>>4PJU:HELIX   49 AF4 ALA A  998  SER A 1004  1                                   7    
AFLDILSEFSSKLLRQDKRTVYVYLEKFTFQSLRREDVWLPLSYRNSLLKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 49 AF4 ALA A 998 SER A 1004 1 7 ATOM 13759 N ALA A 998 -7.689 -1.311 -36.913 1.00 78.81 N ANISOU13759 N ALA A 998 8369 12298 9277 2040 -888 2721 N ATOM 13760 CA ALA A 998 -6.901 -0.753 -35.816 1.00 78.50 C ANISOU13760 CA ALA A 998 8380 12146 9301 2130 -803 2605 C ATOM 13761 C ALA A 998 -5.398 -0.758 -36.111 1.00 79.02 C ANISOU13761 C ALA A 998 8584 12128 9312 2073 -787 2540 C ATOM 13762 O ALA A 998 -4.632 -0.049 -35.463 1.00 75.52 O ANISOU13762 O ALA A 998 8188 11574 8932 2145 -735 2464 O ATOM 13763 CB ALA A 998 -7.180 -1.514 -34.541 1.00 72.65 C ANISOU13763 CB ALA A 998 7611 11450 8540 2155 -730 2503 C ATOM 13764 H ALA A 998 -8.178 -1.982 -36.687 1.00 94.57 H ATOM 13765 HA ALA A 998 -7.171 0.168 -35.676 1.00 94.20 H ATOM 13766 HB1 ALA A 998 -6.651 -1.133 -33.823 1.00 87.17 H ATOM 13767 HB2 ALA A 998 -8.125 -1.441 -34.330 1.00 87.17 H ATOM 13768 HB3 ALA A 998 -6.941 -2.445 -34.670 1.00 87.17 H ATOM 13769 N PHE A 999 -4.984 -1.556 -37.090 1.00 74.55 N ANISOU13769 N PHE A 999 8078 11620 8628 1945 -832 2564 N ATOM 13770 CA PHE A 999 -3.582 -1.641 -37.477 1.00 65.34 C ANISOU13770 CA PHE A 999 7034 10394 7400 1881 -818 2505 C ATOM 13771 C PHE A 999 -3.040 -0.328 -38.037 1.00 74.89 C ANISOU13771 C PHE A 999 8269 11506 8681 1919 -839 2567 C ATOM 13772 O PHE A 999 -1.827 -0.134 -38.110 1.00 81.06 O ANISOU13772 O PHE A 999 9143 12215 9443 1894 -811 2508 O ATOM 13773 CB PHE A 999 -3.386 -2.746 -38.511 1.00 63.67 C ANISOU13773 CB PHE A 999 6865 10279 7047 1738 -869 2522 C ATOM 13774 CG PHE A 999 -1.953 -3.147 -38.698 1.00 75.21 C ANISOU13774 CG PHE A 999 8446 11699 8431 1670 -840 2426 C ATOM 13775 CD1 PHE A 999 -1.279 -3.835 -37.700 1.00 78.43 C ANISOU13775 CD1 PHE A 999 8910 12072 8818 1675 -774 2287 C ATOM 13776 CD2 PHE A 999 -1.277 -2.838 -39.865 1.00 76.68 C ANISOU13776 CD2 PHE A 999 8685 11888 8564 1601 -879 2476 C ATOM 13777 CE1 PHE A 999 0.042 -4.206 -37.863 1.00 74.12 C ANISOU13777 CE1 PHE A 999 8467 11487 8209 1617 -750 2196 C ATOM 13778 CE2 PHE A 999 0.042 -3.209 -40.035 1.00 74.16 C ANISOU13778 CE2 PHE A 999 8465 11538 8173 1541 -848 2382 C ATOM 13779 CZ PHE A 999 0.703 -3.894 -39.033 1.00 72.17 C ANISOU13779 CZ PHE A 999 8266 11246 7911 1552 -784 2240 C ATOM 13780 H PHE A 999 -5.503 -2.064 -37.550 1.00 89.46 H ATOM 13781 HA PHE A 999 -3.055 -1.869 -36.695 1.00 78.41 H ATOM 13782 HB2 PHE A 999 -3.880 -3.531 -38.228 1.00 76.40 H ATOM 13783 HB3 PHE A 999 -3.722 -2.437 -39.367 1.00 76.40 H ATOM 13784 HD1 PHE A 999 -1.721 -4.047 -36.910 1.00 94.12 H ATOM 13785 HD2 PHE A 999 -1.717 -2.378 -40.543 1.00 92.02 H ATOM 13786 HE1 PHE A 999 0.483 -4.667 -37.187 1.00 88.95 H ATOM 13787 HE2 PHE A 999 0.486 -2.996 -40.824 1.00 88.99 H ATOM 13788 HZ PHE A 999 1.592 -4.143 -39.146 1.00 86.61 H ATOM 13789 N LEU A1000 -3.935 0.565 -38.444 1.00 80.86 N ANISOU13789 N LEU A1000 8940 12258 9525 1977 -891 2691 N ATOM 13790 CA LEU A1000 -3.531 1.874 -38.946 1.00 82.63 C ANISOU13790 CA LEU A1000 9178 12380 9836 2018 -920 2767 C ATOM 13791 C LEU A1000 -2.979 2.749 -37.823 1.00 80.08 C ANISOU13791 C LEU A1000 8877 11915 9636 2135 -852 2672 C ATOM 13792 O LEU A1000 -2.167 3.645 -38.061 1.00 82.25 O ANISOU13792 O LEU A1000 9204 12081 9967 2149 -855 2686 O ATOM 13793 CB LEU A1000 -4.713 2.577 -39.613 1.00 88.13 C ANISOU13793 CB LEU A1000 9772 13107 10608 2057 -1001 2927 C ATOM 13794 CG LEU A1000 -5.314 1.921 -40.857 1.00 86.35 C ANISOU13794 CG LEU A1000 9517 13019 10272 1946 -1085 3043 C ATOM 13795 CD1 LEU A1000 -6.215 2.914 -41.542 1.00 83.80 C ANISOU13795 CD1 LEU A1000 9107 12691 10044 1994 -1169 3209 C ATOM 13796 CD2 LEU A1000 -4.244 1.439 -41.818 1.00 89.70 C ANISOU13796 CD2 LEU A1000 10047 13477 10558 1812 -1100 3040 C ATOM 13797 H LEU A1000 -4.786 0.437 -38.440 1.00 97.03 H ATOM 13798 HA LEU A1000 -2.834 1.758 -39.610 1.00 99.15 H ATOM 13799 HB2 LEU A1000 -5.425 2.652 -38.959 1.00105.76 H ATOM 13800 HB3 LEU A1000 -4.425 3.466 -39.872 1.00105.76 H ATOM 13801 HG LEU A1000 -5.850 1.158 -40.590 1.00103.62 H ATOM 13802 HD11 LEU A1000 -6.597 2.501 -42.331 1.00100.57 H ATOM 13803 HD12 LEU A1000 -6.920 3.175 -40.929 1.00100.57 H ATOM 13804 HD13 LEU A1000 -5.692 3.691 -41.795 1.00100.57 H ATOM 13805 HD21 LEU A1000 -4.671 1.032 -42.588 1.00107.64 H ATOM 13806 HD22 LEU A1000 -3.708 2.198 -42.099 1.00107.64 H ATOM 13807 HD23 LEU A1000 -3.684 0.788 -41.367 1.00107.64 H ATOM 13808 N ASP A1001 -3.434 2.492 -36.602 1.00 88.40 N ANISOU13808 N ASP A1001 9887 12972 10729 2215 -792 2575 N ATOM 13809 CA ASP A1001 -2.937 3.197 -35.430 1.00 94.09 C ANISOU13809 CA ASP A1001 10627 13573 11549 2324 -722 2463 C ATOM 13810 C ASP A1001 -1.492 2.780 -35.166 1.00 96.65 C ANISOU13810 C ASP A1001 11073 13848 11801 2265 -672 2347 C ATOM 13811 O ASP A1001 -0.686 3.573 -34.671 1.00 98.91 O ANISOU13811 O ASP A1001 11406 14012 12164 2322 -638 2281 O ATOM 13812 CB ASP A1001 -3.813 2.876 -34.220 1.00102.51 C ANISOU13812 CB ASP A1001 11613 14689 12647 2411 -668 2388 C ATOM 13813 CG ASP A1001 -3.877 4.016 -33.221 1.00113.35 C ANISOU13813 CG ASP A1001 12950 15949 14168 2560 -625 2322 C ATOM 13814 OD1 ASP A1001 -2.829 4.633 -32.939 1.00115.13 O ANISOU13814 OD1 ASP A1001 13253 16053 14438 2585 -599 2253 O ATOM 13815 OD2 ASP A1001 -4.986 4.296 -32.721 1.00125.90 O ANISOU13815 OD2 ASP A1001 14430 17574 15832 2654 -619 2335 O ATOM 13816 H ASP A1001 -4.038 1.905 -36.425 1.00106.08 H ATOM 13817 HA ASP A1001 -2.961 4.153 -35.588 1.00112.91 H ATOM 13818 HB2 ASP A1001 -4.716 2.693 -34.524 1.00123.01 H ATOM 13819 HB3 ASP A1001 -3.452 2.099 -33.765 1.00123.01 H ATOM 13820 N ILE A1002 -1.175 1.529 -35.498 1.00 83.82 N ANISOU13820 N ILE A1002 9497 12317 10035 2151 -671 2318 N ATOM 13821 CA ILE A1002 0.196 1.027 -35.438 1.00 79.80 C ANISOU13821 CA ILE A1002 9099 11774 9447 2082 -634 2218 C ATOM 13822 C ILE A1002 0.990 1.586 -36.608 1.00 81.28 C ANISOU13822 C ILE A1002 9342 11921 9620 2016 -677 2291 C ATOM 13823 O ILE A1002 2.122 2.040 -36.445 1.00 79.95 O ANISOU13823 O ILE A1002 9244 11659 9474 2018 -646 2231 O ATOM 13824 CB ILE A1002 0.229 -0.517 -35.486 1.00 76.00 C ANISOU13824 CB ILE A1002 8646 11404 8828 1982 -629 2166 C ATOM 13825 CG1 ILE A1002 -0.268 -1.090 -34.161 1.00 77.47 C ANISOU13825 CG1 ILE A1002 8795 11616 9022 2040 -574 2077 C ATOM 13826 CG2 ILE A1002 1.639 -1.034 -35.753 1.00 70.00 C ANISOU13826 CG2 ILE A1002 7995 10617 7983 1899 -609 2083 C ATOM 13827 CD1 ILE A1002 -0.599 -2.571 -34.210 1.00 74.81 C ANISOU13827 CD1 ILE A1002 8459 11392 8573 1948 -584 2058 C ATOM 13828 H ILE A1002 -1.746 0.943 -35.765 1.00100.59 H ATOM 13829 HA ILE A1002 0.613 1.320 -34.613 1.00 95.76 H ATOM 13830 HB ILE A1002 -0.356 -0.820 -36.198 1.00 91.20 H ATOM 13831 HG12 ILE A1002 0.420 -0.963 -33.489 1.00 92.96 H ATOM 13832 HG13 ILE A1002 -1.073 -0.616 -33.899 1.00 92.96 H ATOM 13833 HG21 ILE A1002 1.620 -2.003 -35.776 1.00 84.00 H ATOM 13834 HG22 ILE A1002 1.945 -0.688 -36.606 1.00 84.00 H ATOM 13835 HG23 ILE A1002 2.225 -0.731 -35.042 1.00 84.00 H ATOM 13836 HD11 ILE A1002 -0.905 -2.855 -33.335 1.00 89.77 H ATOM 13837 HD12 ILE A1002 -1.296 -2.717 -34.868 1.00 89.77 H ATOM 13838 HD13 ILE A1002 0.199 -3.064 -34.458 1.00 89.77 H ATOM 13839 N LEU A1003 0.379 1.555 -37.786 1.00 84.10 N ANISOU13839 N LEU A1003 9662 12356 9937 1955 -749 2426 N ATOM 13840 CA LEU A1003 1.033 1.977 -39.016 1.00 79.55 C ANISOU13840 CA LEU A1003 9131 11772 9321 1875 -794 2513 C ATOM 13841 C LEU A1003 1.368 3.466 -38.976 1.00 84.86 C ANISOU13841 C LEU A1003 9804 12307 10132 1949 -801 2566 C ATOM 13842 O LEU A1003 2.336 3.905 -39.590 1.00 83.15 O ANISOU13842 O LEU A1003 9649 12045 9900 1894 -808 2591 O ATOM 13843 CB LEU A1003 0.123 1.664 -40.204 1.00 80.37 C ANISOU13843 CB LEU A1003 9182 12000 9356 1803 -876 2653 C ATOM 13844 CG LEU A1003 0.718 1.651 -41.612 1.00 81.05 C ANISOU13844 CG LEU A1003 9316 12141 9340 1685 -925 2737 C ATOM 13845 CD1 LEU A1003 2.102 1.034 -41.618 1.00 81.61 C ANISOU13845 CD1 LEU A1003 9486 12206 9315 1610 -873 2616 C ATOM 13846 CD2 LEU A1003 -0.209 0.883 -42.548 1.00 77.52 C ANISOU13846 CD2 LEU A1003 8821 11845 8789 1605 -995 2824 C ATOM 13847 H LEU A1003 -0.431 1.288 -37.901 1.00100.92 H ATOM 13848 HA LEU A1003 1.860 1.482 -39.126 1.00 95.45 H ATOM 13849 HB2 LEU A1003 -0.262 0.786 -40.056 1.00 96.45 H ATOM 13850 HB3 LEU A1003 -0.590 2.322 -40.210 1.00 96.45 H ATOM 13851 HG LEU A1003 0.790 2.562 -41.937 1.00 97.26 H ATOM 13852 HD11 LEU A1003 2.447 1.043 -42.525 1.00 97.93 H ATOM 13853 HD12 LEU A1003 2.681 1.554 -41.039 1.00 97.93 H ATOM 13854 HD13 LEU A1003 2.042 0.122 -41.295 1.00 97.93 H ATOM 13855 HD21 LEU A1003 0.174 0.878 -43.439 1.00 93.03 H ATOM 13856 HD22 LEU A1003 -0.303 -0.027 -42.223 1.00 93.03 H ATOM 13857 HD23 LEU A1003 -1.075 1.319 -42.562 1.00 93.03 H ATOM 13858 N SER A1004 0.561 4.227 -38.237 1.00 95.14 N ANISOU13858 N SER A1004 11034 13543 11571 2073 -799 2578 N ATOM 13859 CA SER A1004 0.761 5.667 -38.050 1.00 93.16 C ANISOU13859 CA SER A1004 10774 13143 11477 2162 -809 2616 C ATOM 13860 C SER A1004 2.076 5.995 -37.339 1.00 91.91 C ANISOU13860 C SER A1004 10701 12867 11353 2180 -746 2488 C ATOM 13861 O SER A1004 2.496 7.152 -37.292 1.00 87.42 O ANISOU13861 O SER A1004 10144 12166 10905 2230 -756 2513 O ATOM 13862 CB SER A1004 -0.413 6.261 -37.262 1.00 92.04 C ANISOU13862 CB SER A1004 10532 12965 11473 2302 -811 2622 C ATOM 13863 OG SER A1004 0.002 7.361 -36.471 1.00 97.23 O ANISOU13863 OG SER A1004 11199 13465 12279 2409 -783 2559 O ATOM 13864 H SER A1004 -0.129 3.924 -37.821 1.00114.17 H ATOM 13865 HA SER A1004 0.780 6.095 -38.921 1.00111.79 H ATOM 13866 HB2 SER A1004 -1.091 6.560 -37.887 1.00110.44 H ATOM 13867 HB3 SER A1004 -0.779 5.576 -36.680 1.00110.44 H ATOM 13868 HG SER A1004 0.321 7.963 -36.962 1.00116.68 H ATOM 13869 N GLU A1005 2.720 4.977 -36.782 1.00106.31 N ANISOU13869 N GLU A1005 12581 14736 13076 2138 -685 2353 N ATOM 13870 CA GLU A1005 4.018 5.157 -36.142 1.00105.44 C ANISOU13870 CA GLU A1005 12551 14528 12981 2143 -628 2228 C ATOM 13871 C GLU A1005 5.116 5.324 -37.185 1.00102.07 C ANISOU13871 C GLU A1005 12195 14089 12499 2035 -648 2279 C ATOM 13872 O GLU A1005 6.212 5.791 -36.873 1.00104.97 O ANISOU13872 O GLU A1005 12621 14358 12906 2037 -616 2211 O ATOM 13873 CB GLU A1005 4.347 3.957 -35.249 1.00 93.94 C ANISOU13873 CB GLU A1005 11131 13130 11433 2128 -564 2076 C ATOM 13874 CG GLU A1005 3.409 3.773 -34.063 1.00 93.18 C ANISOU13874 CG GLU A1005 10971 13050 11382 2231 -529 2010 C ATOM 13875 CD GLU A1005 3.557 4.862 -33.015 1.00 99.51 C ANISOU13875 CD GLU A1005 11763 13721 12327 2357 -494 1936 C ATOM 13876 OE1 GLU A1005 4.549 5.622 -33.071 1.00 98.73 O ANISOU13876 OE1 GLU A1005 11719 13507 12286 2359 -490 1912 O ATOM 13877 OE2 GLU A1005 2.677 4.957 -32.131 1.00102.32 O ANISOU13877 OE2 GLU A1005 12050 14089 12736 2454 -470 1897 O ATOM 13878 H GLU A1005 2.426 4.169 -36.761 1.00127.57 H ATOM 13879 HA GLU A1005 3.996 5.954 -35.589 1.00126.52 H ATOM 13880 HB2 GLU A1005 4.303 3.151 -35.786 1.00112.73 H ATOM 13881 HB3 GLU A1005 5.244 4.069 -34.899 1.00112.73 H ATOM 13882 HG2 GLU A1005 2.493 3.787 -34.381 1.00111.81 H ATOM 13883 HG3 GLU A1005 3.600 2.922 -33.640 1.00111.81 H ATOM 13884 N PHE A1006 4.813 4.942 -38.423 1.00 80.16 N ANISOU13884 N PHE A1006 9409 11421 9628 1939 -702 2397 N ATOM 13885 CA PHE A1006 5.821 4.873 -39.474 1.00 82.28 C ANISOU13885 CA PHE A1006 9740 11718 9806 1821 -715 2439 C ATOM 13886 C PHE A1006 5.687 5.981 -40.504 1.00 83.33 C ANISOU13886 C PHE A1006 9851 11815 9996 1798 -783 2614 C ATOM 13887 O PHE A1006 6.371 5.954 -41.516 1.00 85.40 O ANISOU13887 O PHE A1006 10151 12124 10171 1692 -801 2676 O ATOM 13888 CB PHE A1006 5.736 3.532 -40.218 1.00 83.29 C ANISOU13888 CB PHE A1006 9881 12009 9757 1709 -726 2433 C ATOM 13889 CG PHE A1006 6.122 2.336 -39.390 1.00 81.10 C ANISOU13889 CG PHE A1006 9640 11767 9408 1702 -667 2266 C ATOM 13890 CD1 PHE A1006 7.430 1.887 -39.362 1.00 68.09 C ANISOU13890 CD1 PHE A1006 8068 10109 7692 1643 -623 2159 C ATOM 13891 CD2 PHE A1006 5.168 1.646 -38.660 1.00 84.42 C ANISOU13891 CD2 PHE A1006 10016 12234 9827 1752 -659 2222 C ATOM 13892 CE1 PHE A1006 7.780 0.785 -38.612 1.00 66.73 C ANISOU13892 CE1 PHE A1006 7929 9964 7462 1638 -577 2013 C ATOM 13893 CE2 PHE A1006 5.513 0.541 -37.909 1.00 75.07 C ANISOU13893 CE2 PHE A1006 8866 11079 8579 1740 -611 2083 C ATOM 13894 CZ PHE A1006 6.821 0.113 -37.884 1.00 71.10 C ANISOU13894 CZ PHE A1006 8442 10557 8017 1685 -573 1979 C ATOM 13895 H PHE A1006 4.024 4.716 -38.681 1.00 96.20 H ATOM 13896 HA PHE A1006 6.702 4.940 -39.073 1.00 98.74 H ATOM 13897 HB2 PHE A1006 4.823 3.401 -40.518 1.00 99.95 H ATOM 13898 HB3 PHE A1006 6.331 3.563 -40.984 1.00 99.95 H ATOM 13899 HD1 PHE A1006 8.081 2.337 -39.850 1.00 81.70 H ATOM 13900 HD2 PHE A1006 4.283 1.933 -38.674 1.00101.31 H ATOM 13901 HE1 PHE A1006 8.663 0.495 -38.596 1.00 80.08 H ATOM 13902 HE2 PHE A1006 4.865 0.089 -37.418 1.00 90.09 H ATOM 13903 HZ PHE A1006 7.057 -0.631 -37.378 1.00 85.33 H ATOM 13904 N SER A1007 4.807 6.947 -40.268 1.00 92.80 N ANISOU13904 N SER A1007 10986 12935 11340 1897 -822 2697 N ATOM 13905 CA SER A1007 4.502 7.936 -41.300 1.00103.13 C ANISOU13905 CA SER A1007 12264 14216 12704 1875 -901 2886 C ATOM 13906 C SER A1007 5.342 9.199 -41.172 1.00103.46 C ANISOU13906 C SER A1007 12339 14091 12879 1903 -902 2909 C ATOM 13907 O SER A1007 5.398 10.010 -42.097 1.00108.33 O ANISOU13907 O SER A1007 12951 14679 13532 1860 -965 3068 O ATOM 13908 CB SER A1007 3.018 8.292 -41.273 1.00104.99 C ANISOU13908 CB SER A1007 12403 14461 13027 1961 -959 2983 C ATOM 13909 OG SER A1007 2.588 8.607 -39.958 1.00103.79 O ANISOU13909 OG SER A1007 12214 14215 13006 2100 -918 2876 O ATOM 13910 H SER A1007 4.378 7.053 -39.531 1.00111.36 H ATOM 13911 HA SER A1007 4.694 7.545 -42.167 1.00123.76 H ATOM 13912 HB2 SER A1007 2.869 9.061 -41.845 1.00125.99 H ATOM 13913 HB3 SER A1007 2.507 7.534 -41.598 1.00125.99 H ATOM 13914 HG SER A1007 1.771 8.800 -39.962 1.00124.55 H ATOM 13915 N SER A1008 5.983 9.368 -40.021 1.00102.92 N ANISOU13915 N SER A1008 12304 13913 12886 1972 -837 2755 N ATOM 13916 CA SER A1008 6.902 10.479 -39.820 1.00100.73 C ANISOU13916 CA SER A1008 12066 13474 12733 1991 -833 2753 C ATOM 13917 C SER A1008 8.024 10.415 -40.853 1.00107.39 C ANISOU13917 C SER A1008 12970 14360 13472 1848 -837 2815 C ATOM 13918 O SER A1008 8.375 11.423 -41.464 1.00119.01 O ANISOU13918 O SER A1008 14447 15750 15019 1817 -882 2939 O ATOM 13919 CB SER A1008 7.501 10.442 -38.410 1.00 92.32 C ANISOU13919 CB SER A1008 11034 12314 11730 2072 -757 2554 C ATOM 13920 OG SER A1008 6.502 10.273 -37.418 1.00 98.42 O ANISOU13920 OG SER A1008 11751 13085 12561 2192 -738 2476 O ATOM 13921 H SER A1008 5.903 8.850 -39.339 1.00123.50 H ATOM 13922 HA SER A1008 6.427 11.318 -39.932 1.00120.88 H ATOM 13923 HB2 SER A1008 8.124 9.701 -38.354 1.00110.79 H ATOM 13924 HB3 SER A1008 7.967 11.276 -38.245 1.00110.79 H ATOM 13925 HG SER A1008 6.854 10.255 -36.656 1.00118.11 H ATOM 13926 N LYS A1009 8.560 9.216 -41.062 1.00 93.51 N ANISOU13926 N LYS A1009 11253 12735 11541 1759 -791 2731 N ATOM 13927 CA LYS A1009 9.739 9.018 -41.901 1.00 94.87 C ANISOU13927 CA LYS A1009 11483 12962 11602 1628 -777 2749 C ATOM 13928 C LYS A1009 9.436 9.043 -43.407 1.00101.84 C ANISOU13928 