 98.087 1.00 21.34 C ATOM 19732 CG LEU D 930 -21.157 16.359 98.419 1.00 17.79 C ATOM 19733 CD1 LEU D 930 -21.369 16.202 99.917 1.00 21.20 C ATOM 19734 CD2 LEU D 930 -22.470 16.191 97.675 1.00 20.54 C ATOM 19735 N LEU D 931 -17.708 16.687 97.296 1.00 27.45 N ATOM 19736 CA LEU D 931 -16.769 15.624 96.957 1.00 22.20 C ATOM 19737 C LEU D 931 -15.556 15.649 97.882 1.00 24.31 C ATOM 19738 O LEU D 931 -15.239 14.640 98.517 1.00 27.06 O ATOM 19739 CB LEU D 931 -16.335 15.726 95.491 1.00 18.28 C ATOM 19740 CG LEU D 931 -17.315 15.199 94.438 1.00 15.56 C ATOM 19741 CD1 LEU D 931 -16.857 15.574 93.042 1.00 16.35 C ATOM 19742 CD2 LEU D 931 -17.477 13.692 94.557 1.00 13.78 C ATOM 19743 N ASP D 932 -14.891 16.801 97.967 1.00 26.14 N ATOM 19744 CA ASP D 932 -13.740 16.946 98.866 1.00 29.29 C ATOM 19745 C ASP D 932 -14.082 16.522 100.299 1.00 29.22 C ATOM 19746 O ASP D 932 -13.319 15.786 100.935 1.00 28.41 O ATOM 19747 CB ASP D 932 -13.195 18.381 98.843 1.00 35.87 C ATOM 19748 CG ASP D 932 -12.227 18.627 97.688 1.00 38.09 C ATOM 19749 OD1 ASP D 932 -11.331 17.781 97.473 1.00 34.82 O ATOM 19750 OD2 ASP D 932 -12.359 19.665 96.996 1.00 30.42 O ATOM 19751 N ALA D 933 -15.239 16.969 100.789 1.00 26.16 N ATOM 19752 CA ALA D 933 -15.689 16.618 102.139 1.00 26.57 C ATOM 19753 C ALA D 933 -15.820 15.107 102.338 1.00 25.49 C ATOM 19754 O ALA D 933 -15.235 14.527 103.271 1.00 24.11 O ATOM 19755 CB ALA D 933 -17.011 17.303 102.448 1.00 31.23 C ATOM 19756 N LEU D 934 -16.596 14.482 101.456 1.00 26.50 N ATOM 19757 CA LEU D 934 -16.820 13.043 101.495 1.00 23.09 C ATOM 19758 C LEU D 934 -15.502 12.286 101.437 1.00 22.63 C ATOM 19759 O LEU D 934 -15.354 11.241 102.073 1.00 27.13 O ATOM 19760 CB LEU D 934 -17.729 12.606 100.345 1.00 19.50 C ATOM 19761 CG LEU D 934 -19.188 13.052 100.425 1.00 13.20 C ATOM 19762 CD1 LEU D 934 -19.959 12.521 99.243 1.00 14.67 C ATOM 19763 CD2 LEU D 934 -19.815 12.577 101.714 1.00 15.83 C ATOM 19764 N LYS D 935 -14.547 12.820 100.680 1.00 16.85 N ATOM 19765 CA LYS D 935 -13.203 12.256 100.645 1.00 20.26 C ATOM 19766 C LYS D 935 -12.566 12.312 102.029 1.00 23.83 C ATOM 19767 O LYS D 935 -12.116 11.285 102.565 1.00 27.45 O ATOM 19768 CB LYS D 935 -12.328 13.013 99.650 1.00 22.39 C ATOM 19769 CG LYS D 935 -10.845 12.693 99.765 1.00 20.98 C ATOM 19770 CD LYS D 935 -9.998 13.834 99.223 1.00 20.87 C ATOM 19771 CE LYS D 935 -10.377 15.147 99.888 1.00 21.98 C ATOM 19772 NZ LYS D 935 -9.565 16.286 99.400 1.00 27.05 N