C LYS A1009 12347 13964 12382 1519 -842 2935 C ATOM 13929 O LYS A1009 10.196 8.494 -44.209 1.00103.73 O ANISOU13929 O LYS A1009 12623 14313 12475 1400 -825 2937 O ATOM 13930 CB LYS A1009 10.432 7.702 -41.521 1.00 99.16 C ANISOU13930 CB LYS A1009 12072 13597 12005 1583 -705 2575 C ATOM 13931 CG LYS A1009 11.235 7.754 -40.217 1.00101.45 C ANISOU13931 CG LYS A1009 12401 13771 12373 1652 -637 2397 C ATOM 13932 CD LYS A1009 12.476 8.640 -40.341 1.00105.47 C ANISOU13932 CD LYS A1009 12952 14173 12948 1613 -624 2405 C ATOM 13933 CE LYS A1009 13.185 8.828 -39.004 1.00105.14 C ANISOU13933 CE LYS A1009 12943 14005 13001 1692 -568 2235 C ATOM 13934 NZ LYS A1009 14.139 7.732 -38.657 1.00 96.01 N ANISOU13934 NZ LYS A1009 11835 12917 11728 1644 -504 2077 N ATOM 13935 H LYS A1009 8.253 8.487 -40.722 1.00112.21 H ATOM 13936 HA LYS A1009 10.364 9.738 -41.721 1.00113.84 H ATOM 13937 HB2 LYS A1009 9.756 7.014 -41.422 1.00118.99 H ATOM 13938 HB3 LYS A1009 11.044 7.458 -42.233 1.00118.99 H ATOM 13939 HG2 LYS A1009 10.675 8.116 -39.512 1.00121.74 H ATOM 13940 HG3 LYS A1009 11.526 6.858 -39.986 1.00121.74 H ATOM 13941 HD2 LYS A1009 13.100 8.228 -40.959 1.00126.56 H ATOM 13942 HD3 LYS A1009 12.210 9.514 -40.668 1.00126.56 H ATOM 13943 HE2 LYS A1009 13.687 9.658 -39.032 1.00126.17 H ATOM 13944 HE3 LYS A1009 12.518 8.872 -38.301 1.00126.17 H ATOM 13945 HZ1 LYS A1009 13.706 6.955 -38.611 1.00115.22 H ATOM 13946 HZ2 LYS A1009 14.773 7.673 -39.278 1.00115.22 H ATOM 13947 HZ3 LYS A1009 14.519 7.898 -37.870 1.00115.22 H ATOM 13948 N LEU A1010 8.333 9.688 -43.786 1.00120.95 N ANISOU13948 N LEU A1010 14708 16368 14881 1562 -917 3088 N ATOM 13949 CA LEU A1010 7.991 9.899 -45.195 1.00128.18 C ANISOU13949 CA LEU A1010 15602 17383 15717 1467 -992 3286 C ATOM 13950 C LEU A1010 8.296 11.337 -45.633 1.00129.17 C ANISOU13950 C LEU A1010 15725 17378 15975 1460 -1046 3445 C ATOM 13951 O LEU A1010 8.775 12.150 -44.838 1.00118.40 O ANISOU13951 O LEU A1010 14377 15842 14768 1531 -1025 3392 O ATOM 13952 CB LEU A1010 6.502 9.606 -45.430 1.00114.88 C ANISOU13952 CB LEU A1010 13846 15780 14023 1510 -1053 3368 C ATOM 13953 CG LEU A1010 6.014 8.154 -45.411 1.00101.57 C ANISOU13953 CG LEU A1010 12151 14257 12182 1481 -1028 3271 C ATOM 13954 CD1 LEU A1010 4.503 8.124 -45.295 1.00105.43 C ANISOU13954 CD1 LEU A1010 12557 14775 12724 1559 -1084 3339 C ATOM 13955 CD2 LEU A1010 6.456 7.409 -46.658 1.00 95.60 C ANISOU13955 CD2 LEU A1010 11427 13677 11222 1329 -1040 3317 C ATOM 13956 H LEU A1010 7.758 10.019 -43.238 1.00145.15 H ATOM 13957 HA LEU A1010 8.512 9.294 -45.747 1.00153.82 H ATOM 13958 HB2 LEU A1010 5.999 10.076 -44.747 1.00137.86 H ATOM 13959 HB3 LEU A1010 6.264 9.967 -46.298 1.00137.86 H ATOM 13960 HG LEU A1010 6.387 7.701 -44.638 1.00121.88 H ATOM 13961 HD11 LEU A1010 4.206 7.201 -45.284 1.00126.51 H ATOM 13962 HD12 LEU A1010 4.241 8.566 -44.472 1.00126.51 H ATOM 13963 HD13 LEU A1010 4.119 8.587 -46.056 1.00126.51 H ATOM 13964 HD21 LEU A1010 6.131 6.496 -46.611 1.00114.73 H ATOM 13965 HD22 LEU A1010 6.088 7.853 -47.437 1.00114.73 H ATOM 13966 HD23 LEU A1010 7.425 7.414 -46.701 1.00114.73 H ATOM 13967 N LEU A1011 8.026 11.633 -46.903 1.00138.69 N ANISOU13967 N LEU A1011 16912 18669 17115 1371 -1119 3641 N ATOM 13968 CA LEU A1011 8.024 13.004 -47.404 1.00144.34 C ANISOU13968 CA LEU A1011 17611 19266 17965 1368 -1193 3831 C ATOM 13969 C LEU A1011 6.668 13.274 -48.037 1.00145.84 C ANISOU13969 C LEU A1011 17730 19502 18179 1395 -1293 4008 C ATOM 13970 O LEU A1011 6.024 12.358 -48.550 1.00139.21 O ANISOU13970 O LEU A1011 16868 18834 17191 1353 -1308 4019 O ATOM 13971 CB LEU A1011 9.148 13.232 -48.419 1.00154.18 C ANISOU13971 CB LEU A1011 18904 20571 19108 1216 -1191 3927 C ATOM 13972 CG LEU A1011 9.159 14.598 -49.125 1.00155.46 C ANISOU13972 CG LEU A1011 19050 20631 19386 1185 -1278 4158 C ATOM 13973 CD1 LEU A1011 9.237 15.763 -48.134 1.00150.22 C ANISOU13973 CD1 LEU A1011 18382 19711 18983 1307 -1290 4135 C ATOM 13974 CD2 LEU A1011 10.312 14.681 -50.115 1.00151.93 C ANISOU13974 CD2 LEU A1011 18647 20272 18809 1022 -1263 4242 C ATOM 13975 H LEU A1011 7.838 11.046 -47.504 1.00166.43 H ATOM 13976 HA LEU A1011 8.147 13.619 -46.664 1.00173.20 H ATOM 13977 HB2 LEU A1011 9.997 13.138 -47.960 1.00185.02 H ATOM 13978 HB3 LEU A1011 9.078 12.553 -49.108 1.00185.02 H ATOM 13979 HG LEU A1011 8.334 14.694 -49.626 1.00186.55 H ATOM 13980 HD11 LEU A1011 9.241 16.597 -48.629 1.00180.26 H ATOM 13981 HD12 LEU A1011 8.465 15.729 -47.547 1.00180.26 H ATOM 13982 HD13 LEU A1011 10.052 15.681 -47.615 1.00180.26 H ATOM 13983 HD21 LEU A1011 10.297 15.550 -50.545 1.00182.32 H ATOM 13984 HD22 LEU A1011 11.147 14.563 -49.636 1.00182.32 H ATOM 13985 HD23 LEU A1011 10.209 13.981 -50.778 1.00182.32 H ATOM 13986 N ARG A1012 6.245 14.533 -47.992 1.00157.11 N ANISOU13986 N ARG A1012 19123 20771 19802 1466 -1366 4142 N ATOM 13987 CA ARG A1012 4.921 14.931 -48.451 1.00159.70 C ANISOU13987 CA ARG A1012 19375 21110 20194 1516 -1468 4307 C ATOM 13988 C ARG A1012 4.627 14.418 -49.862 1.00165.05 C ANISOU13988 C ARG A1012 20042 21997 20673 1380 -1526 4465 C ATOM 13989 O ARG A1012 3.489 14.053 -50.169 1.00164.65 O ANISOU13989 O ARG A1012 19932 22043 20587 1405 -1581 4527 O ATOM 13990 CB ARG A1012 4.773 16.454 -48.381 1.00158.44 C ANISOU13990 CB ARG A1012 19189 20739 20271 1587 -1546 4447 C ATOM 13991 CG ARG A1012 5.213 17.058 -47.045 1.00165.66 C ANISOU13991 CG ARG A1012 20122 21440 21383 1710 -1491 4287 C ATOM 13992 CD ARG A1012 4.110 17.896 -46.396 1.00178.57 C ANISOU13992 CD ARG A1012 21682 22919 23249 1878 -1552 4312 C ATOM 13993 NE ARG A1012 3.195 17.092 -45.580 1.00178.42 N ANISOU13993 NE ARG A1012 21613 22969 23210 1982 -1508 4163 N ATOM 13994 CZ ARG A1012 3.256 16.980 -44.253 1.00173.30 C ANISOU13994 CZ ARG A1012 20966 22234 22646 2098 -1431 3955 C ATOM 13995 NH1 ARG A1012 4.191 17.619 -43.555 1.00171.04 N ANISOU13995 NH1 ARG A1012 20730 21782 22476 2130 -1391 3859 N ATOM 13996 NH2 ARG A1012 2.374 16.223 -43.613 1.00167.29 N ANISOU13996 NH2 ARG A1012 20154 21557 21852 2179 -1395 3845 N ATOM 13997 H ARG A1012 6.717 15.187 -47.694 1.00188.53 H ATOM 13998 HA ARG A1012 4.260 14.545 -47.855 1.00191.64 H ATOM 13999 HB2 ARG A1012 5.315 16.853 -49.079 1.00190.13 H ATOM 14000 HB3 ARG A1012 3.841 16.684 -48.517 1.00190.13 H ATOM 14001 HG2 ARG A1012 5.447 16.342 -46.434 1.00198.80 H ATOM 14002 HG3 ARG A1012 5.980 17.633 -47.194 1.00198.80 H ATOM 14003 HD2 ARG A1012 4.517 18.563 -45.821 1.00214.29 H ATOM 14004 HD3 ARG A1012 3.591 18.329 -47.091 1.00214.29 H ATOM 14005 HE ARG A1012 2.572 16.662 -45.988 1.00214.11 H ATOM 14006 HH11 ARG A1012 4.767 18.112 -43.960 1.00205.25 H ATOM 14007 HH12 ARG A1012 4.219 17.538 -42.699 1.00205.25 H ATOM 14008 HH21 ARG A1012 1.765 15.806 -44.054 1.00200.75 H ATOM 14009 HH22 ARG A1012 2.411 16.149 -42.757 1.00200.75 H ATOM 14010 N GLN A1013 5.658 14.375 -50.705 1.00156.33 N ANISOU14010 N GLN A1013 18993 20971 19435 1236 -1511 4524 N ATOM 14011 CA GLN A1013 5.540 13.805 -52.047 1.00153.62 C ANISOU14011 CA GLN A1013 18648 20848 18873 1095 -1552 4649 C ATOM 14012 C GLN A1013 5.082 12.353 -51.938 1.00147.51 C ANISOU14012 C GLN A1013 17866 20248 17931 1087 -1508 4500 C ATOM 14013 O GLN A1013 4.052 11.964 -52.499 1.00136.94 O ANISOU14013 O GLN A1013 16477 19031 16522 1077 -1573 4584 O ATOM 14014 CB GLN A1013 6.886 13.852 -52.780 1.00162.00 C ANISOU14014 CB GLN A1013 19773 21976 19805 945 -1513 4682 C ATOM 14015 CG GLN A1013 7.528 15.230 -52.865 1.00175.61 C ANISOU14015 CG GLN A1013 21511 23525 21687 933 -1547 4820 C ATOM 14016 CD GLN A1013 8.906 15.193 -53.510 1.00179.73 C ANISOU14016 CD GLN A1013 22090 24125 22073 783 -1495 4834 C ATOM 14017 OE1 GLN A1013 9.665 14.237 -53.330 1.00166.71 O ANISOU14017 OE1 GLN A1013 20481 22578 20283 735 -1398 4655 O ATOM 14018 NE2 GLN A1013 9.232 16.233 -54.272 1.00178.21 N ANISOU14018 NE2 GLN A1013 21897 23887 21926 705 -1560 5051 N ATOM 14019 H GLN A1013 6.444 14.673 -50.523 1.00187.60 H ATOM 14020 HA GLN A1013 4.885 14.303 -52.561 1.00184.35 H ATOM 14021 HB2 GLN A1013 7.508 13.268 -52.319 1.00194.40 H ATOM 14022 HB3 GLN A1013 6.754 13.535 -53.687 1.00194.40 H ATOM 14023 HG2 GLN A1013 6.963 15.811 -53.399 1.00210.73 H ATOM 14024 HG3 GLN A1013 7.625 15.591 -51.970 1.00210.73 H ATOM 14025 HE21 GLN A1013 8.675 16.880 -54.378 1.00213.85 H ATOM 14026 HE22 GLN A1013 10.000 16.259 -54.658 1.00213.85 H ATOM 14027 N ASP A1014 5.867 11.570 -51.197 1.00144.49 N ANISOU14027 N ASP A1014 17533 19871 17495 1090 -1401 4280 N ATOM 14028 CA ASP A1014 5.587 10.156 -50.958 1.00131.06 C ANISOU14028 CA ASP A1014 15835 18311 15651 1083 -1351 4116 C ATOM 14029 C ASP A1014 4.361 9.966 -50.065 1.00126.80 C ANISOU14029 C ASP A1014 15234 17718 15226 1220 -1366 4059 C ATOM 14030 O ASP A1014 3.631 8.984 -50.213 1.00122.82 O ANISOU14030 O ASP A1014 14703 17350 14615 1207 -1376 4018 O ATOM 14031 CB ASP A1014 6.797 9.469 -50.313 1.00126.23 C ANISOU14031 CB ASP A1014 15291 17692 14979 1060 -1237 3901 C ATOM 14032 CG ASP A1014 8.029 9.478 -51.205 1.00134.04 C ANISOU14032 CG ASP A1014 16333 18764 15832 919 -1210 3934 C ATOM 14033 OD1 ASP A1014 8.082 8.678 -52.161 1.00127.37 O ANISOU14033 OD1 ASP A1014 15495 18113 14786 808 -1217 3949 O ATOM 14034 OD2 ASP A1014 8.959 10.266 -50.933 1.00142.95 O ANISOU14034 OD2 ASP A1014 17493 19767 17053 917 -1180 3936 O ATOM 14035 H ASP A1014 6.586 11.843 -50.813 1.00173.39 H ATOM 14036 HA ASP A1014 5.411 9.721 -51.807 1.00157.27 H ATOM 14037 HB2 ASP A1014 7.020 9.931 -49.490 1.00151.48 H ATOM 14038 HB3 ASP A1014 6.571 8.545 -50.124 1.00151.48 H ATOM 14039 N LYS A1015 4.136 10.898 -49.139 1.00104.62 N ANISOU14039 N LYS A1015 12402 14715 12633 1349 -1368 4051 N ATOM 14040 CA LYS A1015 2.971 10.831 -48.262 1.00 98.24 C ANISOU14040 CA LYS A1015 11527 13856 11944 1486 -1379 4000 C ATOM 14041 C LYS A1015 1.692 10.813 -49.079 1.00105.40 C ANISOU14041 C LYS A1015 12358 14868 12823 1478 -1480 4166 C ATOM 14042 O LYS A1015 0.762 10.069 -48.770 1.00105.59 O ANISOU14042 O LYS A1015 12332 14971 12818 1521 -1481 4110 O ATOM 14043 CB LYS A1015 2.930 12.014 -47.297 1.00 95.62 C ANISOU14043 CB LYS A1015 11177 13300 11856 1624 -1378 3987 C ATOM 14044 CG LYS A1015 3.856 11.892 -46.103 1.00100.40 C ANISOU14044 CG LYS A1015 11838 13798 12514 1676 -1275 3778 C ATOM 14045 CD LYS A1015 3.406 12.824 -44.990 1.00107.41 C ANISOU14045 CD LYS A1015 12684 14493 13633 1839 -1276 3733 C ATOM 14046 CE LYS A1015 4.310 12.760 -43.771 1.00107.74 C ANISOU14046 CE LYS A1015 12779 14428 13729 1893 -1179 3525 C ATOM 14047 NZ LYS A1015 5.609 13.444 -43.984 1.00104.40 N ANISOU14047 NZ LYS A1015 12425 13904 13339 1829 -1166 3542 N ATOM 14048 H LYS A1015 4.643 11.578 -49.000 1.00125.54 H ATOM 14049 HA LYS A1015 3.010 10.015 -47.740 1.00117.89 H ATOM 14050 HB2 LYS A1015 3.181 12.817 -47.781 1.00114.75 H ATOM 14051 HB3 LYS A1015 2.026 12.106 -46.959 1.00114.75 H ATOM 14052 HG2 LYS A1015 3.835 10.981 -45.768 1.00120.49 H ATOM 14053 HG3 LYS A1015 4.757 12.137 -46.364 1.00120.49 H ATOM 14054 HD2 LYS A1015 3.411 13.736 -45.320 1.00128.89 H ATOM 14055 HD3 LYS A1015 2.510 12.577 -44.713 1.00128.89 H ATOM 14056 HE2 LYS A1015 3.864 13.188 -43.023 1.00129.29 H ATOM 14057 HE3 LYS A1015 4.491 11.830 -43.561 1.00129.29 H ATOM 14058 HZ1 LYS A1015 6.108 13.384 -43.250 1.00125.28 H ATOM 14059 HZ2 LYS A1015 6.044 13.065 -44.662 1.00125.28 H ATOM 14060 HZ3 LYS A1015 5.472 14.303 -44.172 1.00125.28 H ATOM 14061 N ARG A1016 1.646 11.631 -50.124 1.00124.75 N ANISOU14061 N ARG A1016 14797 17321 15282 1419 -1568 4377 N ATOM 14062 CA ARG A1016 0.465 11.680 -50.969 1.00127.45 C ANISOU14062 CA ARG A1016 15066 17764 15597 1406 -1675 4551 C ATOM 14063 C ARG A1016 0.470 10.547 -51.993 1.00123.00 C ANISOU14063 C ARG A1016 14519 17436 14778 1263 -1685 4564 C ATOM 14064 O ARG A1016 -0.587 10.138 -52.468 1.00125.15 O ANISOU14064 O ARG A1016 14730 17825 14995 1255 -1752 4637 O ATOM 14065 CB ARG A1016 0.313 13.035 -51.662 1.00132.97 C ANISOU14065 CB ARG A1016 15739 18366 16416 1406 -1778 4786 C ATOM 14066 CG ARG A1016 -1.134 13.304 -52.067 1.00136.77 C ANISOU14066 CG ARG A1016 16122 18883 16961 1462 -1890 4942 C ATOM 14067 CD ARG A1016 -1.341 14.669 -52.702 1.00148.31 C ANISOU14067 CD ARG A1016 17557 20231 18563 1469 -1998 5168 C ATOM 14068 NE ARG A1016 -1.367 15.742 -51.711 1.00160.89 N ANISOU14068 NE ARG A1016 19127 21582 20421 1621 -1999 5151 N ATOM 14069 CZ ARG A1016 -2.081 16.860 -51.823 1.00164.23 C ANISOU14069 CZ ARG A1016 19501 21860 21037 1688 -2080 5252 C ATOM 14070 NH1 ARG A1016 -2.851 17.073 -52.884 1.00159.49 N ANISOU14070 NH1 ARG A1016 18872 21332 20397 1617 -2165 5380 N ATOM 14071 NH2 ARG A1016 -2.032 17.772 -50.863 1.00167.18 N ANISOU14071 NH2 ARG A1016 19857 22015 21649 1830 -2076 5212 N ATOM 14072 H ARG A1016 2.279 12.163 -50.362 1.00149.70 H ATOM 14073 HA ARG A1016 -0.316 11.555 -50.407 1.00152.95 H ATOM 14074 HB2 ARG A1016 0.594 13.737 -51.054 1.00159.56 H ATOM 14075 HB3 ARG A1016 0.860 13.046 -52.463 1.00159.56 H ATOM 14076 HG2 ARG A1016 -1.410 12.632 -52.710 1.00164.13 H ATOM 14077 HG3 ARG A1016 -1.695 13.256 -51.277 1.00164.13 H ATOM 14078 HD2 ARG A1016 -0.615 14.845 -53.319 1.00177.97 H ATOM 14079 HD3 ARG A1016 -2.189 14.674 -53.174 1.00177.97 H ATOM 14080 HE ARG A1016 -0.886 15.645 -51.004 1.00193.06 H ATOM 14081 HH11 ARG A1016 -2.890 16.487 -53.512 1.00191.39 H ATOM 14082 HH12 ARG A1016 -3.309 17.799 -52.945 1.00191.39 H ATOM 14083 HH21 ARG A1016 -1.537 17.643 -50.171 1.00200.62 H ATOM 14084 HH22 ARG A1016 -2.493 18.495 -50.931 1.00200.62 H ATOM 14085 N THR A1017 1.651 10.037 -52.334 1.00120.33 N ANISOU14085 N THR A1017 14260 17170 14288 1150 -1620 4486 N ATOM 14086 CA THR A1017 1.732 8.828 -53.146 1.00115.94 C ANISOU14086 CA THR A1017 13725 16835 13490 1026 -1613 4446 C ATOM 14087 C THR A1017 1.073 7.709 -52.344 1.00119.58 C ANISOU14087 C THR A1017 14161 17341 13934 1087 -1571 4273 C ATOM 14088 O THR A1017 0.296 6.913 -52.877 1.00118.58 O ANISOU14088 O THR A1017 13998 17367 13690 1041 -1616 4292 O ATOM 14089 CB THR A1017 3.192 8.433 -53.464 1.00110.86 C ANISOU14089 CB THR A1017 13169 16249 12705 913 -1533 4353 C ATOM 14090 OG1 THR A1017 3.900 9.565 -53.980 1.00114.25 O ANISOU14090 OG1 THR A1017 13622 16605 13182 867 -1557 4501 O ATOM 14091 CG2 THR A1017 3.238 7.303 -54.489 1.00101.53 C ANISOU14091 CG2 THR A1017 12002 15302 11272 779 -1542 4333 C ATOM 14092 H THR A1017 2.412 10.369 -52.110 1.00144.39 H ATOM 14093 HA THR A1017 1.248 8.951 -53.977 1.00139.12 H ATOM 14094 HB THR A1017 3.625 8.126 -52.653 1.00133.04 H ATOM 14095 HG1 THR A1017 3.902 10.186 -53.414 1.00137.10 H ATOM 14096 HG21 THR A1017 4.159 7.066 -54.679 1.00121.83 H ATOM 14097 HG22 THR A1017 2.777 6.523 -54.144 1.00121.83 H ATOM 14098 HG23 THR A1017 2.809 7.585 -55.312 1.00121.83 H ATOM 14099 N VAL A1018 1.388 7.679 -51.050 1.00112.69 N ANISOU14099 N VAL A1018 13306 16332 13179 1187 -1488 4109 N ATOM 14100 CA VAL A1018 0.807 6.722 -50.110 1.00111.15 C ANISOU14100 CA VAL A1018 13086 16155 12991 1255 -1442 3946 C ATOM 14101 C VAL A1018 -0.693 6.946 -49.973 1.00107.42 C ANISOU14101 C VAL A1018 12514 15684 12617 1342 -1515 4040 C ATOM 14102 O VAL A1018 -1.477 5.996 -49.961 1.00 99.01 O ANISOU14102 O VAL A1018 11409 14733 11478 1332 -1527 3996 O ATOM 14103 CB VAL A1018 1.477 6.842 -48.713 1.00111.06 C ANISOU14103 CB VAL A1018 13112 15985 13099 1351 -1343 3770 C ATOM 14104 CG1 VAL A1018 0.517 6.431 -47.585 1.00112.83 C ANISOU14104 CG1 VAL A1018 13278 16178 13415 1469 -1319 3669 C ATOM 14105 CG2 VAL A1018 2.755 6.020 -48.658 1.00 99.26 C ANISOU14105 CG2 VAL A1018 11706 14537 11473 1267 -1258 3614 C ATOM 14106 H VAL A1018 1.951 8.216 -50.684 1.00135.23 H ATOM 14107 HA VAL A1018 0.952 5.821 -50.440 1.00133.38 H ATOM 14108 HB VAL A1018 1.720 7.770 -48.566 1.00133.27 H ATOM 14109 HG11 VAL A1018 0.974 6.521 -46.734 1.00135.40 H ATOM 14110 HG12 VAL A1018 -0.261 7.010 -47.606 1.00135.40 H ATOM 14111 HG13 VAL A1018 0.248 5.509 -47.720 1.00135.40 H ATOM 14112 HG21 VAL A1018 3.152 6.112 -47.778 1.00119.12 H ATOM 14113 HG22 VAL A1018 2.539 5.090 -48.829 1.00119.12 H ATOM 14114 HG23 VAL A1018 3.369 6.347 -49.335 1.00119.12 H ATOM 14115 N TYR A1019 -1.077 8.212 -49.853 1.00109.17 N ANISOU14115 N TYR A1019 12692 15773 13016 1429 -1566 4167 N ATOM 14116 CA TYR A1019 -2.477 8.595 -49.758 1.00110.04 C ANISOU14116 CA TYR A1019 12697 15871 13241 1521 -1642 4269 C ATOM 14117 C TYR A1019 -3.247 8.162 -51.001 1.00117.91 C ANISOU14117 C TYR A1019 13651 17049 14100 1426 -1740 4416 C ATOM 14118 O TYR A1019 -4.381 7.689 -50.909 1.00118.33 O ANISOU14118 O TYR A1019 13625 17177 14156 1461 -1777 4425 O ATOM 14119 CB TYR A1019 -2.591 10.106 -49.596 1.00106.06 C ANISOU14119 CB TYR A1019 12162 15187 12948 1618 -1690 4393 C ATOM 14120 CG TYR A1019 -3.924 10.554 -49.057 1.00115.38 C ANISOU14120 CG TYR A1019 13233 16310 14297 1757 -1739 4436 C ATOM 14121 CD1 TYR A1019 -5.067 10.493 -49.840 1.00123.75 C ANISOU14121 CD1 TYR A1019 14209 17478 15331 1742 -1842 4589 C ATOM 14122 CD2 TYR A1019 -4.039 11.040 -47.766 1.00119.46 C ANISOU14122 CD2 TYR A1019 13724 16669 14996 1906 -1683 4320 C ATOM 14123 CE1 TYR A1019 -6.290 10.902 -49.350 1.00128.60 C ANISOU14123 CE1 TYR A1019 14714 18045 16104 1873 -1886 4626 C ATOM 14124 CE2 TYR A1019 -5.254 11.453 -47.268 1.00122.88 C ANISOU14124 CE2 TYR A1019 14049 17057 15582 2038 -1722 4350 C ATOM 14125 CZ TYR A1019 -6.378 11.383 -48.061 1.00126.84 C ANISOU14125 CZ TYR A1019 14464 17667 16061 2022 -1823 4504 C ATOM 14126 OH TYR A1019 -7.592 11.795 -47.562 1.00126.76 O ANISOU14126 OH TYR A1019 14337 17616 16209 2158 -1861 4531 O ATOM 14127 H TYR A1019 -0.534 8.878 -49.823 1.00131.01 H ATOM 14128 HA TYR A1019 -2.878 8.170 -48.983 1.00132.04 H ATOM 14129 HB2 TYR A1019 -1.905 10.407 -48.980 1.00127.27 H ATOM 14130 HB3 TYR A1019 -2.464 10.524 -50.461 1.00127.27 H ATOM 14131 HD1 TYR A1019 -5.009 10.168 -50.710 1.00148.49 H ATOM 14132 HD2 TYR A1019 -3.283 11.089 -47.226 1.00143.35 H ATOM 14133 HE1 TYR A1019 -7.049 10.856 -49.885 1.00154.32 H ATOM 14134 HE2 TYR A1019 -5.316 11.777 -46.398 1.00147.45 H ATOM 14135 HH TYR A1019 -7.501 12.062 -46.771 1.00152.11 H ATOM 14136 N VAL A1020 -2.632 8.346 -52.165 1.00125.71 N ANISOU14136 N VAL A1020 14686 18112 14966 1302 -1781 4532 N ATOM 14137 CA VAL A1020 -3.210 7.883 -53.421 1.00122.79 C ANISOU14137 CA VAL A1020 14287 17933 14434 1193 -1871 4662 C ATOM 14138 C VAL A1020 -3.420 6.372 -53.383 1.00118.40 C ANISOU14138 C VAL A1020 13738 17534 13715 1133 -1834 4511 C ATOM 14139 O VAL A1020 -4.406 5.867 -53.920 1.00117.64 O ANISOU14139 O VAL A1020 13585 17558 13554 1098 -1898 4556 O ATOM 14140 CB VAL A1020 -2.321 8.272 -54.625 1.00122.24 C ANISOU14140 CB VAL A1020 14282 17923 14241 1055 -1898 4776 C ATOM 14141 CG1 VAL A1020 -2.644 7.429 -55.860 1.00119.57 C ANISOU14141 CG1 VAL A1020 13950 17789 13693 907 -1936 4783 C ATOM 14142 CG2 VAL A1020 -2.482 9.751 -54.941 1.00121.28 C ANISOU14142 CG2 VAL A1020 14141 17654 14285 1088 -1960 4940 C ATOM 14143 H VAL A1020 -1.872 8.739 -52.254 1.00150.85 H ATOM 14144 HA VAL A1020 -4.077 8.302 -53.542 1.00147.35 H ATOM 14145 HB VAL A1020 -1.392 8.116 -54.393 1.00146.69 H ATOM 14146 HG11 VAL A1020 -2.067 7.703 -56.589 1.00143.49 H ATOM 14147 HG12 VAL A1020 -2.493 6.493 -55.651 1.00143.49 H ATOM 14148 HG13 VAL A1020 -3.573 7.568 -56.102 1.00143.49 H ATOM 14149 HG21 VAL A1020 -1.917 9.975 -55.697 1.00145.53 H ATOM 14150 HG22 VAL A1020 -3.410 9.928 -55.157 1.00145.53 H ATOM 14151 HG23 VAL A1020 -2.217 10.270 -54.165 1.00145.53 H ATOM 14152 N TYR A1021 -2.499 5.654 -52.740 1.00127.34 N ANISOU14152 N TYR A1021 14943 18649 14793 1117 -1726 4313 N ATOM 14153 CA TYR A1021 -2.632 4.207 -52.600 1.00124.02 C ANISOU14153 CA TYR A1021 14534 18353 14237 1067 -1688 4158 C ATOM 14154 C TYR A1021 -3.695 3.836 -51.567 1.00121.99 C ANISOU14154 C TYR A1021 14202 18057 14091 1176 -1678 4087 C ATOM 14155 O TYR A1021 -4.317 2.778 -51.664 1.00115.57 O ANISOU14155 O TYR A1021 13360 17364 13187 1136 -1694 4032 O ATOM 14156 CB TYR A1021 -1.300 3.552 -52.227 1.00116.86 C ANISOU14156 CB TYR A1021 13724 17433 13244 1019 -1582 3972 C ATOM 14157 CG TYR A1021 -1.336 2.047 -52.386 1.00117.80 C ANISOU14157 CG TYR A1021 13863 17696 13201 939 -1562 3834 C ATOM 14158 CD1 TYR A1021 -1.206 1.460 -53.640 1.00127.02 C ANISOU14158 CD1 TYR A1021 15050 19038 14173 805 -1610 3872 C ATOM 14159 CD2 TYR A1021 -1.523 1.215 -51.291 1.00110.29 C ANISOU14159 CD2 TYR A1021 12909 16706 12290 997 -1501 3667 C ATOM 14160 CE1 TYR A1021 -1.249 0.087 -53.796 1.00123.10 C ANISOU14160 CE1 TYR A1021 14570 18664 13538 734 -1599 3738 C ATOM 14161 CE2 TYR A1021 -1.568 -0.161 -51.439 1.00110.73 C ANISOU14161 CE2 TYR A1021 12982 16880 12210 923 -1492 3547 C ATOM 14162 CZ TYR A1021 -1.430 -0.718 -52.694 1.00115.78 C ANISOU14162 CZ TYR A1021 13642 17682 12667 794 -1542 3578 C ATOM 14163 OH TYR A1021 -1.473 -2.084 -52.853 1.00115.68 O ANISOU14163 OH TYR A1021 13646 17777 12528 721 -1539 3450 O ATOM 14164 H TYR A1021 -1.791 5.981 -52.378 1.00152.81 H ATOM 14165 HA TYR A1021 -2.911 3.839 -53.453 1.00148.83 H ATOM 14166 HB2 TYR A1021 -0.603 3.899 -52.805 1.00140.23 H ATOM 14167 HB3 TYR A1021 -1.095 3.753 -51.301 1.00140.23 H ATOM 14168 HD1 TYR A1021 -1.084 2.001 -54.386 1.00152.42 H ATOM 14169 HD2 TYR A1021 -1.616 1.587 -50.444 1.00132.35 H ATOM 14170 HE1 TYR A1021 -1.157 -0.290 -54.641 1.00147.72 H ATOM 14171 HE2 TYR A1021 -1.689 -0.706 -50.696 1.00132.88 H ATOM 14172 HH TYR A1021 -1.377 -2.283 -53.663 1.00138.81 H ATOM 14173 N LEU A1022 -3.900 4.709 -50.584 1.00105.16 N ANISOU14173 N LEU A1022 12037 15761 12156 1312 -1651 4085 N ATOM 14174 CA LEU A1022 -4.905 4.480 -49.549 1.00102.21 C ANISOU14174 CA LEU A1022 11586 15353 11898 1424 -1634 4021 C ATOM 14175 C LEU A1022 -6.315 4.698 -50.093 1.00111.62 C ANISOU14175 C LEU A1022 12665 16618 13126 1446 -1742 4179 C ATOM 14176 O LEU A1022 -7.247 3.982 -49.723 1.00109.79 O ANISOU14176 O LEU A1022 12366 16456 12891 1469 -1748 4135 O ATOM 14177 CB LEU A1022 -4.660 5.401 -48.350 1.00 95.37 C ANISOU14177 CB LEU A1022 10715 14293 11227 1566 -1572 3962 C ATOM 14178 CG LEU A1022 -5.716 5.385 -47.239 1.00 83.95 C ANISOU14178 CG LEU A1022 9177 12804 9918 1698 -1551 3906 C ATOM 14179 CD1 LEU A1022 -5.852 3.999 -46.638 1.00 87.75 C ANISOU14179 CD1 LEU A1022 9665 13377 10300 1667 -1489 3748 C ATOM 14180 CD2 LEU A1022 -5.374 6.401 -46.163 1.00 74.53 C ANISOU14180 CD2 LEU A1022 7986 11421 8910 1833 -1495 3847 C ATOM 14181 H LEU A1022 -3.467 5.446 -50.493 1.00126.19 H ATOM 14182 HA LEU A1022 -4.840 3.562 -49.242 1.00122.66 H ATOM 14183 HB2 LEU A1022 -3.815 5.152 -47.946 1.00114.44 H ATOM 14184 HB3 LEU A1022 -4.602 6.313 -48.677 1.00114.44 H ATOM 14185 HG LEU A1022 -6.575 5.631 -47.618 1.00100.74 H ATOM 14186 HD11 LEU A1022 -6.525 4.022 -45.940 1.00105.30 H ATOM 14187 HD12 LEU A1022 -6.117 3.377 -47.334 1.00105.30 H ATOM 14188 HD13 LEU A1022 -4.997 3.732 -46.264 1.00105.30 H ATOM 14189 HD21 LEU A1022 -6.056 6.371 -45.473 1.00 89.43 H ATOM 14190 HD22 LEU A1022 -4.510 6.179 -45.784 1.00 89.43 H ATOM 14191 HD23 LEU A1022 -5.345 7.284 -46.561 1.00 89.43 H ATOM 14192 N GLU A1023 -6.466 5.687 -50.970 1.00137.78 N ANISOU14192 N GLU A1023 15957 19917 16475 1435 -1830 4367 N ATOM 14193 CA GLU A1023 -7.768 5.994 -51.559 1.00141.46 C ANISOU14193 CA GLU A1023 16327 20431 16990 1445 -1929 4500 C ATOM 14194 C GLU A1023 -8.285 4.857 -52.445 1.00135.08 C ANISOU14194 C GLU A1023 15514 19809 16002 1312 -1968 4484 C ATOM 14195 O GLU A1023 -9.481 4.782 -52.735 1.00139.74 O ANISOU14195 O GLU A1023 16023 20447 16626 1315 -2027 4531 O ATOM 14196 CB GLU A1023 -7.708 7.300 -52.359 1.00149.94 C ANISOU14196 CB GLU A1023 17409 21415 18147 1433 -1995 4656 C ATOM 14197 CG GLU A1023 -8.120 8.535 -51.561 1.00157.80 C ANISOU14197 CG GLU A1023 18345 22222 19390 1594 -2003 4698 C ATOM 14198 CD GLU A1023 -8.345 9.756 -52.438 1.00166.49 C ANISOU14198 CD GLU A1023 19437 23242 20580 1577 -2089 4862 C ATOM 14199 OE1 GLU A1023 -8.040 9.686 -53.648 1.00167.79 O ANISOU14199 OE1 GLU A1023 19650 23497 20606 1438 -2133 4946 O ATOM 14200 OE2 GLU A1023 -8.830 10.784 -51.917 1.00166.37 O ANISOU14200 OE2 GLU A1023 19366 23074 20773 1704 -2112 4902 O ATOM 14201 H GLU A1023 -5.829 6.197 -51.242 1.00165.33 H ATOM 14202 HA GLU A1023 -8.408 6.120 -50.842 1.00169.75 H ATOM 14203 HB2 GLU A1023 -6.799 7.436 -52.667 1.00179.93 H ATOM 14204 HB3 GLU A1023 -8.305 7.227 -53.120 1.00179.93 H ATOM 14205 HG2 GLU A1023 -8.949 8.347 -51.093 1.00189.36 H ATOM 14206 HG3 GLU A1023 -7.420 8.748 -50.925 1.00189.36 H ATOM 14207 N LYS A1024 -7.384 3.973 -52.865 1.00119.75 N ANISOU14207 N LYS A1024 13656 17972 13873 1198 -1937 4412 N ATOM 14208 CA LYS A1024 -7.764 2.776 -53.614 1.00120.51 C ANISOU14208 CA LYS A1024 13753 18240 13794 1075 -1967 4365 C ATOM 14209 C LYS A1024 -8.459 1.758 -52.703 1.00118.95 C ANISOU14209 C LYS A1024 13500 18084 13611 1122 -1939 4254 C ATOM 14210 O LYS A1024 -8.976 0.741 -53.173 1.00106.76 O ANISOU14210 O LYS A1024 11940 16669 11953 1034 -1971 4212 O ATOM 14211 CB LYS A1024 -6.526 2.151 -54.266 1.00116.03 C ANISOU14211 CB LYS A1024 13291 17763 13031 949 -1935 4302 C ATOM 14212 CG LYS A1024 -5.794 3.102 -55.203 1.00118.43 C ANISOU14212 CG LYS A1024 13648 18044 13305 887 -1957 4415 C ATOM 14213 CD LYS A1024 -4.387 2.628 -55.511 1.00119.42 C ANISOU14213 CD LYS A1024 13873 18232 13269 797 -1900 4337 C ATOM 14214 CE LYS A1024 -3.619 3.676 -56.308 1.00121.75 C ANISOU14214 CE LYS A1024 14214 18492 13552 743 -1913 4458 C ATOM 14215 NZ LYS A1024 -2.155 3.691 -56.013 1.00120.26 N ANISOU14215 NZ LYS A1024 14108 18279 13307 727 -1836 4397 N ATOM 14216 H LYS A1024 -6.538 4.044 -52.729 1.00143.70 H ATOM 14217 HA LYS A1024 -8.384 3.025 -54.317 1.00144.61 H ATOM 14218 HB2 LYS A1024 -5.907 1.882 -53.571 1.00139.23 H ATOM 14219 HB3 LYS A1024 -6.800 1.377 -54.782 1.00139.23 H ATOM 14220 HG2 LYS A1024 -6.281 3.163 -56.039 1.00142.11 H ATOM 14221 HG3 LYS A1024 -5.734 3.976 -54.786 1.00142.11 H ATOM 14222 HD2 LYS A1024 -3.912 2.468 -54.680 1.00143.30 H ATOM 14223 HD3 LYS A1024 -4.429 1.814 -56.037 1.00143.30 H ATOM 14224 HE2 LYS A1024 -3.731 3.493 -57.255 1.00146.10 H ATOM 14225 HE3 LYS A1024 -3.975 4.553 -56.098 1.00146.10 H ATOM 14226 HZ1 LYS A1024 -1.753 4.317 -56.502 1.00144.31 H ATOM 14227 HZ2 LYS A1024 -2.021 3.866 -55.151 1.00144.31 H ATOM 14228 HZ3 LYS A1024 -1.798 2.899 -56.207 1.00144.31 H ATOM 14229 N PHE A1025 -8.469 2.050 -51.403 1.00117.05 N ANISOU14229 N PHE A1025 13229 17731 13512 1257 -1879 4202 N ATOM 14230 CA PHE A1025 -9.084 1.180 -50.404 1.00111.43 C ANISOU14230 CA PHE A1025 12471 17031 12834 1303 -1830 4074 C ATOM 14231 C PHE A1025 -10.249 1.862 -49.706 1.00114.16 C ANISOU14231 C PHE A1025 12695 17317 13364 1440 -1851 4141 C ATOM 14232 O PHE A1025 -11.314 1.267 -49.534 1.00112.14 O ANISOU14232 O PHE A1025 12350 17144 13113 1447 -1881 4143 O ATOM 14233 CB PHE A1025 -8.039 0.756 -49.373 1.00 97.78 C ANISOU14233 CB PHE A1025 10831 15212 11110 1325 -1705 3882 C ATOM 14234 CG PHE A1025 -6.978 -0.124 -49.940 1.00 91.23 C ANISOU14234 CG PHE A1025 10108 14452 10103 1196 -1678 3787 C ATOM 14235 CD1 PHE A1025 -5.880 0.425 -50.572 1.00 92.38 C ANISOU14235 CD1 PHE A1025 10336 14569 10194 1147 -1670 3816 C ATOM 14236 CD2 PHE A1025 -7.093 -1.500 -49.872 1.00 85.43 C ANISOU14236 CD2 PHE A1025 9387 13814 9258 1121 -1666 3671 C ATOM 14237 CE1 PHE A1025 -4.905 -0.380 -51.112 1.00 96.75 C ANISOU14237 CE1 PHE A1025 10981 15197 10584 1031 -1642 3722 C ATOM 14238 CE2 PHE A1025 -6.122 -2.313 -50.411 1.00 85.56 C ANISOU14238 CE2 PHE A1025 9498 13892 9119 1009 -1644 3574 C ATOM 14239 CZ PHE A1025 -5.025 -1.753 -51.032 1.00 95.50 C ANISOU14239 CZ PHE A1025 10835 15130 10321 967 -1630 3596 C ATOM 14240 H PHE A1025 -8.119 2.761 -51.069 1.00140.45 H ATOM 14241 HA PHE A1025 -9.419 0.382 -50.840 1.00133.71 H ATOM 14242 HB2 PHE A1025 -7.609 1.548 -49.015 1.00117.34 H ATOM 14243 HB3 PHE A1025 -8.480 0.268 -48.659 1.00117.34 H ATOM 14244 HD1 PHE A1025 -5.797 1.350 -50.628 1.00110.85 H ATOM 14245 HD2 PHE A1025 -7.831 -1.880 -49.454 1.00102.52 H ATOM 14246 HE1 PHE A1025 -4.166 0.000 -51.531 1.00116.10 H ATOM 14247 HE2 PHE A1025 -6.204 -3.238 -50.354 1.00102.67 H ATOM 14248 HZ PHE A1025 -4.366 -2.299 -51.395 1.00114.60 H HETATM14249 N MSE A1026 -10.047 3.113 -49.310 1.00139.54 N ANISOU14249 N MSE A1026 15901 20385 16733 1549 -1837 4192 N HETATM14250 CA MSE A1026 -11.061 3.828 -48.556 1.00142.26 C ANISOU14250 CA MSE A1026 16130 20657 17266 1695 -1847 4233 C HETATM14251 C MSE A1026 -12.034 4.551 -49.478 1.00151.26 C ANISOU14251 C MSE A1026 17203 21800 18468 1682 -1945 4375 C HETATM14252 O MSE A1026 -11.658 5.023 -50.554 1.00148.39 O ANISOU14252 O MSE A1026 16894 21435 18054 1600 -2000 4468 O HETATM14253 CB MSE A1026 -10.407 4.807 -47.583 1.00131.13 C ANISOU14253 CB MSE A1026 14753 19058 16011 1817 -1769 4168 C HETATM14254 CG MSE A1026 -9.952 6.120 -48.184 1.00133.59 C ANISOU14254 CG MSE A1026 15090 19261 16405 1841 -1824 4303 C HETATM14255 SE MSE A1026 -9.648 7.432 -46.791 1.00158.95 SE ANISOU14255 SE MSE A1026 18292 22231 19871 2034 -1748 4225 SE HETATM14256 CE MSE A1026 -11.355 7.335 -45.844 1.00134.56 C ANISOU14256 CE MSE A1026 15029 19176 16921 2180 -1750 4201 C HETATM14257 H MSE A1026 -9.333 3.567 -49.465 1.00167.45 H HETATM14258 HA MSE A1026 -11.560 3.185 -48.028 1.00170.71 H HETATM14259 HB2 MSE A1026 -11.044 5.014 -46.882 1.00157.35 H HETATM14260 HB3 MSE A1026 -9.627 4.379 -47.196 1.00157.35 H HETATM14261 HG2 MSE A1026 -9.121 5.985 -48.665 1.00160.31 H HETATM14262 HG3 MSE A1026 -10.638 6.458 -48.780 1.00160.31 H HETATM14263 HE1 MSE A1026 -11.340 7.959 -45.102 1.00161.47 H HETATM14264 HE2 MSE A1026 -12.070 7.568 -46.458 1.00161.47 H HETATM14265 HE3 MSE A1026 -11.483 6.432 -45.515 1.00161.47 H ATOM 14266 N THR A1027 -13.282 4.642 -49.032 1.00125.60 N ANISOU14266 N THR A1027 13835 18556 15330 1763 -1963 4386 N ATOM 14267 CA THR A1027 -14.349 5.229 -49.827 1.00123.13 C ANISOU14267 CA THR A1027 13447 18253 15083 1756 -2057 4506 C ATOM 14268 C THR A1027 -14.790 6.575 -49.269 1.00127.48 C ANISOU14268 C THR A1027 13929 18648 15859 1914 -2065 4553 C ATOM 14269 O THR A1027 -14.360 6.985 -48.192 1.00125.68 O ANISOU14269 O THR A1027 13703 18312 15739 2032 -1994 4480 O ATOM 14270 CB THR A1027 -15.561 4.293 -49.881 1.00116.44 C ANISOU14270 CB THR A1027 12505 17544 14193 1719 -2085 4491 C ATOM 14271 OG1 THR A1027 -16.097 4.120 -48.562 1.00106.70 O ANISOU14271 OG1 THR A1027 11184 16291 13066 1842 -2019 4407 O ATOM 14272 CG2 THR A1027 -15.151 2.944 -50.436 1.00116.15 C ANISOU14272 CG2 THR A1027 12537 17653 13943 1564 -2083 4434 C ATOM 14273 H THR A1027 -13.539 4.364 -48.260 1.00150.71 H ATOM 14274 HA THR A1027 -14.032 5.366 -50.734 1.00147.75 H ATOM 14275 HB THR A1027 -16.240 4.673 -50.460 1.00139.73 H ATOM 14276 HG1 THR A1027 -16.762 3.607 -48.587 1.00128.04 H ATOM 14277 HG21 THR A1027 -15.919 2.352 -50.469 1.00139.38 H ATOM 14278 HG22 THR A1027 -14.794 3.048 -51.332 1.00139.38 H ATOM 14279 HG23 THR A1027 -14.471 2.546 -49.870 1.00139.38 H ATOM 14280 N PHE A1028 -15.659 7.253 -50.009 1.00123.55 N ANISOU14280 N PHE A1028 13371 18138 15434 1915 -2155 4670 N ATOM 14281 CA PHE A1028 -16.115 8.586 -49.641 1.00125.73 C ANISOU14281 CA PHE A1028 13584 18260 15929 2058 -2180 4722 C ATOM 14282 C PHE A1028 -16.798 8.622 -48.268 1.00127.14 C ANISOU14282 C PHE A1028 13655 18399 16251 2215 -2116 4622 C ATOM 14283 O PHE A1028 -16.541 9.520 -47.469 1.00128.46 O ANISOU14283 O PHE A1028 13813 18417 16577 2349 -2079 4585 O ATOM 14284 CB PHE A1028 -17.070 9.118 -50.711 1.00128.80 C ANISOU14284 CB PHE A1028 13915 18670 16352 2023 -2295 4861 C ATOM 14285 CG PHE A1028 -17.503 10.532 -50.483 1.00125.30 C ANISOU14285 CG PHE A1028 13415 18060 16132 2159 -2336 4924 C ATOM 14286 CD1 PHE A1028 -16.652 11.587 -50.764 1.00123.97 C ANISOU14286 CD1 PHE A1028 13325 17746 16033 2172 -2357 4988 C ATOM 14287 CD2 PHE A1028 -18.763 10.808 -49.986 1.00126.51 C ANISOU14287 CD2 PHE A1028 13435 18204 16431 2274 -2356 4916 C ATOM 14288 CE1 PHE A1028 -17.052 12.891 -50.552 1.00123.70 C ANISOU14288 CE1 PHE A1028 13240 17548 16213 2298 -2402 5040 C ATOM 14289 CE2 PHE A1028 -19.170 12.109 -49.773 1.00129.22 C ANISOU14289 CE2 PHE A1028 13725 18389 16985 2404 -2398 4962 C ATOM 14290 CZ PHE A1028 -18.314 13.153 -50.056 1.00125.37 C ANISOU14290 CZ PHE A1028 13320 17746 16569 2417 -2423 5022 C ATOM 14291 H PHE A1028 -16.003 6.958 -50.739 1.00148.26 H ATOM 14292 HA PHE A1028 -15.349 9.180 -49.606 1.00150.88 H ATOM 14293 HB2 PHE A1028 -16.628 9.078 -51.573 1.00154.56 H ATOM 14294 HB3 PHE A1028 -17.866 8.562 -50.723 1.00154.56 H ATOM 14295 HD1 PHE A1028 -15.801 11.415 -51.098 1.00148.77 H ATOM 14296 HD2 PHE A1028 -19.344 10.108 -49.794 1.00151.82 H ATOM 14297 HE1 PHE A1028 -16.473 13.593 -50.744 1.00148.44 H ATOM 14298 HE2 PHE A1028 -20.020 12.282 -49.438 1.00155.07 H ATOM 14299 HZ PHE A1028 -18.585 14.031 -49.913 1.00150.44 H ATOM 14300 N GLN A1029 -17.661 7.644 -47.996 1.00123.40 N ANISOU14300 N GLN A1029 13101 18063 15722 2196 -2101 4575 N ATOM 14301 CA GLN A1029 -18.438 7.618 -46.754 1.00126.21 C ANISOU14301 CA GLN A1029 13340 18411 16202 2335 -2040 4487 C ATOM 14302 C GLN A1029 -17.666 6.923 -45.636 1.00135.35 C ANISOU14302 C GLN A1029 14539 19581 17305 2365 -1925 4348 C ATOM 14303 O GLN A1029 -18.071 6.937 -44.471 1.00136.57 O ANISOU14303 O GLN A1029 14613 19723 17555 2486 -1854 4258 O ATOM 14304 CB GLN A1029 -19.784 6.933 -46.989 1.00134.50 C ANISOU14304 CB GLN A1029 14273 19605 17224 2298 -2082 4513 C ATOM 14305 CG GLN A1029 -20.744 6.983 -45.804 1.00139.82 C ANISOU14305 CG GLN A1029 14807 20286 18032 2439 -2026 4438 C ATOM 14306 CD GLN A1029 -22.021 6.217 -46.063 1.00136.67 C ANISOU14306 CD GLN A1029 14294 20041 17594 2386 -2065 4468 C ATOM 14307 OE1 GLN A1029 -23.110 6.785 -46.058 1.00135.06 O ANISOU14307 OE1 GLN A1029 13971 19827 17518 2464 -2108 4512 O ATOM 14308 NE2 GLN A1029 -21.892 4.917 -46.297 1.00131.68 N ANISOU14308 NE2 GLN A1029 13695 19549 16787 2252 -2055 4442 N ATOM 14309 H GLN A1029 -17.817 6.979 -48.518 1.00148.08 H ATOM 14310 HA GLN A1029 -18.613 8.530 -46.474 1.00151.45 H ATOM 14311 HB2 GLN A1029 -20.223 7.362 -47.740 1.00161.40 H ATOM 14312 HB3 GLN A1029 -19.623 5.999 -47.197 1.00161.40 H ATOM 14313 HG2 GLN A1029 -20.311 6.593 -45.029 1.00167.78 H ATOM 14314 HG3 GLN A1029 -20.979 7.907 -45.625 1.00167.78 H ATOM 14315 HE21 GLN A1029 -21.112 4.555 -46.295 1.00158.01 H ATOM 14316 HE22 GLN A1029 -22.589 4.437 -46.450 1.00158.01 H HETATM14317 N MSE A1030 -16.548 6.307 -45.997 1.00177.13 N ANISOU14317 N MSE A1030 19955 24905 22440 2254 -1905 4327 N HETATM14318 CA MSE A1030 -15.571 5.903 -45.005 1.00163.45 C ANISOU14318 CA MSE A1030 18284 23146 20671 2291 -1803 4206 C HETATM14319 C MSE A1030 -14.872 7.161 -44.518 1.00160.97 C ANISOU14319 C MSE A1030 18006 22646 20507 2412 -1775 4195 C HETATM14320 O MSE A1030 -14.639 7.340 -43.323 1.00156.08 O ANISOU14320 O MSE A1030 17375 21957 19972 2527 -1686 4079 O HETATM14321 CB MSE A1030 -14.560 4.943 -45.610 1.00156.83 C ANISOU14321 CB MSE A1030 17570 22390 19629 2138 -1798 4188 C HETATM14322 CG MSE A1030 -14.979 3.493 -45.518 1.00164.33 C ANISOU14322 CG MSE A1030 18495 23504 20439 2049 -1783 4130 C HETATM14323 SE MSE A1030 -13.628 2.270 -46.191 1.00169.11 SE ANISOU14323 SE MSE A1030 19275 24177 20800 1853 -1757 4045 SE HETATM14324 CE MSE A1030 -12.071 2.921 -45.202 1.00153.03 C ANISOU14324 CE MSE A1030 17370 21946 18827 1925 -1631 3898 C HETATM14325 H MSE A1030 -16.335 6.112 -46.807 1.00212.55 H HETATM14326 HA MSE A1030 -16.016 5.464 -44.263 1.00196.13 H HETATM14327 HB2 MSE A1030 -14.444 5.161 -46.548 1.00188.20 H HETATM14328 HB3 MSE A1030 -13.716 5.040 -45.142 1.00188.20 H HETATM14329 HG2 MSE A1030 -15.146 3.272 -44.589 1.00197.20 H HETATM14330 HG3 MSE A1030 -15.786 3.364 -46.040 1.00197.20 H HETATM14331 HE1 MSE A1030 -11.298 2.388 -45.445 1.00183.63 H HETATM14332 HE2 MSE A1030 -11.918 3.851 -45.432 1.00183.63 H HETATM14333 HE3 MSE A1030 -12.245 2.840 -44.251 1.00183.63 H ATOM 14334 N SER A1031 -14.559 8.039 -45.464 1.00125.57 N ANISOU14334 N SER A1031 13576 18078 16059 2376 -1849 4304 N ATOM 14335 CA SER A1031 -13.939 9.323 -45.164 1.00126.84 C ANISOU14335 CA SER A1031 13771 18049 16374 2477 -1843 4313 C ATOM 14336 C SER A1031 -14.861 10.246 -44.368 1.00127.04 C ANISOU14336 C SER A1031 13680 17971 16620 2650 -1839 4287 C ATOM 14337 O SER A1031 -14.415 11.280 -43.874 1.00130.98 O ANISOU14337 O SER A1031 14196 18302 17270 2757 -1823 4262 O ATOM 14338 CB SER A1031 -13.505 10.014 -46.465 1.00121.89 C ANISOU14338 CB SER A1031 13217 17369 15726 2381 -1934 4455 C ATOM 14339 OG SER A1031 -13.157 11.372 -46.251 1.00119.77 O ANISOU14339 OG SER A1031 12962 16906 15639 2481 -1949 4485 O ATOM 14340 H SER A1031 -14.699 7.912 -46.303 1.00150.69 H ATOM 14341 HA SER A1031 -13.143 9.169 -44.631 1.00152.21 H ATOM 14342 HB2 SER A1031 -12.735 9.547 -46.826 1.00146.26 H ATOM 14343 HB3 SER A1031 -14.239 9.976 -47.099 1.00146.26 H ATOM 14344 HG SER A1031 -12.924 11.727 -46.976 1.00143.72 H ATOM 14345 N LEU A1032 -16.133 9.873 -44.229 1.00123.18 N ANISOU14345 N LEU A1032 13071 17580 16153 2677 -1854 4284 N ATOM 14346 CA LEU A1032 -17.117 10.757 -43.603 1.00127.50 C ANISOU14346 CA LEU A1032 13497 18043 16906 2835 -1861 4264 C ATOM 14347 C LEU A1032 -17.717 10.241 -42.294 1.00126.63 C ANISOU14347 C LEU A1032 13285 18000 16830 2941 -1764 4128 C ATOM 14348 O LEU A1032 -18.175 11.039 -41.474 1.00124.33 O ANISOU14348 O LEU A1032 12913 17614 16712 3096 -1735 4063 O ATOM 14349 CB LEU A1032 -18.241 11.082 -44.588 1.00133.77 C ANISOU14349 CB LEU A1032 14214 18873 17738 2802 -1973 4392 C ATOM 14350 CG LEU A1032 -17.950 12.129 -45.671 1.00130.09 C ANISOU14350 CG LEU A1032 13809 18289 17330 2765 -2076 4529 C ATOM 14351 CD1 LEU A1032 -19.225 12.440 -46.438 1.00128.02 C ANISOU14351 CD1 LEU A1032 13449 18068 17124 2760 -2179 4638 C ATOM 14352 CD2 LEU A1032 -17.345 13.418 -45.109 1.00121.64 C ANISOU14352 CD2 LEU A1032 12770 17002 16446 2894 -2062 4497 C ATOM 14353 H LEU A1032 -16.451 9.117 -44.487 1.00147.82 H ATOM 14354 HA LEU A1032 -16.672 11.595 -43.397 1.00153.00 H ATOM 14355 HB2 LEU A1032 -18.487 10.262 -45.045 1.00160.52 H ATOM 14356 HB3 LEU A1032 -19.003 11.403 -44.080 1.00160.52 H ATOM 14357 HG LEU A1032 -17.312 11.756 -46.299 1.00156.11 H ATOM 14358 HD11 LEU A1032 -19.029 13.103 -47.119 1.00153.62 H ATOM 14359 HD12 LEU A1032 -19.550 11.626 -46.852 1.00153.62 H ATOM 14360 HD13 LEU A1032 -19.888 12.786 -45.820 1.00153.62 H ATOM 14361 HD21 LEU A1032 -17.185 14.036 -45.839 1.00145.97 H ATOM 14362 HD22 LEU A1032 -17.968 13.808 -44.475 1.00145.97 H ATOM 14363 HD23 LEU A1032 -16.509 13.206 -44.664 1.00145.97 H ATOM 14364 N ARG A1033 -17.742 8.927 -42.095 1.00133.74 N ANISOU14364 N ARG A1033 14184 19063 17568 2857 -1715 4082 N ATOM 14365 CA ARG A1033 -18.209 8.391 -40.822 1.00139.29 C ANISOU14365 CA ARG A1033 14798 19839 18288 2946 -1616 3956 C ATOM 14366 C ARG A1033 -17.057 8.502 -39.839 1.00137.04 C ANISOU14366 C ARG A1033 14600 19463 18007 3008 -1513 3826 C ATOM 14367 O ARG A1033 -16.204 7.622 -39.770 1.00134.68 O ANISOU14367 O ARG A1033 14418 19201 17552 2893 -1457 3748 O ATOM 14368 CB ARG A1033 -18.689 6.946 -40.956 1.00131.97 C ANISOU14368 CB ARG A1033 13839 19112 17193 2827 -1607 3957 C ATOM 14369 CG ARG A1033 -19.671 6.543 -39.855 1.00123.65 C ANISOU14369 CG ARG A1033 12644 18152 16186 2916 -1535 3872 C ATOM 14370 CD ARG A1033 -20.222 5.136 -40.029 1.00122.65 C ANISOU14370 CD ARG A1033 12477 18218 15906 2790 -1538 3886 C ATOM 14371 NE ARG A1033 -19.637 4.450 -41.177 1.00128.07 N ANISOU14371 NE ARG A1033 13276 18952 16432 2617 -1606 3959 N ATOM 14372 CZ ARG A1033 -20.105 4.527 -42.420 1.00133.92 C ANISOU14372 CZ ARG A1033 14017 19721 17147 2523 -1713 4075 C ATOM 14373 NH1 ARG A1033 -21.169 5.271 -42.696 1.00147.56 N ANISOU14373 NH1 ARG A1033 15637 21427 19003 2586 -1770 4142 N ATOM 14374 NH2 ARG A1033 -19.497 3.868 -43.394 1.00131.73 N ANISOU14374 NH2 ARG A1033 13847 19495 16711 2368 -1762 4119 N ATOM 14375 H ARG A1033 -17.499 8.334 -42.669 1.00160.49 H ATOM 14376 HA ARG A1033 -18.945 8.931 -40.495 1.00167.15 H ATOM 14377 HB2 ARG A1033 -19.136 6.840 -41.810 1.00158.37 H ATOM 14378 HB3 ARG A1033 -17.923 6.353 -40.906 1.00158.37 H ATOM 14379 HG2 ARG A1033 -19.217 6.582 -38.999 1.00148.38 H ATOM 14380 HG3 ARG A1033 -20.420 7.160 -39.860 1.00148.38 H ATOM 14381 HD2 ARG A1033 -20.023 4.616 -39.235 1.00147.18 H ATOM 14382 HD3 ARG A1033 -21.181 5.185 -40.164 1.00147.18 H ATOM 14383 HE ARG A1033 -18.942 3.962 -41.041 1.00153.68 H ATOM 14384 HH11 ARG A1033 -21.567 5.703 -42.067 1.00177.08 H ATOM 14385 HH12 ARG A1033 -21.464 5.317 -43.502 1.00177.08 H ATOM 14386 HH21 ARG A1033 -18.807 3.385 -43.221 1.00158.08 H ATOM 14387 HH22 ARG A1033 -19.797 3.917 -44.198 1.00158.08 H ATOM 14388 N ARG A1034 -17.029 9.602 -39.094 1.00163.10 N ANISOU14388 N ARG A1034 17865 22619 21485 3168 -1482 3764 N ATOM 14389 CA ARG A1034 -15.851 9.970 -38.316 1.00169.83 C ANISOU14389 CA ARG A1034 18836 23333 22360 3205 -1393 3621 C ATOM 14390 C ARG A1034 -15.723 9.193 -37.003 1.00176.73 C ANISOU14390 C ARG A1034 19715 24270 23165 3224 -1258 3429 C ATOM 14391 O ARG A1034 -14.644 8.710 -36.673 1.00174.50 O ANISOU14391 O ARG A1034 19562 23963 22778 3153 -1190 3329 O ATOM 14392 CB ARG A1034 -15.850 11.480 -38.033 1.00167.46 C ANISOU14392 CB ARG A1034 18499 22844 22284 3367 -1420 3624 C ATOM 14393 CG ARG A1034 -14.613 12.213 -38.551 1.00169.85 C ANISOU14393 CG ARG A1034 18942 22981 22614 3328 -1454 3661 C ATOM 14394 CD ARG A1034 -14.488 13.636 -37.995 1.00181.45 C ANISOU14394 CD ARG A1034 20387 24246 24311 3495 -1459 3619 C ATOM 14395 NE ARG A1034 -14.069 13.668 -36.592 1.00190.52 N ANISOU14395 NE ARG A1034 21556 25340 25491 3586 -1334 3401 N ATOM 14396 CZ ARG A1034 -13.900 14.780 -35.877 1.00182.07 C ANISOU14396 CZ ARG A1034 20470 24100 24608 3735 -1316 3313 C ATOM 14397 NH1 ARG A1034 -14.118 15.971 -36.422 1.00171.45 N ANISOU14397 NH1 ARG A1034 19088 22608 23448 3813 -1417 3427 N ATOM 14398 NH2 ARG A1034 -13.514 14.702 -34.610 1.00171.66 N ANISOU14398 NH2 ARG A1034 19174 22757 23292 3805 -1200 3110 N ATOM 14399 H ARG A1034 -17.683 10.156 -39.022 1.00195.72 H ATOM 14400 HA ARG A1034 -15.062 9.774 -38.845 1.00203.80 H ATOM 14401 HB2 ARG A1034 -16.627 11.876 -38.457 1.00200.95 H ATOM 14402 HB3 ARG A1034 -15.894 11.617 -37.074 1.00200.95 H ATOM 14403 HG2 ARG A1034 -13.821 11.719 -38.290 1.00203.83 H ATOM 14404 HG3 ARG A1034 -14.663 12.273 -39.518 1.00203.83 H ATOM 14405 HD2 ARG A1034 -13.829 14.121 -38.516 1.00217.74 H ATOM 14406 HD3 ARG A1034 -15.350 14.076 -38.060 1.00217.74 H ATOM 14407 HE ARG A1034 -13.920 12.916 -36.202 1.00228.62 H ATOM 14408 HH11 ARG A1034 -14.367 16.029 -37.243 1.00205.74 H ATOM 14409 HH12 ARG A1034 -14.008 16.684 -35.954 1.00205.74 H ATOM 14410 HH21 ARG A1034 -13.372 13.934 -34.250 1.00205.99 H ATOM 14411 HH22 ARG A1034 -13.407 15.420 -34.148 1.00205.99 H ATOM 14412 N GLU A1035 -16.820 9.059 -36.265 1.00168.91 N ANISOU14412 N GLU A1035 18580 23367 22230 3317 -1219 3384 N ATOM 14413 CA GLU A1035 -16.763 8.538 -34.902 1.00165.31 C ANISOU14413 CA GLU A1035 18114 22960 21735 3361 -1088 3204 C ATOM 14414 C GLU A1035 -18.023 7.684 -34.696 1.00159.79 C ANISOU14414 C GLU A1035 17273 22454 20986 3346 -1076 3227 C ATOM 14415 O GLU A1035 -19.042 7.981 -35.317 1.00147.92 O ANISOU14415 O GLU A1035 15647 20997 19557 3378 -1160 3351 O ATOM 14416 CB GLU A1035 -16.688 9.735 -33.931 1.00172.13 C ANISOU14416 CB GLU A1035 18941 23682 22779 3547 -1037 3090 C ATOM 14417 CG GLU A1035 -16.297 9.442 -32.467 1.00180.25 C ANISOU14417 CG GLU A1035 19993 24722 23771 3601 -898 2885 C ATOM 14418 CD GLU A1035 -14.887 9.909 -32.073 1.00181.78 C ANISOU14418 CD GLU A1035 20341 24755 23973 3608 -854 2776 C ATOM 14419 OE1 GLU A1035 -14.273 10.723 -32.802 1.00178.87 O ANISOU14419 OE1 GLU A1035 20042 24238 23681 3606 -927 2848 O ATOM 14420 OE2 GLU A1035 -14.397 9.457 -31.011 1.00172.35 O ANISOU14420 OE2 GLU A1035 19193 23586 22707 3613 -748 2621 O ATOM 14421 H GLU A1035 -17.612 9.264 -36.530 1.00202.69 H ATOM 14422 HA GLU A1035 -15.977 7.982 -34.787 1.00198.37 H ATOM 14423 HB2 GLU A1035 -16.036 10.363 -34.279 1.00206.56 H ATOM 14424 HB3 GLU A1035 -17.560 10.161 -33.912 1.00206.56 H ATOM 14425 HG2 GLU A1035 -16.928 9.889 -31.883 1.00216.30 H ATOM 14426 HG3 GLU A1035 -16.340 8.484 -32.322 1.00216.30 H ATOM 14427 N ASP A1036 -17.984 6.610 -33.894 1.00167.12 N ANISOU14427 N ASP A1036 18213 23497 21789 3289 -982 3122 N ATOM 14428 CA ASP A1036 -16.795 6.095 -33.206 1.00169.48 C ANISOU14428 CA ASP A1036 18655 23758 21980 3234 -891 2985 C ATOM 14429 C ASP A1036 -16.228 4.872 -33.925 1.00164.39 C ANISOU14429 C ASP A1036 18121 23187 21151 3042 -918 3029 C ATOM 14430 O ASP A1036 -16.836 4.382 -34.875 1.00162.89 O ANISOU14430 O ASP A1036 17889 23092 20911 2953 -1000 3156 O ATOM 14431 CB ASP A1036 -17.160 5.696 -31.769 1.00172.20 C ANISOU14431 CB ASP A1036 18933 24186 22309 3301 -770 2840 C ATOM 14432 CG ASP A1036 -16.341 6.436 -30.727 1.00170.06 C ANISOU14432 CG ASP A1036 18725 23787 22104 3412 -685 2682 C ATOM 14433 OD1 ASP A1036 -15.125 6.174 -30.617 1.00158.86 O ANISOU14433 OD1 ASP A1036 17459 22297 20604 3343 -655 2615 O ATOM 14434 OD2 ASP A1036 -16.921 7.274 -30.007 1.00172.83 O ANISOU14434 OD2 ASP A1036 18968 24110 22587 3570 -649 2618 O ATOM 14435 H ASP A1036 -18.683 6.138 -33.727 1.00200.55 H ATOM 14436 HA ASP A1036 -16.112 6.782 -33.174 1.00203.37 H ATOM 14437 HB2 ASP A1036 -18.096 5.898 -31.613 1.00206.64 H ATOM 14438 HB3 ASP A1036 -17.002 4.746 -31.654 1.00206.64 H ATOM 14439 N VAL A1037 -15.072 4.392 -33.452 1.00128.97 N ANISOU14439 N VAL A1037 13774 18658 16569 2982 -851 2918 N ATOM 14440 CA VAL A1037 -14.453 3.149 -33.927 1.00115.34 C ANISOU14440 CA VAL A1037 12156 16999 14670 2810 -859 2925 C ATOM 14441 C VAL A1037 -13.728 3.366 -35.263 1.00108.30 C ANISOU14441 C VAL A1037 11368 16040 13743 2720 -949 3022 C ATOM 14442 O VAL A1037 -13.229 2.420 -35.866 1.00101.23 O ANISOU14442 O VAL A1037 10561 15194 12708 2578 -969 3034 O ATOM 14443 CB VAL A1037 -15.505 1.982 -34.034 1.00115.36 C ANISOU14443 CB VAL A1037 12064 17184 14585 2725 -875 2978 C ATOM 14444 CG1 VAL A1037 -14.856 0.635 -34.327 