ATOM 19773 N TYR D 936 -12.540 13.515 102.601 1.00 21.17 N ATOM 19774 CA TYR D 936 -11.941 13.741 103.917 1.00 22.43 C ATOM 19775 C TYR D 936 -12.489 12.780 104.964 1.00 25.68 C ATOM 19776 O TYR D 936 -11.753 11.952 105.515 1.00 25.90 O ATOM 19777 CB TYR D 936 -12.163 15.186 104.374 1.00 23.40 C ATOM 19778 CG TYR D 936 -11.526 15.517 105.708 1.00 23.91 C ATOM 19779 CD1 TYR D 936 -10.253 16.070 105.772 1.00 27.17 C ATOM 19780 CD2 TYR D 936 -12.198 15.284 106.903 1.00 25.78 C ATOM 19781 CE1 TYR D 936 -9.664 16.377 106.989 1.00 34.92 C ATOM 19782 CE2 TYR D 936 -11.617 15.583 108.123 1.00 34.15 C ATOM 19783 CZ TYR D 936 -10.349 16.129 108.162 1.00 43.04 C ATOM 19784 OH TYR D 936 -9.767 16.431 109.375 1.00 41.85 O ATOM 19785 N TYR D 937 -13.783 12.900 105.245 1.00 26.65 N ATOM 19786 CA TYR D 937 -14.390 12.080 106.289 1.00 24.26 C ATOM 19787 C TYR D 937 -14.340 10.593 105.957 1.00 23.72 C ATOM 19788 O TYR D 937 -14.147 9.765 106.847 1.00 27.77 O ATOM 19789 CB TYR D 937 -15.820 12.536 106.586 1.00 26.82 C ATOM 19790 CG TYR D 937 -15.875 13.904 107.225 1.00 26.79 C ATOM 19791 CD1 TYR D 937 -15.926 15.051 106.448 1.00 31.65 C ATOM 19792 CD2 TYR D 937 -15.855 14.049 108.603 1.00 25.73 C ATOM 19793 CE1 TYR D 937 -15.965 16.304 107.024 1.00 30.09 C ATOM 19794 CE2 TYR D 937 -15.894 15.299 109.189 1.00 28.69 C ATOM 19795 CZ TYR D 937 -15.949 16.422 108.393 1.00 27.58 C ATOM 19796 OH TYR D 937 -15.990 17.671 108.966 1.00 33.79 O ATOM 19797 N GLY D 938 -14.499 10.261 104.678 1.00 22.06 N ATOM 19798 CA GLY D 938 -14.414 8.879 104.241 1.00 22.56 C ATOM 19799 C GLY D 938 -13.096 8.248 104.645 1.00 24.00 C ATOM 19800 O GLY D 938 -13.072 7.205 105.306 1.00 24.19 O ATOM 19801 N PHE D 939 -11.995 8.894 104.270 1.00 23.57 N ATOM 19802 CA PHE D 939 -10.672 8.410 104.654 1.00 22.68 C ATOM 19803 C PHE D 939 -10.506 8.376 106.178 1.00 28.82 C ATOM 19804 O PHE D 939 -10.181 7.325 106.763 1.00 35.33 O ATOM 19805 CB PHE D 939 -9.576 9.283 104.029 1.00 24.32 C ATOM 19806 CG PHE D 939 -9.396 9.078 102.547 1.00 24.20 C ATOM 19807 CD1 PHE D 939 -8.788 10.051 101.771 1.00 26.19 C ATOM 19808 CD2 PHE D 939 -9.827 7.915 101.931 1.00 23.63 C ATOM 19809 CE1 PHE D 939 -8.615 9.865 100.407 1.00 25.62 C ATOM 19810 CE2 PHE D 939 -9.657 7.727 100.569 1.00 19.01 C ATOM 19811 CZ PHE D 939 -9.052 8.701 99.808 1.00 20.49 C ATOM 19812 N THR D 940 -10.743 9.529 106.806 1.00 31.14 N ATOM 19813 CA THR D 940 -10.540 9.704 108.246 1.00 28.13 C ATOM 19814 C THR