1.00108.78 C ANISOU14444 CG1 VAL A1037 11340 16410 13581 2557 -874 2956 C ATOM 14445 CG2 VAL A1037 -16.308 1.857 -32.746 1.00120.61 C ANISOU14445 CG2 VAL A1037 12609 17927 15289 2817 -786 2896 C ATOM 14446 H VAL A1037 -14.614 4.783 -32.838 1.00154.76 H ATOM 14447 HA VAL A1037 -13.789 2.875 -33.275 1.00138.41 H ATOM 14448 HB VAL A1037 -16.123 2.180 -34.755 1.00138.44 H ATOM 14449 HG11 VAL A1037 -15.548 -0.043 -34.382 1.00130.53 H ATOM 14450 HG12 VAL A1037 -14.380 0.691 -35.170 1.00130.53 H ATOM 14451 HG13 VAL A1037 -14.238 0.420 -33.611 1.00130.53 H ATOM 14452 HG21 VAL A1037 -16.946 1.132 -32.842 1.00144.73 H ATOM 14453 HG22 VAL A1037 -15.701 1.669 -32.013 1.00144.73 H ATOM 14454 HG23 VAL A1037 -16.776 2.691 -32.584 1.00144.73 H ATOM 14455 N TRP A1038 -13.649 4.619 -35.709 1.00111.13 N ANISOU14455 N TRP A1038 11715 16283 14228 2803 -1001 3089 N ATOM 14456 CA TRP A1038 -13.049 4.935 -37.007 1.00110.06 C ANISOU14456 CA TRP A1038 11662 16091 14064 2720 -1091 3202 C ATOM 14457 C TRP A1038 -11.807 5.810 -36.864 1.00110.41 C ANISOU14457 C TRP A1038 11822 15965 14166 2758 -1065 3146 C ATOM 14458 O TRP A1038 -11.230 6.241 -37.860 1.00113.39 O ANISOU14458 O TRP A1038 12267 16281 14534 2700 -1133 3239 O ATOM 14459 CB TRP A1038 -14.064 5.625 -37.934 1.00112.83 C ANISOU14459 CB TRP A1038 11902 16459 14507 2756 -1201 3372 C ATOM 14460 CG TRP A1038 -15.128 4.699 -38.451 1.00113.71 C ANISOU14460 CG TRP A1038 11922 16744 14537 2677 -1253 3456 C ATOM 14461 CD1 TRP A1038 -16.303 4.382 -37.837 1.00112.69 C ANISOU14461 CD1 TRP A1038 11653 16718 14447 2734 -1230 3443 C ATOM 14462 CD2 TRP A1038 -15.109 3.963 -39.682 1.00104.06 C ANISOU14462 CD2 TRP A1038 10740 15617 13181 2523 -1337 3561 C ATOM 14463 NE1 TRP A1038 -17.017 3.496 -38.605 1.00107.42 N ANISOU14463 NE1 TRP A1038 10935 16197 13684 2622 -1298 3538 N ATOM 14464 CE2 TRP A1038 -16.306 3.222 -39.743 1.00101.95 C ANISOU14464 CE2 TRP A1038 10352 15501 12882 2493 -1366 3608 C ATOM 14465 CE3 TRP A1038 -14.196 3.858 -40.736 1.00 95.87 C ANISOU14465 CE3 TRP A1038 9825 14560 12044 2405 -1389 3617 C ATOM 14466 CZ2 TRP A1038 -16.615 2.391 -40.816 1.00103.48 C ANISOU14466 CZ2 TRP A1038 10548 15817 12952 2352 -1450 3702 C ATOM 14467 CZ3 TRP A1038 -14.505 3.031 -41.800 1.00 95.79 C ANISOU14467 CZ3 TRP A1038 9814 14679 11902 2269 -1468 3708 C ATOM 14468 CH2 TRP A1038 -15.704 2.311 -41.833 1.00102.58 C ANISOU14468 CH2 TRP A1038 10557 15680 12738 2244 -1500 3747 C ATOM 14469 H TRP A1038 -13.969 5.303 -35.295 1.00133.36 H ATOM 14470 HA TRP A1038 -12.778 4.107 -37.433 1.00132.07 H ATOM 14471 HB2 TRP A1038 -14.502 6.338 -37.444 1.00135.39 H ATOM 14472 HB3 TRP A1038 -13.592 5.992 -38.699 1.00135.39 H ATOM 14473 HD1 TRP A1038 -16.579 4.716 -37.014 1.00135.23 H ATOM 14474 HE1 TRP A1038 -17.786 3.168 -38.404 1.00128.91 H ATOM 14475 HE3 TRP A1038 -13.397 4.334 -40.721 1.00115.05 H ATOM 14476 HZ2 TRP A1038 -17.411 1.912 -40.841 1.00124.17 H ATOM 14477 HZ3 TRP A1038 -13.906 2.954 -42.507 1.00114.95 H ATOM 14478 HH2 TRP A1038 -15.885 1.763 -42.562 1.00123.10 H ATOM 14479 N LEU A1039 -11.385 6.060 -35.630 1.00102.38 N ANISOU14479 N LEU A1039 10824 14875 13200 2849 -970 2995 N ATOM 14480 CA LEU A1039 -10.297 7.001 -35.385 1.00 95.27 C ANISOU14480 CA LEU A1039 10016 13803 12378 2901 -947 2935 C ATOM 14481 C LEU A1039 -8.930 6.529 -35.899 1.00106.79 C ANISOU14481 C LEU A1039 11632 15232 13712 2769 -942 2915 C ATOM 14482 O LEU A1039 -8.097 7.361 -36.261 1.00109.61 O ANISOU14482 O LEU A1039 12062 15460 14127 2774 -966 2937 O ATOM 14483 CB LEU A1039 -10.216 7.369 -33.901 1.00 94.59 C ANISOU14483 CB LEU A1039 9909 13657 12373 3033 -847 2768 C ATOM 14484 CG LEU A1039 -11.343 8.275 -33.394 1.00111.75 C ANISOU14484 CG LEU A1039 11935 15807 14716 3197 -853 2773 C ATOM 14485 CD1 LEU A1039 -12.625 7.482 -33.186 1.00128.01 C ANISOU14485 CD1 LEU A1039 13865 18043 16730 3196 -842 2799 C ATOM 14486 CD2 LEU A1039 -10.943 8.993 -32.113 1.00107.27 C ANISOU14486 CD2 LEU A1039 11376 15131 14251 3332 -769 2607 C ATOM 14487 H LEU A1039 -11.709 5.699 -34.919 1.00122.85 H ATOM 14488 HA LEU A1039 -10.505 7.819 -35.864 1.00114.32 H ATOM 14489 HB2 LEU A1039 -10.240 6.552 -33.379 1.00113.51 H ATOM 14490 HB3 LEU A1039 -9.377 7.830 -33.743 1.00113.51 H ATOM 14491 HG LEU A1039 -11.522 8.951 -34.066 1.00134.10 H ATOM 14492 HD11 LEU A1039 -13.318 8.082 -32.866 1.00153.61 H ATOM 14493 HD12 LEU A1039 -12.893 7.088 -34.031 1.00153.61 H ATOM 14494 HD13 LEU A1039 -12.462 6.785 -32.532 1.00153.61 H ATOM 14495 HD21 LEU A1039 -11.679 9.555 -31.824 1.00128.73 H ATOM 14496 HD22 LEU A1039 -10.742 8.333 -31.432 1.00128.73 H ATOM 14497 HD23 LEU A1039 -10.160 9.538 -32.289 1.00128.73 H ATOM 14498 N PRO A1040 -8.684 5.202 -35.925 1.00118.63 N ANISOU14498 N PRO A1040 13182 16847 15046 2650 -913 2871 N ATOM 14499 CA PRO A1040 -7.448 4.735 -36.568 1.00109.73 C ANISOU14499 CA PRO A1040 12191 15703 13799 2522 -918 2861 C ATOM 14500 C PRO A1040 -7.300 5.244 -38.004 1.00108.14 C ANISOU14500 C PRO A1040 12012 15483 13594 2454 -1017 3019 C ATOM 14501 O PRO A1040 -6.196 5.585 -38.434 1.00 99.62 O ANISOU14501 O PRO A1040 11033 14324 12495 2405 -1021 3020 O ATOM 14502 CB PRO A1040 -7.615 3.215 -36.561 1.00102.06 C ANISOU14502 CB PRO A1040 11232 14878 12668 2410 -899 2824 C ATOM 14503 CG PRO A1040 -8.439 2.942 -35.368 1.00 93.16 C ANISOU14503 CG PRO A1040 10014 13801 11580 2496 -836 2747 C ATOM 14504 CD PRO A1040 -9.383 4.101 -35.234 1.00109.01 C ANISOU14504 CD PRO A1040 11905 15765 13750 2633 -863 2810 C ATOM 14505 HA PRO A1040 -6.670 4.985 -36.045 1.00131.68 H ATOM 14506 HB2 PRO A1040 -8.070 2.930 -37.368 1.00122.47 H ATOM 14507 HB3 PRO A1040 -6.746 2.789 -36.485 1.00122.47 H ATOM 14508 HG2 PRO A1040 -8.932 2.116 -35.498 1.00111.79 H ATOM 14509 HG3 PRO A1040 -7.868 2.877 -34.588 1.00111.79 H ATOM 14510 HD2 PRO A1040 -10.224 3.905 -35.676 1.00130.82 H ATOM 14511 HD3 PRO A1040 -9.517 4.321 -34.299 1.00130.82 H ATOM 14512 N LEU A1041 -8.416 5.303 -38.724 1.00 99.29 N ANISOU14512 N LEU A1041 10793 14442 12490 2451 -1096 3156 N ATOM 14513 CA LEU A1041 -8.427 5.767 -40.106 1.00 95.97 C ANISOU14513 CA LEU A1041 10380 14025 12059 2386 -1199 3322 C ATOM 14514 C LEU A1041 -8.263 7.283 -40.208 1.00 99.20 C ANISOU14514 C LEU A1041 10779 14275 12638 2484 -1236 3391 C ATOM 14515 O LEU A1041 -7.600 7.772 -41.119 1.00 96.47 O ANISOU14515 O LEU A1041 10497 13879 12277 2421 -1289 3485 O ATOM 14516 CB LEU A1041 -9.727 5.345 -40.782 1.00 93.80 C ANISOU14516 CB LEU A1041 9996 13889 11754 2355 -1278 3445 C ATOM 14517 CG LEU A1041 -9.875 5.706 -42.259 1.00 98.25 C ANISOU14517 CG LEU A1041 10558 14487 12286 2278 -1394 3628 C ATOM 14518 CD1 LEU A1041 -8.785 5.075 -43.127 1.00 82.51 C ANISOU14518 CD1 LEU A1041 8691 12538 10122 2122 -1401 3628 C ATOM 14519 CD2 LEU A1041 -11.258 5.278 -42.708 1.00103.74 C ANISOU14519 CD2 LEU A1041 11130 15319 12966 2266 -1465 3729 C ATOM 14520 H LEU A1041 -9.191 5.076 -38.429 1.00119.15 H ATOM 14521 HA LEU A1041 -7.692 5.353 -40.584 1.00115.16 H ATOM 14522 HB2 LEU A1041 -9.805 4.381 -40.713 1.00112.56 H ATOM 14523 HB3 LEU A1041 -10.464 5.762 -40.309 1.00112.56 H ATOM 14524 HG LEU A1041 -9.814 6.669 -42.355 1.00117.90 H ATOM 14525 HD11 LEU A1041 -8.927 5.336 -44.050 1.00 99.02 H ATOM 14526 HD12 LEU A1041 -7.919 5.390 -42.823 1.00 99.02 H ATOM 14527 HD13 LEU A1041 -8.834 4.110 -43.044 1.00 99.02 H ATOM 14528 HD21 LEU A1041 -11.368 5.501 -43.646 1.00124.48 H ATOM 14529 HD22 LEU A1041 -11.349 4.321 -42.583 1.00124.48 H ATOM 14530 HD23 LEU A1041 -11.921 5.747 -42.177 1.00124.48 H HETATM14531 N MSE A1042 -8.882 8.018 -39.286 1.00142.04 N ANISOU14531 N MSE A1042 16120 19624 18225 2637 -1210 3347 N HETATM14532 CA MSE A1042 -8.720 9.469 -39.216 1.00143.75 C ANISOU14532 CA MSE A1042 16325 19668 18625 2747 -1242 3388 C HETATM14533 C MSE A1042 -7.292 9.834 -38.866 1.00150.38 C ANISOU14533 C MSE A1042 17291 20376 19469 2732 -1187 3291 C HETATM14534 O MSE A1042 -6.676 10.690 -39.503 1.00160.58 O ANISOU14534 O MSE A1042 18633 21558 20821 2714 -1238 3378 O HETATM14535 CB MSE A1042 -9.611 10.063 -38.131 1.00154.47 C ANISOU14535 CB MSE A1042 17569 20976 20147 2920 -1208 3316 C HETATM14536 CG MSE A1042 -11.087 9.809 -38.306 1.00167.59 C ANISOU14536 CG MSE A1042 19086 22760 21832 2958 -1254 3398 C HETATM14537 SE MSE A1042 -12.090 10.372 -36.737 1.00199.12 SE ANISOU14537 SE MSE A1042 22935 26717 26004 3175 -1179 3260 SE HETATM14538 CE MSE A1042 -11.125 12.006 -36.281 1.00176.12 C ANISOU14538 CE MSE A1042 20088 23535 23294 3301 -1175 3198 C HETATM14539 H MSE A1042 -9.406 7.697 -38.684 1.00170.45 H HETATM14540 HA MSE A1042 -8.960 9.866 -40.068 1.00172.50 H HETATM14541 HB2 MSE A1042 -9.349 9.687 -37.277 1.00185.37 H HETATM14542 HB3 MSE A1042 -9.480 11.024 -38.117 1.00185.37 H HETATM14543 HG2 MSE A1042 -11.411 10.310 -39.071 1.00201.11 H HETATM14544 HG3 MSE A1042 -11.235 8.860 -38.438 1.00201.11 H HETATM14545 HE1 MSE A1042 -11.530 12.402 -35.494 1.00211.34 H HETATM14546 HE2 MSE A1042 -10.198 11.784 -36.100 1.00211.34 H HETATM14547 HE3 MSE A1042 -11.178 12.622 -37.028 1.00211.34 H ATOM 14548 N SER A1043 -6.778 9.195 -37.823 1.00111.55 N ANISOU14548 N SER A1043 12421 15470 14494 2740 -1084 3115 N ATOM 14549 CA SER A1043 -5.458 9.519 -37.319 1.00104.68 C ANISOU14549 CA SER A1043 11660 14477 13636 2739 -1025 3003 C ATOM 14550 C SER A1043 -4.381 9.149 -38.325 1.00112.42 C ANISOU14550 C SER A1043 12754 15477 14486 2585 -1048 3059 C ATOM 14551 O SER A1043 -3.365 9.838 -38.431 1.00124.55 O ANISOU14551 O SER A1043 14366 16889 16068 2575 -1046 3052 O ATOM 14552 CB SER A1043 -5.216 8.815 -35.989 1.00 98.40 C ANISOU14552 CB SER A1043 10884 13711 12793 2776 -915 2809 C ATOM 14553 OG SER A1043 -5.966 9.429 -34.953 1.00 98.22 O ANISOU14553 OG SER A1043 10769 13640 12911 2933 -882 2737 O ATOM 14554 H SER A1043 -7.177 8.569 -37.390 1.00133.87 H ATOM 14555 HA SER A1043 -5.407 10.475 -37.165 1.00125.61 H ATOM 14556 HB2 SER A1043 -5.486 7.887 -36.068 1.00118.08 H ATOM 14557 HB3 SER A1043 -4.272 8.869 -35.770 1.00118.08 H ATOM 14558 HG SER A1043 -5.826 9.035 -34.224 1.00117.86 H ATOM 14559 N TYR A1044 -4.594 8.068 -39.067 1.00 99.77 N ANISOU14559 N TYR A1044 11157 14030 12720 2465 -1071 3110 N ATOM 14560 CA TYR A1044 -3.631 7.679 -40.090 1.00101.85 C ANISOU14560 CA TYR A1044 11519 14332 12849 2318 -1094 3160 C ATOM 14561 C TYR A1044 -3.698 8.635 -41.268 1.00109.59 C ANISOU14561 C TYR A1044 12488 15269 13883 2290 -1192 3348 C ATOM 14562 O TYR A1044 -2.706 8.841 -41.972 1.00108.07 O ANISOU14562 O TYR A1044 12378 15047 13636 2201 -1206 3392 O ATOM 14563 CB TYR A1044 -3.879 6.252 -40.575 1.00101.29 C ANISOU14563 CB TYR A1044 11454 14439 12591 2199 -1096 3155 C ATOM 14564 CG TYR A1044 -2.885 5.797 -41.621 1.00 94.65 C ANISOU14564 CG TYR A1044 10709 13650 11603 2051 -1115 3188 C ATOM 14565 CD1 TYR A1044 -1.534 6.097 -41.496 1.00 95.33 C ANISOU14565 CD1 TYR A1044 10894 13643 11684 2023 -1069 3118 C ATOM 14566 CD2 TYR A1044 -3.292 5.059 -42.723 1.00 84.38 C ANISOU14566 CD2 TYR A1044 9396 12497 10166 1938 -1177 3281 C ATOM 14567 CE1 TYR A1044 -0.618 5.687 -42.441 1.00 92.86 C ANISOU14567 CE1 TYR A1044 10661 13387 11234 1890 -1079 3142 C ATOM 14568 CE2 TYR A1044 -2.380 4.637 -43.676 1.00 83.69 C ANISOU14568 CE2 TYR A1044 9393 12469 9937 1805 -1189 3299 C ATOM 14569 CZ TYR A1044 -1.044 4.954 -43.529 1.00 87.50 C ANISOU14569 CZ TYR A1044 9968 12862 10417 1783 -1137 3229 C ATOM 14570 OH TYR A1044 -0.125 4.545 -44.469 1.00 82.30 O ANISOU14570 OH TYR A1044 9385 12270 9616 1653 -1143 3241 O ATOM 14571 H TYR A1044 -5.277 7.550 -39.001 1.00119.72 H ATOM 14572 HA TYR A1044 -2.736 7.720 -39.717 1.00122.23 H ATOM 14573 HB2 TYR A1044 -3.814 5.648 -39.819 1.00121.54 H ATOM 14574 HB3 TYR A1044 -4.766 6.202 -40.964 1.00121.54 H ATOM 14575 HD1 TYR A1044 -1.242 6.591 -40.764 1.00114.39 H ATOM 14576 HD2 TYR A1044 -4.191 4.844 -42.823 1.00101.25 H ATOM 14577 HE1 TYR A1044 0.282 5.898 -42.343 1.00111.43 H ATOM 14578 HE2 TYR A1044 -2.666 4.145 -44.412 1.00100.43 H ATOM 14579 HH TYR A1044 -0.509 4.110 -45.076 1.00 98.76 H ATOM 14580 N ARG A1045 -4.873 9.219 -41.483 1.00109.45 N ANISOU14580 N ARG A1045 12365 15250 13973 2366 -1262 3464 N ATOM 14581 CA ARG A1045 -5.058 10.135 -42.593 1.00106.54 C ANISOU14581 CA ARG A1045 11976 14842 13664 2345 -1368 3660 C ATOM 14582 C ARG A1045 -4.490 11.504 -42.252 1.00109.42 C ANISOU14582 C ARG A1045 12363 15002 14210 2432 -1373 3668 C ATOM 14583 O ARG A1045 -3.853 12.135 -43.091 1.00117.68 O ANISOU14583 O ARG A1045 13460 15989 15262 2367 -1426 3785 O ATOM 14584 CB ARG A1045 -6.532 10.236 -42.977 1.00110.72 C ANISOU14584 CB ARG A1045 12378 15445 14244 2394 -1450 3786 C ATOM 14585 CG ARG A1045 -6.764 9.978 -44.448 1.00120.32 C ANISOU14585 CG ARG A1045 13593 16784 15340 2266 -1548 3965 C ATOM 14586 CD ARG A1045 -8.236 9.903 -44.826 1.00124.61 C ANISOU14586 CD ARG A1045 14008 17423 15914 2302 -1629 4081 C ATOM 14587 NE ARG A1045 -8.963 11.150 -44.578 1.00127.23 N ANISOU14587 NE ARG A1045 14248 17626 16466 2447 -1685 4163 N ATOM 14588 CZ ARG A1045 -9.982 11.289 -43.727 1.00126.55 C ANISOU14588 CZ ARG A1045 14050 17527 16504 2582 -1668 4108 C ATOM 14589 NH1 ARG A1045 -10.431 10.262 -43.008 1.00121.76 N ANISOU14589 NH1 ARG A1045 13408 17032 15822 2588 -1596 3981 N ATOM 14590 NH2 ARG A1045 -10.562 12.473 -43.594 1.00126.89 N ANISOU14590 NH2 ARG A1045 14014 17445 16754 2713 -1726 4184 N ATOM 14591 H ARG A1045 -5.574 9.099 -41.000 1.00131.35 H ATOM 14592 HA ARG A1045 -4.574 9.796 -43.362 1.00127.85 H ATOM 14593 HB2 ARG A1045 -7.037 9.579 -42.473 1.00132.86 H ATOM 14594 HB3 ARG A1045 -6.852 11.129 -42.774 1.00132.86 H ATOM 14595 HG2 ARG A1045 -6.362 10.697 -44.960 1.00144.39 H ATOM 14596 HG3 ARG A1045 -6.352 9.133 -44.687 1.00144.39 H ATOM 14597 HD2 ARG A1045 -8.307 9.699 -45.772 1.00149.53 H ATOM 14598 HD3 ARG A1045 -8.658 9.202 -44.305 1.00149.53 H ATOM 14599 HE ARG A1045 -8.715 11.848 -45.015 1.00152.67 H ATOM 14600 HH11 ARG A1045 -10.063 9.489 -43.086 1.00146.11 H ATOM 14601 HH12 ARG A1045 -11.088 10.373 -42.465 1.00146.11 H ATOM 14602 HH21 ARG A1045 -10.280 13.144 -44.053 1.00152.27 H ATOM 14603 HH22 ARG A1045 -11.218 12.571 -43.047 1.00152.27 H ATOM 14604 N ASN A1046 -4.710 11.959 -41.023 1.00112.16 N ANISOU14604 N ASN A1046 12673 15242 14702 2576 -1319 3543 N ATOM 14605 CA ASN A1046 -4.121 13.219 -40.581 1.00125.61 C ANISOU14605 CA ASN A1046 14402 16740 16584 2663 -1319 3522 C ATOM 14606 C ASN A1046 -2.606 13.096 -40.502 1.00127.48 C ANISOU14606 C ASN A1046 14767 16922 16746 2576 -1260 3437 C ATOM 14607 O ASN A1046 -1.883 14.078 -40.666 1.00128.14 O ANISOU14607 O ASN A1046 14896 16858 16934 2581 -1286 3479 O ATOM 14608 CB ASN A1046 -4.673 13.645 -39.221 1.00126.98 C ANISOU14608 CB ASN A1046 14508 16826 16914 2836 -1266 3379 C ATOM 14609 CG ASN A1046 -6.133 14.028 -39.280 1.00136.45 C ANISOU14609 CG ASN A1046 15569 18047 18227 2941 -1330 3467 C ATOM 14610 OD1 ASN A1046 -6.952 13.510 -38.520 1.00142.02 O ANISOU14610 OD1 ASN A1046 16197 18836 18927 3013 -1281 3375 O ATOM 14611 ND2 ASN A1046 -6.470 14.940 -40.187 1.00138.91 N ANISOU14611 ND2 ASN A1046 15845 18289 18646 2949 -1440 3651 N ATOM 14612 H ASN A1046 -5.191 11.562 -40.430 1.00134.59 H ATOM 14613 HA ASN A1046 -4.335 13.912 -41.224 1.00150.73 H ATOM 14614 HB2 ASN A1046 -4.581 12.907 -38.597 1.00152.38 H ATOM 14615 HB3 ASN A1046 -4.173 14.413 -38.903 1.00152.38 H ATOM 14616 HD21 ASN A1046 -7.289 15.192 -40.260 1.00166.69 