D 940 -11.220 8.615 109.065 1.00 25.44 C ATOM 19815 O THR D 940 -10.639 8.084 110.011 1.00 27.64 O ATOM 19816 CB THR D 940 -11.073 11.069 108.726 1.00 30.01 C ATOM 19817 OG1 THR D 940 -10.600 12.104 107.856 1.00 36.51 O ATOM 19818 CG2 THR D 940 -10.611 11.355 110.146 1.00 35.01 C ATOM 19819 N PHE D 941 -12.451 8.289 108.687 1.00 25.76 N ATOM 19820 CA PHE D 941 -13.224 7.259 109.371 1.00 28.85 C ATOM 19821 C PHE D 941 -12.817 5.847 108.970 1.00 25.79 C ATOM 19822 O PHE D 941 -12.858 4.930 109.789 1.00 25.39 O ATOM 19823 CB PHE D 941 -14.719 7.467 109.134 1.00 25.85 C ATOM 19824 CG PHE D 941 -15.272 8.662 109.841 1.00 22.26 C ATOM 19825 CD1 PHE D 941 -16.231 9.458 109.243 1.00 24.95 C ATOM 19826 CD2 PHE D 941 -14.824 8.992 111.107 1.00 23.67 C ATOM 19827 CE1 PHE D 941 -16.735 10.561 109.897 1.00 31.51 C ATOM 19828 CE2 PHE D 941 -15.322 10.092 111.767 1.00 29.78 C ATOM 19829 CZ PHE D 941 -16.278 10.880 111.163 1.00 34.28 C ATOM 19830 N SER D 942 -12.436 5.670 107.710 1.00 24.95 N ATOM 19831 CA SER D 942 -11.969 4.368 107.259 1.00 27.05 C ATOM 19832 C SER D 942 -10.735 3.954 108.051 1.00 27.64 C ATOM 19833 O SER D 942 -10.504 2.766 108.276 1.00 30.61 O ATOM 19834 CB SER D 942 -11.638 4.392 105.769 1.00 31.86 C ATOM 19835 OG SER D 942 -10.413 5.069 105.535 1.00 37.21 O ATOM 19836 N THR D 943 -9.942 4.937 108.468 1.00 23.97 N ATOM 19837 CA THR D 943 -8.740 4.650 109.250 1.00 25.60 C ATOM 19838 C THR D 943 -9.015 3.985 110.604 1.00 28.34 C ATOM 19839 O THR D 943 -8.514 2.895 110.894 1.00 25.91 O ATOM 19840 CB THR D 943 -7.932 5.923 109.500 1.00 25.24 C ATOM 19841 OG1 THR D 943 -7.601 6.527 108.244 1.00 28.42 O ATOM 19842 CG2 THR D 943 -6.657 5.596 110.268 1.00 22.80 C ATOM 19843 N THR D 944 -9.821 4.653 111.422 1.00 28.65 N ATOM 19844 CA THR D 944 -10.068 4.231 112.798 1.00 25.23 C ATOM 19845 C THR D 944 -11.109 3.117 112.904 1.00 29.81 C ATOM 19846 O THR D 944 -11.327 2.557 113.977 1.00 30.19 O ATOM 19847 CB THR D 944 -10.523 5.421 113.653 1.00 20.32 C ATOM 19848 OG1 THR D 944 -11.705 5.997 113.083 1.00 19.09 O ATOM 19849 CG2 THR D 944 -9.437 6.475 113.698 1.00 25.03 C ATOM 19850 N SER D 945 -11.743 2.802 111.780 1.00 34.23 N ATOM 19851 CA SER D 945 -12.805 1.802 111.722 1.00 33.08 C ATOM 19852 C SER D 945 -12.386 0.437 112.251 1.00 33.34 C ATOM 19853 O SER D 945 -13.220 -0.337 112.714 1.00 32.82 O ATOM 19854 CB SER D 945 -13.283 1.646 110.280 1.00 40.47 C ATOM 19855 OG SER D 945 -12.195 1.323 109.427 1.00 35.71 O