H ATOM 14617 HD22 ASN A1046 -5.869 15.278 -40.701 1.00166.69 H ATOM 14618 N SER A1047 -2.139 11.879 -40.241 1.00104.05 N ANISOU14618 N SER A1047 11853 14074 13605 2497 -1184 3318 N ATOM 14619 CA SER A1047 -0.715 11.584 -40.168 1.00 99.25 C ANISOU14619 CA SER A1047 11361 13440 12909 2410 -1125 3226 C ATOM 14620 C SER A1047 -0.010 11.905 -41.477 1.00100.15 C ANISOU14620 C SER A1047 11532 13558 12963 2283 -1186 3379 C ATOM 14621 O SER A1047 1.181 12.223 -41.493 1.00 90.58 O ANISOU14621 O SER A1047 10401 12265 11750 2234 -1157 3344 O ATOM 14622 CB SER A1047 -0.510 10.108 -39.838 1.00 98.94 C ANISOU14622 CB SER A1047 11357 13549 12686 2340 -1051 3098 C ATOM 14623 OG SER A1047 0.661 9.613 -40.458 1.00102.56 O ANISOU14623 OG SER A1047 11913 14048 13007 2206 -1033 3088 O ATOM 14624 H SER A1047 -2.639 11.194 -40.100 1.00124.85 H ATOM 14625 HA SER A1047 -0.311 12.115 -39.464 1.00119.10 H ATOM 14626 HB2 SER A1047 -0.426 10.007 -38.877 1.00118.73 H ATOM 14627 HB3 SER A1047 -1.275 9.604 -40.159 1.00118.73 H ATOM 14628 HG SER A1047 0.601 9.694 -41.292 1.00123.07 H ATOM 14629 N LEU A1048 -0.754 11.803 -42.573 1.00116.95 N ANISOU14629 N LEU A1048 13612 15788 15034 2225 -1269 3549 N ATOM 14630 CA LEU A1048 -0.215 12.060 -43.903 1.00124.28 C ANISOU14630 CA LEU A1048 14584 16751 15885 2096 -1333 3711 C ATOM 14631 C LEU A1048 -0.426 13.519 -44.304 1.00126.99 C ANISOU14631 C LEU A1048 14894 16946 16411 2149 -1422 3877 C ATOM 14632 O LEU A1048 0.495 14.177 -44.784 1.00128.11 O ANISOU14632 O LEU A1048 15095 17007 16574 2087 -1440 3947 O ATOM 14633 CB LEU A1048 -0.870 11.130 -44.925 1.00121.81 C ANISOU14633 CB LEU A1048 14243 16642 15398 1994 -1382 3808 C ATOM 14634 CG LEU A1048 -0.722 9.632 -44.639 1.00107.12 C ANISOU14634 CG LEU A1048 12413 14930 13358 1931 -1308 3657 C ATOM 14635 CD1 LEU A1048 -1.839 8.858 -45.310 1.00 93.00 C ANISOU14635 CD1 LEU A1048 10558 13313 11467 1887 -1367 3739 C ATOM 14636 CD2 LEU A1048 0.642 9.123 -45.095 1.00 99.87 C ANISOU14636 CD2 LEU A1048 11599 14056 12290 1801 -1262 3602 C ATOM 14637 H LEU A1048 -1.586 11.584 -42.573 1.00140.33 H ATOM 14638 HA LEU A1048 0.739 11.882 -43.899 1.00149.13 H ATOM 14639 HB2 LEU A1048 -1.818 11.328 -44.957 1.00146.17 H ATOM 14640 HB3 LEU A1048 -0.473 11.301 -45.794 1.00146.17 H ATOM 14641 HG LEU A1048 -0.791 9.486 -43.682 1.00128.54 H ATOM 14642 HD11 LEU A1048 -1.729 7.914 -45.118 1.00111.61 H ATOM 14643 HD12 LEU A1048 -2.690 9.169 -44.965 1.00111.61 H ATOM 14644 HD13 LEU A1048 -1.795 9.009 -46.268 1.00111.61 H ATOM 14645 HD21 LEU A1048 0.705 8.174 -44.901 1.00119.84 H ATOM 14646 HD22 LEU A1048 0.732 9.273 -46.049 1.00119.84 H ATOM 14647 HD23 LEU A1048 1.334 9.605 -44.617 1.00119.84 H ATOM 14648 N LEU A1049 -1.641 14.016 -44.096 1.00114.39 N ANISOU14648 N LEU A1049 13200 15313 14952 2265 -1479 3939 N ATOM 14649 CA LEU A1049 -1.979 15.404 -44.396 1.00109.01 C ANISOU14649 CA LEU A1049 12473 14475 14469 2336 -1572 4092 C ATOM 14650 C LEU A1049 -1.440 16.341 -43.319 1.00110.53 C ANISOU14650 C LEU A1049 12688 14451 14858 2452 -1530 3974 C ATOM 14651 O LEU A1049 -0.756 17.322 -43.616 1.00111.42 O ANISOU14651 O LEU A1049 12840 14419 15073 2435 -1570 4055 O ATOM 14652 CB LEU A1049 -3.494 15.557 -44.497 1.00105.83 C ANISOU14652 CB LEU A1049 11949 14112 14150 2428 -1646 4184 C ATOM 14653 CG LEU A1049 -4.181 14.533 -45.398 1.00111.81 C ANISOU14653 CG LEU A1049 12673 15092 14718 2328 -1684 4273 C ATOM 14654 CD1 LEU A1049 -5.683 14.590 -45.207 1.00110.57 C ANISOU14654 CD1 LEU A1049 12387 14972 14654 2438 -1737 4318 C ATOM 14655 CD2 LEU A1049 -3.809 14.768 -46.851 1.00117.69 C ANISOU14655 CD2 LEU A1049 13456 15894 15367 2186 -1772 4480 C ATOM 14656 H LEU A1049 -2.297 13.562 -43.776 1.00137.27 H ATOM 14657 HA LEU A1049 -1.587 15.656 -45.246 1.00130.81 H ATOM 14658 HB2 LEU A1049 -3.874 15.468 -43.609 1.00127.00 H ATOM 14659 HB3 LEU A1049 -3.693 16.439 -44.849 1.00127.00 H ATOM 14660 HG LEU A1049 -3.882 13.644 -45.152 1.00134.17 H ATOM 14661 HD11 LEU A1049 -6.100 13.934 -45.787 1.00132.69 H ATOM 14662 HD12 LEU A1049 -5.890 14.393 -44.280 1.00132.69 H ATOM 14663 HD13 LEU A1049 -5.996 15.480 -45.434 1.00132.69 H ATOM 14664 HD21 LEU A1049 -4.257 14.107 -47.402 1.00141.23 H ATOM 14665 HD22 LEU A1049 -4.091 15.659 -47.109 1.00141.23 H ATOM 14666 HD23 LEU A1049 -2.848 14.683 -46.948 1.00141.23 H TER 14667 LEU A1049 ATOM 14668 N LYS B 321 16.822 37.960 -24.815 1.00115.71 N ANISOU14668 N LYS B 321 15096 14623 14245 -2431 -575 2316 N ATOM 14669 CA LYS B 321 17.256 37.498 -23.497 1.00121.22 C ANISOU14669 CA LYS B 321 15765 15322 14970 -2271 -564 2214 C ATOM 14670 C LYS B 321 18.716 37.015 -23.491 1.00117.49 C ANISOU14670 C LYS B 321 15271 14923 14448 -2274 -534 2002 C ATOM 14671 O LYS B 321 19.106 36.145 -24.279 1.00104.65 O ANISOU14671 O LYS B 321 13650 13351 12762 -2346 -546 1941 O ATOM 14672 CB LYS B 321 16.313 36.406 -22.988 1.00116.41 C ANISOU14672 CB LYS B 321 15160 14688 14383 -2169 -606 2298 C ATOM 14673 CG LYS B 321 14.900 36.918 -22.765 1.00125.07 C ANISOU14673 CG LYS B 321 16274 15709 15538 -2140 -633 2498 C ATOM 14674 CD LYS B 321 13.940 35.818 -22.345 1.00131.15 C ANISOU14674 CD LYS B 321 17048 16454 16327 -2049 -675 2585 C ATOM 14675 CE LYS B 321 13.582 34.905 -23.505 1.00123.96 C ANISOU14675 CE LYS B 321 16158 15575 15368 -2149 -709 2626 C ATOM 14676 NZ LYS B 321 12.574 33.891 -23.095 1.00116.20 N ANISOU14676 NZ LYS B 321 15167 14570 14415 -2025 -743 2669 N ATOM 14677 HA LYS B 321 17.197 38.243 -22.878 1.00145.46 H ATOM 14678 HB2 LYS B 321 16.275 35.690 -23.641 1.00139.69 H ATOM 14679 HB3 LYS B 321 16.647 36.068 -22.142 1.00139.69 H ATOM 14680 HG2 LYS B 321 14.913 37.590 -22.065 1.00150.08 H ATOM 14681 HG3 LYS B 321 14.570 37.305 -23.591 1.00150.08 H ATOM 14682 HD2 LYS B 321 14.356 35.279 -21.653 1.00157.38 H ATOM 14683 HD3 LYS B 321 13.122 36.218 -22.011 1.00157.38 H ATOM 14684 HE2 LYS B 321 13.206 35.434 -24.226 1.00148.75 H ATOM 14685 HE3 LYS B 321 14.378 34.441 -23.806 1.00148.75 H ATOM 14686 HZ1 LYS B 321 12.375 33.364 -23.784 1.00139.44 H ATOM 14687 HZ2 LYS B 321 12.898 33.391 -22.433 1.00139.44 H ATOM 14688 HZ3 LYS B 321 11.832 34.295 -22.815 1.00139.44 H ATOM 14689 N ARG B 322 19.495 37.593 -22.574 1.00112.31 N ANISOU14689 N ARG B 322 14589 14266 13818 -2193 -497 1891 N ATOM 14690 CA ARG B 322 20.946 37.397 -22.478 1.00101.79 C ANISOU14690 CA ARG B 322 13233 12998 12446 -2194 -462 1685 C ATOM 14691 C ARG B 322 21.371 35.927 -22.448 1.00 96.73 C ANISOU14691 C ARG B 322 12584 12409 11761 -2154 -480 1582 C ATOM 14692 O ARG B 322 20.774 35.112 -21.745 1.00 99.71 O ANISOU14692 O ARG B 322 12960 12765 12161 -2040 -507 1624 O ATOM 14693 CB ARG B 322 21.483 38.071 -21.204 1.00 97.60 C ANISOU14693 CB ARG B 322 12674 12446 11964 -2070 -427 1600 C ATOM 14694 CG ARG B 322 21.116 39.545 -21.014 1.00102.67 C ANISOU14694 CG ARG B 322 13318 13033 12658 -2085 -408 1689 C ATOM 14695 CD ARG B 322 21.994 40.475 -21.842 1.00101.96 C ANISOU14695 CD ARG B 322 13228 12974 12537 -2221 -370 1615 C ATOM 14696 NE ARG B 322 23.390 40.447 -21.404 1.00 97.31 N ANISOU14696 NE ARG B 322 12609 12435 11928 -2185 -331 1410 N ATOM 14697 CZ ARG B 322 23.910 41.237 -20.466 1.00 95.01 C ANISOU14697 CZ ARG B 322 12293 12126 11679 -2103 -297 1338 C ATOM 14698 NH1 ARG B 322 23.162 42.138 -19.844 1.00 95.14 N ANISOU14698 NH1 ARG B 322 12311 12077 11761 -2045 -297 1452 N ATOM 14699 NH2 ARG B 322 25.193 41.125 -20.147 1.00 87.70 N ANISOU14699 NH2 ARG B 322 11341 11250 10732 -2076 -264 1147 N ATOM 14700 H ARG B 322 19.191 38.125 -21.971 1.00134.77 H ATOM 14701 HA ARG B 322 21.372 37.816 -23.242 1.00122.15 H ATOM 14702 HB2 ARG B 322 21.141 37.587 -20.436 1.00117.12 H ATOM 14703 HB3 ARG B 322 22.452 38.014 -21.214 1.00117.12 H ATOM 14704 HG2 ARG B 322 20.195 39.680 -21.286 1.00123.20 H ATOM 14705 HG3 ARG B 322 21.225 39.782 -20.079 1.00123.20 H ATOM 14706 HD2 ARG B 322 21.963 40.198 -22.771 1.00122.35 H ATOM 14707 HD3 ARG B 322 21.667 41.384 -21.753 1.00122.35 H ATOM 14708 HE ARG B 322 23.913 39.878 -21.780 1.00116.77 H ATOM 14709 HH11 ARG B 322 22.329 42.217 -20.044 1.00114.17 H ATOM 14710 HH12 ARG B 322 23.509 42.642 -19.240 1.00114.17 H ATOM 14711 HH21 ARG B 322 25.686 40.544 -20.545 1.00105.24 H ATOM 14712 HH22 ARG B 322 25.531 41.634 -19.542 1.00105.24 H ATOM 14713 N LYS B 323 22.421 35.599 -23.194 1.00 76.53 N ANISOU14713 N LYS B 323 10021 9919 9139 -2244 -464 1445 N ATOM 14714 CA LYS B 323 23.009 34.265 -23.136 1.00 81.47 C ANISOU14714 CA LYS B 323 10635 10600 9719 -2206 -476 1323 C ATOM 14715 C LYS B 323 23.946 34.182 -21.926 1.00 75.96 C ANISOU14715 C LYS B 323 9906 9917 9038 -2072 -447 1162 C ATOM 14716 O LYS B 323 24.494 33.121 -21.620 1.00 66.53 O ANISOU14716 O LYS B 323 8699 8764 7816 -2011 -453 1047 O ATOM 14717 CB LYS B 323 23.773 33.952 -24.428 1.00 88.72 C ANISOU14717 CB LYS B 323 11560 11587 10561 -2358 -470 1238 C ATOM 14718 CG LYS B 323 22.993 34.235 -25.707 1.00 94.00 C ANISOU14718 CG LYS B 323 12260 12244 11210 -2506 -492 1384 C ATOM 14719 CD LYS B 323 22.714 32.960 -26.491 1.00 99.39 C ANISOU14719 CD LYS B 323 12957 12963 11842 -2556 -532 1402 C ATOM 14720 CE LYS B 323 21.821 33.224 -27.698 1.00102.76 C ANISOU14720 CE LYS B 323 13416 13373 12254 -2691 -557 1561 C ATOM 14721 NZ LYS B 323 22.507 34.051 -28.729 1.00110.61 N ANISOU14721 NZ LYS B 323 14417 14401 13207 -2843 -527 1516 N ATOM 14722 H LYS B 323 22.813 36.133 -23.743 1.00 91.84 H ATOM 14723 HA LYS B 323 22.306 33.606 -23.027 1.00 97.76 H ATOM 14724 HB2 LYS B 323 24.580 34.490 -24.450 1.00106.46 H ATOM 14725 HB3 LYS B 323 24.008 33.011 -24.429 1.00106.46 H ATOM 14726 HG2 LYS B 323 22.143 34.643 -25.479 1.00112.80 H ATOM 14727 HG3 LYS B 323 23.510 34.831 -26.271 1.00112.80 H ATOM 14728 HD2 LYS B 323 23.552 32.591 -26.809 1.00119.26 H ATOM 14729 HD3 LYS B 323 22.264 32.323 -25.915 1.00119.26 H ATOM 14730 HE2 LYS B 323 21.575 32.378 -28.103 1.00123.31 H ATOM 14731 HE3 LYS B 323 21.026 33.700 -27.408 1.00123.31 H ATOM 14732 HZ1 LYS B 323 21.963 34.189 -29.419 1.00132.73 H ATOM 14733 HZ2 LYS B 323 22.739 34.837 -28.382 1.00132.73 H ATOM 14734 HZ3 LYS B 323 23.239 33.634 -29.015 1.00132.73 H ATOM 14735 N LEU B 324 24.121 35.316 -21.248 1.00 70.36 N ANISOU14735 N LEU B 324 9184 9174 8377 -2026 -415 1155 N ATOM 14736 CA LEU B 324 24.976 35.417 -20.070 1.00 64.36 C ANISOU14736 CA LEU B 324 8393 8421 7639 -1899 -385 1010 C ATOM 14737 C LEU B 324 24.452 34.557 -18.929 1.00 62.05 C ANISOU14737 C LEU B 324 8094 8103 7381 -1731 -409 1031 C ATOM 14738 O LEU B 324 23.359 34.806 -18.435 1.00 77.97 O ANISOU14738 O LEU B 324 10120 10056 9450 -1667 -429 1180 O ATOM 14739 CB LEU B 324 25.038 36.876 -19.603 1.00 66.34 C ANISOU14739 CB LEU B 324 8634 8630 7942 -1886 -351 1032 C ATOM 14740 CG LEU B 324 25.850 37.167 -18.333 1.00 69.26 C ANISOU14740 CG LEU B 324 8972 9001 8345 -1750 -318 895 C ATOM 14741 CD1 LEU B 324 27.364 37.119 -18.597 1.00 61.44 C ANISOU14741 CD1 LEU B 324 7960 8080 7305 -1797 -282 686 C ATOM 14742 CD2 LEU B 324 25.434 38.499 -17.710 1.00 67.68 C ANISOU14742 CD2 LEU B 324 8767 8738 8212 -1709 -300 976 C ATOM 14743 H LEU B 324 23.743 36.059 -21.459 1.00 84.43 H ATOM 14744 HA LEU B 324 25.874 35.124 -20.292 1.00 77.23 H ATOM 14745 HB2 LEU B 324 25.426 37.405 -20.318 1.00 79.61 H ATOM 14746 HB3 LEU B 324 24.132 37.179 -19.438 1.00 79.61 H ATOM 14747 HG LEU B 324 25.652 36.474 -17.684 1.00 83.12 H ATOM 14748 HD11 LEU B 324 27.834 37.308 -17.769 1.00 73.73 H ATOM 14749 HD12 LEU B 324 27.600 36.235 -18.917 1.00 73.73 H ATOM 14750 HD13 LEU B 324 27.589 37.785 -19.265 1.00 73.73 H ATOM 14751 HD21 LEU B 324 25.964 38.653 -16.912 1.00 81.22 H ATOM 14752 HD22 LEU B 324 25.588 39.209 -18.352 1.00 81.22 H ATOM 14753 HD23 LEU B 324 24.493 38.459 -17.480 1.00 81.22 H ATOM 14754 N ILE B 325 25.229 33.567 -18.487 1.00 56.20 N ANISOU14754 N ILE B 325 7336 7407 6610 -1657 -408 883 N ATOM 14755 CA ILE B 325 24.789 32.684 -17.399 1.00 49.42 C ANISOU14755 CA ILE B 325 6472 6527 5781 -1496 -430 894 C ATOM 14756 C ILE B 325 24.685 33.404 -16.054 1.00 49.33 C ANISOU14756 C ILE B 325 6443 6466 5837 -1353 -411 898 C ATOM 14757 O ILE B 325 25.658 33.994 -15.582 1.00 56.34 O ANISOU14757 O ILE B 325 7307 7371 6729 -1322 -373 765 O ATOM 14758 CB ILE B 325 25.723 31.474 -17.232 1.00 42.37 C ANISOU14758 CB ILE B 325 5565 5697 4839 -1450 -432 724 C ATOM 14759 CG1 ILE B 325 25.745 30.662 -18.520 1.00 44.34 C ANISOU14759 CG1 ILE B 325 5831 5993 5023 -1582 -456 728 C ATOM 14760 CG2 ILE B 325 25.276 30.600 -16.052 1.00 41.85 C ANISOU14760 CG2 ILE B 325 5493 5604 4804 -1277 -453 735 C ATOM 14761 CD1 ILE B 325 26.598 29.442 -18.447 1.00 49.90 C ANISOU14761 CD1 ILE B 325 6524 6760 5677 -1547 -462 570 C ATOM 14762 H ILE B 325 26.011 33.385 -18.797 1.00 67.44 H ATOM 14763 HA ILE B 325 23.907 32.345 -17.618 1.00 59.31 H ATOM 14764 HB ILE B 325 26.620 31.798 -17.055 1.00 50.85 H ATOM 14765 HG12 ILE B 325 24.841 30.380 -18.727 1.00 53.21 H ATOM 14766 HG13 ILE B 325 26.087 31.221 -19.235 1.00 53.21 H ATOM 14767 HG21 ILE B 325 25.882 29.846 -15.971 1.00 50.22 H ATOM 14768 HG22 ILE B 325 25.297 31.130 -15.240 1.00 50.22 H ATOM 14769 HG23 ILE B 325 24.374 30.283 -16.218 1.00 50.22 H ATOM 14770 HD11 ILE B 325 26.561 28.981 -19.299 1.00 59.88 H ATOM 14771 HD12 ILE B 325 27.510 29.706 -18.252 1.00 59.88 H ATOM 14772 HD13 ILE B 325 26.262 28.865 -17.743 1.00 59.88 H ATOM 14773 N VAL B 326 23.503 33.341 -15.442 1.00 51.18 N ANISOU14773 N VAL B 326 6687 6638 6122 -1265 -436 1048 N ATOM 14774 CA VAL B 326 23.286 33.944 -14.134 1.00 51.29 C ANISOU14774 CA VAL B 326 6685 6602 6201 -1121 -422 1065 C ATOM 14775 C VAL B 326 22.608 32.950 -13.217 1.00 50.32 C ANISOU14775 C VAL B 326 6564 6453 6104 -974 -451 1112 C ATOM 14776 O VAL B 326 21.587 32.377 -13.569 1.00 60.71 O ANISOU14776 O VAL B 326 7900 7745 7421 -992 -488 1248 O ATOM 14777 CB VAL B 326 22.429 35.214 -14.216 1.00 45.57 C ANISOU14777 CB VAL B 326 5971 5815 5528 -1159 -419 1223 C ATOM 14778 CG1 VAL B 326 22.354 35.885 -12.838 1.00 44.93 C ANISOU14778 CG1 VAL B 326 5870 5688 5513 -1009 -401 1219 C ATOM 14779 CG2 VAL B 326 23.008 36.173 -15.247 1.00 46.60 C ANISOU14779 CG2 VAL B 326 6104 5970 5632 -1317 -393 1192 C ATOM 14780 H VAL B 326 22.809 32.952 -15.768 1.00 61.42 H ATOM 14781 HA VAL B 326 24.143 34.181 -13.745 1.00 61.55 H ATOM 14782 HB VAL B 326 21.529 34.977 -14.490 1.00 54.68 H ATOM 14783 HG11 VAL B 326 21.810 36.685 -12.906 1.00 53.92 H ATOM 14784 HG12 VAL B 326 21.956 35.265 -12.207 1.00 53.92 H ATOM 14785 HG13 VAL B 326 23.251 36.118 -12.552 1.00 53.92 H ATOM 14786 HG21 VAL B 326 22.454 36.968 -15.285 1.00 55.92 H ATOM 14787 HG22 VAL B 326 23.911 36.411 -14.984 1.00 55.92 H ATOM 14788 HG23 VAL B 326 23.019 35.736 -16.113 1.00 55.92 H ATOM 14789 N ASP B 327 23.185 32.753 -12.038 1.00 52.27 N ANISOU14789 N ASP B 327 6788 6704 6369 -830 -434 999 N ATOM 14790 CA ASP B 327 22.726 31.715 -11.129 1.00 45.77 C ANISOU14790 CA ASP B 327 5965 5864 5562 -684 -458 1015 C ATOM 14791 C ASP B 327 21.765 32.280 -10.104 1.00 47.84 C ANISOU14791 C ASP B 327 6226 6053 5899 -566 -462 1143 C ATOM 14792 O ASP B 327 22.100 33.204 -9.372 1.00 48.82 O ANISOU14792 O ASP B 327 6333 6157 6060 -504 -434 1103 O ATOM 14793 CB ASP B 327 23.921 31.054 -10.439 1.00 42.48 C ANISOU14793 CB ASP B 327 5526 5497 5119 -590 -439 812 C ATOM 14794 CG ASP B 327 24.796 30.272 -11.411 1.00 48.45 C ANISOU14794 CG ASP B 327 6283 6326 5799 -695 -441 688 C ATOM 14795 OD1 ASP B 327 24.240 29.639 -12.332 1.00 49.35 O ANISOU14795 OD1 ASP B 327 6418 6449 5883 -786 -471 771 O ATOM 14796 OD2 ASP B 327 26.039 30.295 -11.265 1.00 51.23 O ANISOU14796 OD2 ASP B 327 6615 6727 6123 -688 -412 508 O ATOM 14797 H ASP B 327 23.849 33.211 -11.741 1.00 62.73 H ATOM 14798 HA ASP B 327 22.258 31.034 -11.637 1.00 54.92 H ATOM 14799 HB2 ASP B 327 24.469 31.741 -10.027 1.00 50.98 H ATOM 14800 HB3 ASP B 327 23.596 30.438 -9.764 1.00 50.98 H ATOM 14801 N SER B 328 20.559 31.720 -10.058 1.00 63.08 N ANISOU14801 N SER B 328 8175 7943 7850 -535 -498 1297 N ATOM 14802 CA SER B 328 19.555 32.200 -9.124 1.00 55.51 C ANISOU14802 CA SER B 328 7217 6914 6960 -425 -506 1430 C ATOM 14803 C SER B 328 19.944 31.799 -7.710 1.00 47.04 C ANISOU14803 C SER B 328 6124 5837 5912 -242 -494 1334 C ATOM 14804 O SER B 328 19.821 32.593 -6.782 1.00 41.09 O ANISOU14804 O SER B 328 5358 5045 5211 -148 -477 1351 O ATOM 14805 CB SER B 328 18.182 31.646 -9.470 1.00 60.82 C ANISOU14805 CB SER B 328 7914 7546 7647 -442 -547 1615 C ATOM 14806 OG SER B 328 17.257 31.967 -8.443 1.00 87.37 O ANISOU14806 OG SER B 328 11275 10844 11077 -317 -554 1730 O ATOM 14807 H SER B 328 20.302 31.067 -10.554 1.00 75.70 H ATOM 14808 HA SER B 328 19.513 33.168 -9.167 1.00 66.61 H ATOM 14809 HB2 SER B 328 17.882 32.039 -10.304 1.00 72.98 H ATOM 14810 HB3 SER B 328 18.240 30.682 -9.556 1.00 72.98 H ATOM 14811 HG SER B 328 16.498 31.662 -8.634 1.00104.84 H ATOM 14812 N VAL B 329 20.432 30.568 -7.567 1.00 58.91 N ANISOU14812 N VAL B 329 7625 7382 7376 -194 -503 1230 N ATOM 14813 CA VAL B 329 20.992 30.082 -6.307 1.00 60.20 C ANISOU14813 CA VAL B 329 7771 7553 7551 -27 -490 1111 C ATOM 14814 C VAL B 329 22.514 29.869 -6.441 1.00 48.04 C ANISOU14814 C VAL B 329 6212 6083 5959 -48 -463 892 C ATOM 14815 O VAL B 329 22.976 29.382 -7.467 1.00 51.47 O ANISOU14815 O VAL B 329 6653 6567 6337 -166 -470 836 O ATOM 14816 CB VAL B 329 20.264 28.790 -5.883 1.00 48.87 C ANISOU14816 CB VAL B 329 6348 6103 6118 66 -524 1172 C ATOM 14817 CG1 VAL B 329 20.977 28.102 -4.736 1.00 54.92 C ANISOU14817 CG1 VAL B 329 7098 6889 6882 224 -512 1029 C ATOM 14818 CG2 VAL B 329 18.838 29.126 -5.493 1.00 40.21 C ANISOU14818 CG2 VAL B 329 5263 4932 5082 115 -544 1374 C ATOM 14819 H VAL B 329 20.450 29.984 -8.199 1.00 70.69 H ATOM 14820 HA VAL B 329 20.843 30.749 -5.619 1.00 72.25 H ATOM 14821 HB VAL B 329 20.236 28.178 -6.634 1.00 58.65 H ATOM 14822 HG11 VAL B 329 20.490 27.297 -4.499 1.00 65.91 H ATOM 14823 HG12 VAL B 329 21.877 27.874 -5.016 1.00 65.91 H ATOM 14824 HG13 VAL B 329 21.009 28.705 -3.977 1.00 65.91 H ATOM 14825 HG21 VAL B 329 18.384 28.311 -5.226 1.00 48.25 H ATOM 14826 HG22 VAL B 329 18.853 29.754 -4.753 1.00 48.25 H ATOM 14827 HG23 VAL B 329 18.387 29.522 -6.255 1.00 48.25 H ATOM 14828 N LYS B 330 23.279 30.234 -5.409 1.00 42.79 N ANISOU14828 N LYS B 330 5523 5422 5313 66 -434 769 N ATOM 14829 CA LYS B 330 24.748 30.230 -5.485 1.00 51.77 C ANISOU14829 CA LYS B 330 6641 6623 6408 47 -405 559 C ATOM 14830 C LYS B 330 25.427 29.315 -4.468 1.00 50.16 C ANISOU14830 C LYS B 330 6423 6444 6193 197 -400 415 C ATOM 14831 O LYS B 330 26.526 28.838 -4.717 1.00 44.67 O ANISOU14831 O LYS B 330 5717 5809 5447 172 -389 249 O ATOM 14832 CB LYS B 330 25.294 31.644 -5.294 1.00 47.19 C ANISOU14832 CB LYS B 330 6041 6033 5856 28 -367 512 C ATOM 14833 CG LYS B 330 24.745 32.668 -6.272 1.00 44.86 C ANISOU14833 CG LYS B 330 5759 5714 5572 -121 -367 640 C ATOM 14834 CD LYS B 330 25.234 34.068 -5.934 1.00 49.56 C ANISOU14834 CD LYS B 330 6334 6294 6203 -121 -330 598 C ATOM 14835 CE LYS B 330 24.764 34.516 -4.557 1.00 54.75 C ANISOU14835 CE LYS B 330 6979 6896 6927 44 -325 644 C ATOM 14836 NZ LYS B 330 25.233 35.873 -4.199 1.00 54.33 N ANISOU14836 NZ LYS B 330 6905 6827 6911 49 -290 602 N ATOM 14837 H LYS B 330 22.971 30.490 -4.648 1.00 51.35 H ATOM 14838 HA LYS B 330 25.011 29.930 -6.370 1.00 62.13 H ATOM 14839 HB2 LYS B 330 25.072 31.943 -4.399 1.00 56.63 H ATOM 14840 HB3 LYS B 330 26.257 31.621 -5.401 1.00 56.63 H ATOM 14841 HG2 LYS B 330 25.044 32.449 -7.168 1.00 53.83 H ATOM 14842 HG3 LYS B 330 23.776 32.666 -6.230 1.00 53.83 H ATOM 14843 HD2 LYS B 330 26.204 34.078 -5.940 1.00 59.47 H ATOM 14844 HD3 LYS B 330 24.889 34.694 -6.590 1.00 59.47 H ATOM 14845 HE2 LYS B 330 23.794 34.521 -4.541 1.00 65.70 H ATOM 14846 HE3 LYS B 330 25.103 33.897 -3.892 1.00 65.70 H ATOM 14847 HZ1 LYS B 330 24.936 36.093 -3.389 1.00 65.20 H ATOM 14848 HZ2 LYS B 330 26.122 35.896 -4.197 1.00 65.20 H ATOM 14849 HZ3 LYS B 330 24.929 36.465 -4.790 1.00 65.20 H ATOM 14850 N GLU B 331 24.791 29.102 -3.318 1.00 54.95 N ANISOU14850 N GLU B 331 7029 7005 6846 353 -409 475 N ATOM 14851 CA GLU B 331 25.326 28.208 -2.294 1.00 52.59 C ANISOU14851 CA GLU B 331 6719 6724 6539 506 -407 352 C ATOM 14852 C GLU B 331 24.393 27.033 -2.052 1.00 54.35 C ANISOU14852 C GLU B 331 6962 6924 6764 575 -444 454 C ATOM 14853 O GLU B 331 23.178 27.187 -2.107 1.00 48.60 O ANISOU14853 O GLU B 331 6249 6143 6072 570 -464 634 O ATOM 14854 CB GLU B 331 25.505 28.954 -0.967 1.00 56.36 C ANISOU14854 CB GLU B 331 7176 7169 7070 655 -382 315 C ATOM 14855 CG GLU B 331 26.599 30.001 -0.967 1.00 64.07 C ANISOU14855 CG GLU B 331 8129 8171 8045 620 -343 181 C ATOM 14856 CD GLU B 331 26.845 30.577 0.426 1.00 77.98 C ANISOU14856 CD GLU B 331 9868 9904 9856 783 -320 126 C ATOM 14857 OE1 GLU B 331 27.052 29.780 1.375 1.00 65.80 O ANISOU14857 OE1 GLU B 331 8321 8367 8314 928 -324 55 O ATOM 14858 OE2 GLU B 331 26.819 31.825 0.573 1.00 84.12 O ANISOU14858 OE2 GLU B 331 10633 10654 10674 767 -299 157 O ATOM 14859 H GLU B 331 24.042 29.466 -3.105 1.00 65.94 H ATOM 14860 HA GLU B 331 26.189 27.867 -2.577 1.00 63.11 H ATOM 14861 HB2 GLU B 331 24.672 29.401 -0.750 1.00 67.63 H ATOM 14862 HB3 GLU B 331 25.718 28.308 -0.276 1.00 67.63 H ATOM 14863 HG2 GLU B 331 27.425 29.598 -1.277 1.00 76.89 H ATOM 14864 HG3 GLU B 331 26.343 30.730 -1.554 1.00 76.89 H ATOM 14865 N LEU B 332 24.970 25.862 -1.794 1.00 44.59 N ANISOU14865 N LEU B 332 5725 5728 5488 638 -451 335 N ATOM 14866 CA LEU B 332 24.263 24.812 -1.088 1.00 41.89 C ANISOU14866 CA LEU B 332 5395 5360 5160 761 -477 397 C ATOM 14867 C LEU B 332 24.142 25.333 0.322 1.00 42.96 C ANISOU14867 C LEU B 332 5517 5453 5352 928 -459 397 C ATOM 14868 O LEU B 332 25.096 25.889 0.845 1.00 52.11 O ANISOU14868 O LEU B 332 6654 6632 6513 976 -429 260 O ATOM 14869 CB LEU B 332 25.080 23.529 -1.059 1.00 37.06 C ANISOU14869 CB LEU B 332 4783 4805 4494 796 -484 246 C ATOM 14870 CG LEU B 332 25.440 22.930 -2.406 1.00 37.32 C ANISOU14870 CG LEU B 332 4826 4892 4462 639 -500 207 C ATOM 14871 CD1 LEU B 332 26.185 21.647 -2.193 1.00 44.73 C ANISOU14871 CD1 LEU B 332 5763 5880 5353 699 -508 62 C ATOM 14872 CD2 LEU B 332 24.205 22.692 -3.238 1.00 40.40 C ANISOU14872 CD2 LEU B 332 5239 5251 4859 546 -533 398 C ATOM 14873 H LEU B 332 25.774 25.655 -2.020 1.00 53.50 H ATOM 14874 HA LEU B 332 23.386 24.652 -1.470 1.00 50.27 H ATOM 14875 HB2 LEU B 332 25.911 23.709 -0.592 1.00 44.48 H ATOM 14876 HB3 LEU B 332 24.576 22.859 -0.571 1.00 44.48 H ATOM 14877 HG LEU B 332 26.019 23.543 -2.886 1.00 44.78 H ATOM 14878 HD11 LEU B 332 26.413 21.268 -3.056 1.00 53.67 H ATOM 14879 HD12 LEU B 332 26.992 21.832 -1.688 1.00 53.67 H ATOM 14880 HD13 LEU B 332 25.619 21.033 -1.699 1.00 53.67 H ATOM 14881 HD21 LEU B 332 24.468 22.310 -4.090 1.00 48.48 H ATOM 14882 HD22 LEU B 332 23.620 22.079 -2.766 1.00 48.48 H ATOM 14883 HD23 LEU B 332 23.753 23.539 -3.380 1.00 48.48 H ATOM 14884 N ASP B 333 22.988 25.168 0.950 1.00 43.43 N ANISOU14884 N ASP B 333 5588 5454 5458 1018 -477 547 N ATOM 14885 CA ASP B 333 22.817 25.692 2.287 1.00 47.04 C ANISOU14885 CA ASP B 333 6033 5869 5971 1177 -461 556 C ATOM 14886 C ASP B 333 23.443 24.755 3.288 1.00 51.25 C ANISOU14886 C ASP B 333 6559 6424 6489 1330 -457 422 C ATOM 14887 O ASP B 333 23.762 23.613 2.972 1.00 50.73 O ANISOU14887 O ASP B 333 6502 6396 6375 1319 -473 355 O ATOM 14888 CB ASP B 333 21.346 25.888 2.618 1.00 59.71 C ANISOU14888 CB ASP B 333 7652 7402 7632 1220 -481 767 C ATOM 14889 CG ASP B 333 20.567 24.601 2.577 1.00 65.78 C ANISOU14889 CG ASP B 333 8442 8161 8391 1252 -515 850 C ATOM 14890 OD1 ASP B 333 20.735 23.784 3.507 1.00 72.66 O ANISOU14890 OD1 ASP B 333 9313 9034 9262 1394 -516 788 O ATOM 14891 OD2 ASP B 333 19.781 24.411 1.620 1.00 70.93 O ANISOU14891 OD2 ASP B 333 9113 8802 9036 1138 -540 978 O ATOM 14892 H ASP B 333 22.301 24.763 0.628 1.00 52.11 H ATOM 14893 HA ASP B 333 23.262 26.552 2.354 1.00 56.45 H ATOM 14894 HB2 ASP B 333 21.269 26.257 3.512 1.00 71.65 H ATOM 14895 HB3 ASP B 333 20.955 26.496 1.972 1.00 71.65 H ATOM 14896 N SER B 334 23.596 25.250 4.508 1.00 65.50 N ANISOU14896 N SER B 334 8349 8204 8335 1475 -437 385 N ATOM 14897 CA SER B 334 24.282 24.515 5.553 1.00 60.81 C ANISOU14897 CA SER B 334 7746 7629 7729 1630 -429 245 C ATOM 14898 C SER B 334 23.574 23.207 5.849 1.00 61.67 C ANISOU14898 C SER B 334 7876 7723 7832 1706 -458 313 C ATOM 14899 O SER B 334 24.220 22.180 6.051 1.00 65.20 O ANISOU14899 O SER B 334 8325 8210 8238 1759 -462 191 O ATOM 14900 CB SER B 334 24.378 25.367 6.818 1.00 66.01 C ANISOU14900 CB SER B 334 8387 8254 8441 1773 -404 224 C ATOM 14901 OG SER B 334 23.768 24.725 7.925 1.00 83.50 O ANISOU14901 OG SER B 334 10609 10432 10684 1938 -415 275 O ATOM 14902 H SER B 334 23.306 26.021 4.757 1.00 78.60 H ATOM 14903 HA SER B 334 25.183 24.310 5.258 1.00 72.97 H ATOM 14904 HB2 SER B 334 25.313 25.522 7.022 1.00 79.21 H ATOM 14905 HB3 SER B 334 23.930 26.213 6.661 1.00 79.21 H ATOM 14906 HG SER B 334 23.831 25.209 8.608 1.00100.20 H ATOM 14907 N LYS B 335 22.245 23.235 5.856 1.00 63.35 N ANISOU14907 N LYS B 335 8105 7880 8085 1710 -479 508 N ATOM 14908 CA LYS B 335 21.484 22.043 6.191 1.00 57.78 C ANISOU14908 CA LYS B 335 7419 7154 7380 1788 -506 586 C ATOM 14909 C LYS B 335 21.748 20.921 5.183 1.00 59.39 C ANISOU14909 C LYS B 335 7637 7406 7522 1686 -528 542 C ATOM 14910 O LYS B 335 21.922 19.765 5.576 1.00 59.37 O ANISOU14910 O LYS B 335 7642 7420 7496 1768 -540 483 O ATOM 14911 CB LYS B 335 19.989 22.352 6.294 1.00 56.97 C ANISOU14911 CB LYS B 335 7330 6982 7333 1796 -524 808 C ATOM 14912 CG LYS B 335 19.680 23.627 7.078 1.00 78.51 C ANISOU14912 CG LYS B 335 10043 9663 10122 1865 -503 866 C ATOM 14913 CD LYS B 335 18.601 23.396 8.147 1.00 95.18 C ANISOU14913 CD LYS B 335 12163 11713 12287 2013 -513 995 C ATOM 14914 CE LYS B 335 17.850 24.679 8.526 1.00 90.52 C ANISOU14914 CE LYS B 335 11565 11066 11761 2031 -504 1124 C ATOM 14915 NZ LYS B 335 16.483 24.754 7.923 1.00 74.08 N ANISOU14915 NZ LYS B 335 9502 8938 9708 1953 -530 1334 N ATOM 14916 H LYS B 335 21.766 23.926 5.673 1.00 76.02 H ATOM 14917 HA LYS B 335 21.776 21.727 7.060 1.00 69.34 H ATOM 14918 HB2 LYS B 335 19.629 22.459 5.400 1.00 68.36 H ATOM 14919 HB3 LYS B 335 19.547 21.614 6.741 1.00 68.36 H ATOM 14920 HG2 LYS B 335 20.487 23.930 7.523 1.00 94.21 H ATOM 14921 HG3 LYS B 335 19.360 24.308 6.466 1.00 94.21 H ATOM 14922 HD2 LYS B 335 17.953 22.759 7.808 1.00114.21 H ATOM 14923 HD3 LYS B 335 19.021 23.046 8.949 1.00114.21 H ATOM 14924 HE2 LYS B 335 17.754 24.715 9.491 1.00108.62 H ATOM 14925 HE3 LYS B 335 18.357 25.445 8.215 1.00108.62 H ATOM 14926 HZ1 LYS B 335 16.084 25.511 8.168 1.00 88.90 H ATOM 14927 HZ2 LYS B 335 16.541 24.732 7.036 1.00 88.90 H ATOM 14928 HZ3 LYS B 335 15.991 24.066 8.199 1.00 88.90 H ATOM 14929 N THR B 336 21.811 21.237 3.893 1.00 40.86 N ANISOU14929 N THR B 336 5293 5083 5148 1509 -534 566 N ATOM 14930 CA THR B 336 21.971 20.165 2.919 1.00 39.05 C ANISOU14930 CA THR B 336 5078 4896 4863 1412 -558 537 C ATOM 14931 C THR B 336 23.353 19.547 3.058 1.00 45.76 C ANISOU14931 C THR B 336 5916 5811 5658 1443 -546 318 C ATOM 14932 O THR B 336 23.543 18.380 2.747 1.00 55.50 O ANISOU14932 O THR B 336 7160 7077 6849 1434 -565 269 O ATOM 14933 CB THR B 336 21.771 20.618 1.465 1.00 35.82 C ANISOU14933 CB THR B 336 4675 4502 4432 1213 -568 605 C ATOM 14934 OG1 THR B 336 22.888 21.398 1.056 1.00 55.07 O ANISOU14934 OG1 THR B 336 7096 6984 6845 1135 -541 470 O ATOM 14935 CG2 THR B 336 20.546 21.439 1.325 1.00 42.50 C ANISOU14935 CG2 THR B 336 5530 5286 5333 1177 -576 804 C ATOM 14936 H THR B 336 21.766 22.031 3.566 1.00 49.03 H ATOM 14937 HA THR B 336 21.316 19.474 3.107 1.00 46.86 H ATOM 14938 HB THR B 336 21.690 19.840 0.890 1.00 42.98 H ATOM 14939 HG1 THR B 336 22.962 22.074 1.549 1.00 66.09 H ATOM 14940 HG21 THR B 336 20.436 21.716 0.402 1.00 51.00 H ATOM 14941 HG22 THR B 336 19.769 20.924 1.594 1.00 51.00 H ATOM 14942 HG23 THR B 336 20.610 22.229 1.885 1.00 51.00 H ATOM 14943 N ILE B 337 24.325 20.318 3.524 1.00 53.75 N ANISOU14943 N ILE B 337 6907 6844 6673 1480 -513 185 N ATOM 14944 CA ILE B 337 25.652 19.754 3.732 1.00 47.25 C ANISOU14944 CA ILE B 337 6071 6081 5799 1519 -500 -28 C ATOM 14945 C ILE B 337 25.614 18.810 4.917 1.00 44.87 C ANISOU14945 C ILE B 337 5774 5768 5505 1700 -506 -69 C ATOM 14946 O ILE B 337 26.363 17.842 4.955 1.00 54.92 O ANISOU14946 O ILE B 337 7048 7086 6732 1730 -511 -203 O ATOM 14947 CB ILE B 337 26.724 20.828 3.945 1.00 43.22 C ANISOU14947 CB ILE B 337 5535 5595 5291 1514 -463 -166 C ATOM 14948 CG1 ILE B 337 26.832 21.674 2.681 1.00 50.80 C ANISOU14948 CG1 ILE B 337 6493 6573 6237 1325 -457 -135 C ATOM 14949 CG2 ILE B 337 28.073 20.182 4.251 1.00 42.20 C ANISOU14949 CG2 ILE B 337 5394 5528 5113 1568 -451 -388 C ATOM 14950 CD1 ILE B 337 27.791 22.815 2.788 1.00 63.50 C ANISOU14950 CD1 ILE B 337 8077 8201 7851 1304 -421 -253 C ATOM 14951 H ILE B 337 24.248 21.151 3.725 1.00 64.51 H ATOM 14952 HA ILE B 337 25.900 19.238 2.949 1.00 56.70 H ATOM 14953 HB ILE B 337 26.465 21.395 4.689 1.00 51.86 H ATOM 14954 HG12 ILE B 337 27.127 21.107 1.952 1.00 60.96 H ATOM 14955 HG13 ILE B 337 25.957 22.042 2.478 1.00 60.96 H ATOM 14956 HG21 ILE B 337 28.734 20.880 4.382 1.00 50.64 H ATOM 14957 HG22 ILE B 337 27.992 19.648 5.057 1.00 50.64 H ATOM 14958 HG23 ILE B 337 28.330 19.619 3.504 1.00 50.64 H ATOM 14959 HD11 ILE B 337 27.800 23.299 1.948 1.00 76.21 H ATOM 14960 HD12 ILE B 337 27.505 23.402 3.505 1.00 76.21 H ATOM 14961 HD13 ILE B 337 28.676 22.466 2.979 1.00 76.21 H ATOM 14962 N ARG B 338 24.751 19.095 5.888 1.00 45.00 N ANISOU14962 N ARG B 338 5794 5723 5580 1821 -505 46 N ATOM 14963 CA ARG B 338 24.557 18.170 6.991 1.00 47.77 C ANISOU14963 CA ARG B 338 6153 6057 5941 1992 -513 32 C ATOM 14964 C ARG B 338 24.034 16.863 6.416 1.00 48.69 C ANISOU14964 C ARG B 338 6292 6181 6026 1952 -547 91 C ATOM 14965 O ARG B 338 24.524 15.788 6.749 1.00 41.92 O ANISOU14965 O ARG B 338 5440 5353 5136 2025 -555 -13 O ATOM 14966 CB ARG B 338 23.593 18.731 8.048 1.00 54.67 C ANISOU14966 CB ARG B 338 7027 6860 6884 2117 -508 166 C ATOM 14967 CG ARG B 338 24.282 19.430 9.218 1.00 69.57 C ANISOU14967 CG ARG B 338 8893 8743 8796 2252 -476 56 C ATOM 14968 CD ARG B 338 23.299 20.175 10.130 1.00 82.29 C ANISOU14968 CD ARG B 338 10504 10285 10479 2354 -470 199 C ATOM 14969 NE ARG B 338 23.098 21.571 9.730 1.00 88.62 N ANISOU14969 NE ARG B 338 11293 11066 11314 2264 -456 267 N ATOM 14970 CZ ARG B 338 22.589 22.516 10.521 1.00 93.55 C ANISOU14970 CZ ARG B 338 11907 11640 11996 2344 -443 347 C ATOM 14971 NH1 ARG B 338 22.235 22.227 11.767 1.00108.57 N ANISOU14971 NH1 ARG B 338 13805 13512 13935 2437 -428 358 N ATOM 14972 NH2 ARG B 338 22.439 23.759 10.076 1.00 82.41 N ANISOU14972 NH2 ARG B 338 10486 10213 10613 2252 -432 405 N ATOM 14973 H ARG B 338 24.273 19.809 5.929 1.00 54.00 H ATOM 14974 HA ARG B 338 25.410 17.996 7.418 1.00 57.32 H ATOM 14975 HB2 ARG B 338 23.006 19.376 7.623 1.00 65.60 H ATOM 14976 HB3 ARG B 338 23.068 17.999 8.409 1.00 65.60 H ATOM 14977 HG2 ARG B 338 24.744 18.766 9.754 1.00 83.48 H ATOM 14978 HG3 ARG B 338 24.917 20.076 8.870 1.00 83.48 H ATOM 14979 HD2 ARG B 338 22.439 19.727 10.098 1.00 98.75 H ATOM 14980 HD3 ARG B 338 23.643 20.169 11.037 1.00 98.75 H ATOM 14981 HE ARG B 338 23.324 21.796 8.931 1.00106.35 H ATOM 14982 HH11 ARG B 338 22.328 21.426 12.065 1.00130.28 H ATOM 14983 HH12 ARG B 338 21.909 22.840 12.274 1.00130.28 H ATOM 14984 HH21 ARG B 338 22.668 23.958 9.272 1.00 98.89 H ATOM 14985 HH22 ARG B 338 22.114 24.364 10.593 1.00 98.89 H ATOM 14986 N ALA B 339 23.044 16.965 5.535 1.00 55.43 N ANISOU14986 N ALA B 339 7159 7009 6892 1836 -569 256 N ATOM 14987 CA ALA B 339 22.427 15.783 4.936 1.00 49.44 C ANISOU14987 CA ALA B 339 6422 6253 6110 1791 -603 330 C ATOM 14988 C ALA B 339 23.443 14.964 4.135 1.00 44.89 C ANISOU14988 C ALA B 339 5845 5749 5461 1707 -611 178 C ATOM 14989 O ALA B 339 23.512 13.738 4.264 1.00 36.19 O ANISOU14989 O ALA B 339 4755 4664 4332 1757 -629 137 O ATOM 14990 CB ALA B 339 21.281 16.198 4.046 1.00 44.64 C ANISOU14990 CB ALA B 339 5826 5609 5527 1667 -622 524 C ATOM 14991 H ALA B 339 22.708 17.710 5.266 1.00 66.51 H ATOM 14992 HA ALA B 339 22.073 15.218 5.640 1.00 59.33 H ATOM 14993 HB1 ALA B 339 20.881 15.405 3.656 1.00 53.57 H ATOM 14994 HB2 ALA B 339 20.623 16.672 4.579 1.00 53.57 H ATOM 14995 HB3 ALA B 339 21.619 16.778 3.346 1.00 53.57 H ATOM 14996 N GLN B 340 24.219 15.657 3.306 1.00 49.95 N ANISOU14996 N GLN B 340 6473 6431 6074 1579 -596 96 N ATOM 14997 CA GLN B 340 25.273 15.035 2.511 1.00 48.60 C ANISOU14997 CA GLN B 340 6300 6333 5835 1491 -600 -59 C ATOM 14998 C GLN B 340 26.169 14.122 3.368 1.00 47.85 C ANISOU14998 C GLN B 340 6200 6271 5710 1626 -595 -229 C ATOM 14999 O GLN B 340 26.643 13.079 2.890 1.00 43.28 O ANISOU14999 O GLN B 340 5627 5738 5078 1591 -612 -315 O ATOM 15000 CB GLN B 340 26.132 16.105 1.821 1.00 39.01 C ANISOU15000 CB GLN B 340 5066 5154 4600 1370 -575 -147 C ATOM 15001 CG GLN B 340 25.535 16.738 0.562 1.00 39.28 C ANISOU15001 CG GLN B 340 5108 5181 4637 1192 -585 -19 C ATOM 15002 CD GLN B 340 26.556 17.594 -0.191 1.00 53.58 C ANISOU15002 CD GLN B 340 6901 7039 6416 1067 -560 -133 C ATOM 15003 OE1 GLN B 340 27.630 17.889 0.326 1.00 62.82 O ANISOU15003 OE1 GLN B 340 8053 8240 7575 1122 -533 -295 O ATOM 15004 NE2 GLN B 340 26.231 17.985 -1.419 1.00 48.26 N ANISOU15004 NE2 GLN B 340 6235 6373 5730 900 -569 -51 N ATOM 15005 H GLN B 340 24.153 16.506 3.185 1.00 59.94 H ATOM 15006 HA GLN B 340 24.865 14.489 1.821 1.00 58.32 H ATOM 15007 HB2 GLN B 340 26.295 16.821 2.455 1.00 46.81 H ATOM 15008 HB3 GLN B 340 26.977 15.701 1.568 1.00 46.81 H ATOM 15009 HG2 GLN B 340 25.232 16.035 -0.034 1.00 47.14 H ATOM 15010 HG3 GLN B 340 24.791 17.306 0.814 1.00 47.14 H ATOM 15011 HE21 GLN B 340 25.474 17.755 -1.758 1.00 57.92 H ATOM 15012 HE22 GLN B 340 26.777 18.467 -1.876 1.00 57.92 H ATOM 15013 N LEU B 341 26.396 14.512 4.624 1.00 41.21 N ANISOU15013 N LEU B 341 5348 5407 4902 1778 -572 -278 N ATOM 15014 CA LEU B 341 27.206 13.711 5.543 1.00 41.48 C ANISOU15014 CA LEU B 341 5380 5468 4914 1920 -567 -435 C ATOM 15015 C LEU B 341 26.422 12.509 6.035 1.00 47.37 C ANISOU15015 C LEU B 341 6146 6184 5666 2018 -593 -355 C ATOM 15016 O LEU B 341 26.989 11.442 6.270 1.00 50.14 O ANISOU15016 O LEU B 341 6503 6570 5979 2078 -603 -469 O ATOM 15017 CB LEU B 341 27.627 14.506 6.782 1.00 45.23 C ANISOU15017 CB LEU B 341 5837 5923 5425 2060 -535 -504 C ATOM 15018 CG LEU B 341 28.353 15.839 6.632 1.00 51.82 C ANISOU15018 CG LEU B 341 6647 6773 6268 2003 -503 -580 C ATOM 15019 CD1 LEU B 341 28.867 16.320 7.985 1.00 50.74 C ANISOU15019 CD1 LEU B 341 6494 6622 6161 2169 -475 -674 C ATOM 15020 CD2 LEU B 341 29.488 15.735 5.626 1.00 55.80 C ANISOU15020 CD2 LEU B 341 7142 7349 6710 1871 -498 -732 C ATOM 15021 H LEU B 341 26.091 15.239 4.969 1.00 49.45 H ATOM 15022 HA LEU B 341 28.003 13.397 5.088 1.00 49.78 H ATOM 15023 HB2 LEU B 341 26.825 14.688 7.296 1.00 54.27 H ATOM 15024 HB3 LEU B 341 28.209 13.936 7.308 1.00 54.27 H ATOM 15025 HG LEU B 341 27.725 16.500 6.302 1.00 62.18 H ATOM 15026 HD11 LEU B 341 29.324 17.168 7.866 1.00 60.88 H ATOM 15027 HD12 LEU B 341 28.114 16.432 8.587 1.00 60.88 H ATOM 15028 HD13 LEU B 341 29.481 15.660 8.342 1.00 60.88 H ATOM 15029 HD21 LEU B 341 29.927 16.597 5.556 1.00 66.96 H ATOM 15030 HD22 LEU B 341 30.120 15.066 5.932 1.00 66.96 H ATOM 15031 HD23 LEU B 341 29.124 15.477 4.765 1.00 66.96 H ATOM 15032 N SER B 342 25.124 12.704 6.234 1.00 58.29 N ANISOU15032 N SER B 342 7541 7504 7101 2040 -605 -161 N ATOM 15033 CA SER B 342 24.294 11.703 6.890 1.00 47.42 C ANISOU15033 CA SER B 342 6185 6091 5744 2155 -625 -73 C ATOM 15034 C SER B 342 24.043 10.488 5.992 1.00 48.54 C ANISOU15034 C SER B 342 6343 6255 5843 2070 -659 -47 C ATOM 15035 O SER B 342 23.794 9.392 6.503 1.00 46.68 O ANISOU15035 O SER B 342 6121 6011 5602 2167 -675 -44 O ATOM 15036 CB SER B 342 22.946 12.308 7.305 1.00 52.44 C ANISOU15036 CB SER B 342 6827 6651 6448 2193 -627 132 C ATOM 15037 OG SER B 342 23.087 13.571 7.938 1.00 64.52 O ANISOU15037 OG SER B 342 8340 8158 8018 2242 -598 128 O ATOM 15038 H SER B 342 24.697 13.412 5.997 1.00 69.94 H ATOM 15039 HA SER B 342 24.745 11.395 7.692 1.00 56.91 H ATOM 15040 HB2 SER B 342 22.398 12.418 6.512 1.00 62.93 H ATOM 15041 HB3 SER B 342 22.509 11.700 7.922 1.00 62.93 H ATOM 15042 HG SER B 342 22.333 13.872 8.151 1.00 77.43 H ATOM 15043 N ASP B 343 24.103 10.687 4.669 1.00 45.77 N ANISOU15043 N ASP B 343 5991 5934 5464 1893 -670 -28 N ATOM 15044 CA ASP B 343 23.737 9.653 3.700 1.00 46.75 C ANISOU15044 CA ASP B 343 6132 6077 5554 1796 -705 19 C ATOM 15045 C ASP B 343 24.554 9.810 2.397 1.00 47.72 C ANISOU15045 C ASP B 343 6247 6264 5622 1622 -706 -74 C ATOM 15046 O ASP B 343 24.236 10.665 1.560 1.00 44.29 O ANISOU15046 O ASP B 343 5809 5823 5196 1491 -704 8 O ATOM 15047 CB ASP B 343 22.223 9.753 3.424 1.00 50.02 C ANISOU15047 CB ASP B 343 6561 6429 6015 1759 -725 249 C ATOM 15048 CG ASP B 343 21.718 8.771 2.356 1.00 50.53 C ANISOU15048 CG ASP B 343 6641 6508 6050 1650 -762 318 C ATOM 15049 OD1 ASP B 343 22.493 7.923 1.854 1.00 51.06 O ANISOU15049 OD1 ASP B 343 6710 6632 6061 1607 -774 193 O ATOM 15050 OD2 ASP B 343 20.505 8.854 2.034 1.00 61.23 O ANISOU15050 OD2 ASP B 343 8008 7815 7442 1608 -780 502 O ATOM 15051 H ASP B 343 24.357 11.425 4.306 1.00 54.92 H ATOM 15052 HA ASP B 343 23.924 8.778 4.076 1.00 56.10 H ATOM 15053 HB2 ASP B 343 21.743 9.568 4.247 1.00 60.02 H ATOM 15054 HB3 ASP B 343 22.020 10.651 3.120 1.00 60.02 H ATOM 15055 N TYR B 344 25.588 8.975 2.224 1.00 41.51 N ANISOU15055 N TYR B 344 5457 5538 4777 1621 -711 -243 N ATOM 15056 CA TYR B 344 26.367 8.957 0.974 1.00 50.68 C ANISOU15056 CA TYR B 344 6612 6763 5880 1459 -715 -337 C ATOM 15057 C TYR B 344 26.130 7.691 0.146 1.00 51.58 C ANISOU15057 C TYR B 344 6741 6903 5953 1388 -752 -317 C ATOM 15058 O TYR B 344 26.882 7.400 -0.787 1.00 48.55 O ANISOU15058 O TYR B 344 6353 6580 5515 1276 -759 -419 O ATOM 15059 CB TYR B 344 27.873 9.153 1.228 1.00 43.03 C ANISOU15059 CB TYR B 344 5624 5854 4872 1483 -689 -560 C ATOM 15060 CG TYR B 344 28.501 8.208 2.228 1.00 41.89 C ANISOU15060 CG TYR B 344 5481 5727 4710 1638 -688 -695 C ATOM 15061 CD1 TYR B 344 28.938 6.952 1.846 1.00 49.34 C ANISOU15061 CD1 TYR B 344 6433 6715 5600 1623 -712 -784 C ATOM 15062 CD2 TYR B 344 28.693 8.594 3.550 1.00 45.89 C ANISOU15062 CD2 TYR B 344 5980 6206 5251 1799 -664 -739 C ATOM 15063 CE1 TYR B 344 29.525 6.099 2.752 1.00 51.06 C ANISOU15063 CE1 TYR B 344 6652 6949 5800 1764 -712 -909 C ATOM 15064 CE2 TYR B 344 29.277 7.750 4.465 1.00 43.77 C ANISOU15064 CE2 TYR B 344 5713 5952 4964 1942 -663 -864 C ATOM 15065 CZ TYR B 344 29.689 6.499 4.064 1.00 44.44 C ANISOU15065 CZ TYR B 344 5807 6081 4996 1924 -687 -948 C ATOM 15066 OH TYR B 344 30.284 5.629 4.957 1.00 49.93 O ANISOU15066 OH TYR B 344 6506 6794 5671 2065 -688 -1075 O ATOM 15067 H TYR B 344 25.858 8.410 2.813 1.00 49.81 H ATOM 15068 HA TYR B 344 26.074 9.706 0.432 1.00 60.81 H ATOM 15069 HB2 TYR B 344 28.342 9.038 0.386 1.00 51.64 H ATOM 15070 HB3 TYR B 344 28.013 10.056 1.555 1.00 51.64 H ATOM 15071 HD1 TYR B 344 28.825 6.676 0.965 1.00 59.21 H ATOM 15072 HD2 TYR B 344 28.411 9.437 3.823 1.00 55.07 H ATOM 15073 HE1 TYR B 344 29.805 5.254 2.484 1.00 61.27 H ATOM 15074 HE2 TYR B 344 29.390 8.021 5.348 1.00 52.52 H ATOM 15075 HH TYR B 344 30.327 5.983 5.717 1.00 59.92 H ATOM 15076 N SER B 345 25.064 6.961 0.461 1.00 54.59 N ANISOU15076 N SER B 345 7140 7239 6363 1451 -777 -183 N ATOM 15077 CA SER B 345 24.758 5.718 -0.245 1.00 50.14 C ANISOU15077 CA SER B 345 6592 6694 5767 1396 -814 -156 C ATOM 15078 C SER B 345 24.564 5.893 -1.749 1.00 42.37 C ANISOU15078 C SER B 345 5609 5735 4756 1201 -831 -98 C ATOM 15079 O SER B 345 24.831 4.975 -2.512 1.00 53.13 O ANISOU15079 O SER B 345 6977 7140 6071 1129 -856 -147 O ATOM 15080 CB SER B 345 23.507 5.056 0.343 1.00 55.99 C ANISOU15080 CB SER B 345 7350 7372 6552 1492 -834 2 C ATOM 15081 OG SER B 345 22.358 5.866 0.167 1.00 53.32 O ANISOU15081 OG SER B 345 7016 6976 6267 1449 -835 192 O ATOM 15082 H SER B 345 24.502 7.162 1.080 1.00 65.51 H ATOM 15083 HA SER B 345 25.498 5.105 -0.118 1.00 60.17 H ATOM 15084 HB2 SER B 345 23.364 4.207 -0.102 1.00 67.19 H ATOM 15085 HB3 SER B 345 23.646 4.912 1.292 1.00 67.19 H ATOM 15086 HG SER B 345 22.467 6.606 0.549 1.00 63.98 H ATOM 15087 N ASP B 346 24.092 7.056 -2.178 1.00 40.86 N ANISOU15087 N ASP B 346 5414 5518 4595 1115 -820 7 N ATOM 15088 CA ASP B 346 23.826 7.282 -3.595 1.00 37.68 C ANISOU15088 CA ASP B 346 5013 5133 4169 931 -836 76 C ATOM 15089 C ASP B 346 25.064 7.613 -4.418 1.00 45.68 C ANISOU15089 C ASP B 346 6013 6219 5125 815 -822 -83 C ATOM 15090 O ASP B 346 24.974 7.721 -5.644 1.00 43.08 O ANISOU15090 O ASP B 346 5686 5913 4768 659 -836 -45 O ATOM 15091 CB ASP B 346 22.808 8.404 -3.771 1.00 45.24 C ANISOU15091 CB ASP B 346 5974 6035 5181 881 -830 255 C ATOM 15092 CG ASP B 346 23.240 9.700 -3.137 1.00 49.68 C ANISOU15092 CG ASP B 346 6521 6584 5772 924 -791 213 C ATOM 15093 OD1 ASP B 346 23.931 9.665 -2.092 1.00 48.26 O ANISOU15093 OD1 ASP B 346 6331 6410 5594 1054 -770 93 O ATOM 15094 OD2 ASP B 346 22.867 10.759 -3.689 1.00 52.75 O ANISOU15094 OD2 ASP B 346 6907 6953 6181 826 -782 303 O ATOM 15095 H ASP B 346 23.917 7.729 -1.672 1.00 49.04 H ATOM 15096 HA ASP B 346 23.438 6.475 -3.967 1.00 45.21 H ATOM 15097 HB2 ASP B 346 22.677 8.564 -4.719 1.00 54.29 H ATOM 15098 HB3 ASP B 346 21.971 8.136 -3.362 1.00 54.29 H ATOM 15099 N ILE B 347 26.205 7.795 -3.752 1.00 42.94 N ANISOU15099 N ILE B 347 5650 5904 4759 890 -795 -257 N ATOM 15100 CA ILE B 347 27.455 8.078 -4.450 1.00 40.46 C ANISOU15100 CA ILE B 347 5322 5660 4391 790 -779 -421 C ATOM 15101 C ILE B 347 28.501 6.976 -4.235 1.00 46.66 C ANISOU15101 C ILE B 347 6103 6503 5122 845 -786 -607 C ATOM 15102 O ILE B 347 29.653 7.100 -4.663 1.00 47.55 O ANISOU15102 O ILE B 347 6202 6677 5187 783 -772 -767 O ATOM 15103 CB ILE B 347 28.064 9.440 -4.026 1.00 44.56 C ANISOU15103 CB ILE B 347 5823 6177 4931 802 -737 -484 C ATOM 15104 CG1 ILE B 347 28.378 9.468 -2.529 1.00 41.38 C ANISOU15104 CG1 ILE B 347 5413 5752 4558 991 -716 -558 C ATOM 15105 CG2 ILE B 347 27.141 10.592 -4.407 1.00 43.87 C ANISOU15105 CG2 ILE B 347 5739 6041 4891 725 -731 -312 C ATOM 15106 CD1 ILE B 347 29.273 10.623 -2.149 1.00 37.77 C ANISOU15106 CD1 ILE B 347 4935 5309 4109 1004 -675 -669 C ATOM 15107 H ILE B 347 26.280 7.759 -2.896 1.00 51.52 H ATOM 15108 HA ILE B 347 27.272 8.123 -5.401 1.00 48.55 H ATOM 15109 HB ILE B 347 28.898 9.556 -4.508 1.00 53.47 H ATOM 15110 HG12 ILE B 347 27.549 9.554 -2.033 1.00 49.66 H ATOM 15111 HG13 ILE B 347 28.829 8.645 -2.285 1.00 49.66 H ATOM 15112 HG21 ILE B 347 27.549 11.427 -4.130 1.00 52.65 H ATOM 15113 HG22 ILE B 347 27.014 10.589 -5.369 1.00 52.65 H ATOM 15114 HG23 ILE B 347 26.289 10.474 -3.960 1.00 52.65 H ATOM 15115 HD11 ILE B 347 29.439 10.592 -1.193 1.00 45.33 H ATOM 15116 HD12 ILE B 347 30.110 10.547 -2.633 1.00 45.33 H ATOM 15117 HD13 ILE B 347 28.831 11.455 -2.381 1.00 45.33 H ATOM 15118 N VAL B 348 28.100 5.910 -3.551 1.00 58.82 N ANISOU15118 N VAL B 348 8010 5331 9008 -1300 -1068 -795 N ATOM 15119 CA VAL B 348 28.946 4.735 -3.393 1.00 48.06 C ANISOU15119 CA VAL B 348 6589 4039 7634 -1305 -1036 -777 C ATOM 15120 C VAL B 348 28.256 3.595 -4.150 1.00 43.19 C ANISOU15120 C VAL B 348 5907 3444 7060 -1237 -1011 -820 C ATOM 15121 O VAL B 348 27.118 3.747 -4.586 1.00 47.50 O ANISOU15121 O VAL B 348 6459 3944 7646 -1190 -1015 -865 O ATOM 15122 CB VAL B 348 29.169 4.419 -1.896 1.00 44.37 C ANISOU15122 CB VAL B 348 6133 3554 7171 -1327 -1003 -781 C ATOM 15123 CG1 VAL B 348 27.981 3.701 -1.311 1.00 50.98 C ANISOU15123 CG1 VAL B 348 6954 4343 8072 -1270 -964 -848 C ATOM 15124 CG2 VAL B 348 30.420 3.598 -1.703 1.00 61.76 C ANISOU15124 CG2 VAL B 348 8290 5835 9339 -1357 -984 -738 C ATOM 15125 H VAL B 348 27.335 5.843 -3.165 1.00 70.58 H ATOM 15126 HA VAL B 348 29.809 4.900 -3.805 1.00 57.68 H ATOM 15127 HB VAL B 348 29.282 5.252 -1.412 1.00 53.24 H ATOM 15128 HG11 VAL B 348 28.153 3.519 -0.374 1.00 61.17 H ATOM 15129 HG12 VAL B 348 27.197 4.265 -1.400 1.00 61.17 H ATOM 15130 HG13 VAL B 348 27.847 2.869 -1.792 1.00 61.17 H ATOM 15131 HG21 VAL B 348 30.534 3.415 -0.757 1.00 74.11 H ATOM 15132 HG22 VAL B 348 30.329 2.765 -2.192 1.00 74.11 H ATOM 15133 HG23 VAL B 348 31.180 4.098 -2.037 1.00 74.11 H ATOM 15134 N THR B 349 28.937 2.472 -4.339 1.00 50.19 N ANISOU15134 N THR B 349 6732 4399 7937 -1231 -984 -806 N ATOM 15135 CA THR B 349 28.344 1.375 -5.100 1.00 54.78 C ANISOU15135 CA THR B 349 7252 5005 8557 -1169 -960 -844 C ATOM 15136 C THR B 349 28.825 -0.011 -4.692 1.00 53.99 C ANISOU15136 C THR B 349 7091 4959 8465 -1157 -913 -846 C ATOM 15137 O THR B 349 29.567 -0.184 -3.719 1.00 54.95 O ANISOU15137 O THR B 349 7216 5095 8565 -1194 -895 -822 O ATOM 15138 CB THR B 349 28.595 1.532 -6.613 1.00 58.66 C ANISOU15138 CB THR B 349 7721 5540 9026 -1162 -991 -821 C ATOM 15139 OG1 THR B 349 28.037 0.407 -7.302 1.00 62.94 O ANISOU15139 OG1 THR B 349 8202 6107 9605 -1102 -965 -859 O ATOM 15140 CG2 THR B 349 30.087 1.605 -6.920 1.00 64.21 C ANISOU15140 CG2 THR B 349 8414 6317 9668 -1216 -1007 -751 C ATOM 15141 H THR B 349 29.730 2.320 -4.045 1.00 60.22 H ATOM 15142 HA THR B 349 27.384 1.398 -4.964 1.00 65.74 H ATOM 15143 HB THR B 349 28.175 2.347 -6.929 1.00 70.39 H ATOM 15144 HG1 THR B 349 28.168 0.482 -8.129 1.00 75.53 H ATOM 15145 HG21 THR B 349 30.224 1.703 -7.875 1.00 77.06 H ATOM 15146 HG22 THR B 349 30.483 2.364 -6.465 1.00 77.06 H ATOM 15147 HG23 THR B 349 30.527 0.794 -6.620 1.00 77.06 H ATOM 15148 N THR B 350 28.394 -0.992 -5.473 1.00 46.56 N ANISOU15148 N THR B 350 6093 4046 7552 -1104 -892 -876 N ATOM 15149 CA THR B 350 28.655 -2.387 -5.191 1.00 50.14 C ANISOU15149 CA THR B 350 6485 4546 8021 -1082 -845 -887 C ATOM 15150 C THR B 350 29.794 -2.847 -6.076 1.00 58.43 C ANISOU15150 C THR B 350 7491 5682 9028 -1101 -851 -837 C ATOM 15151 O THR B 350 29.974 -2.321 -7.172 1.00 66.56 O ANISOU15151 O THR B 350 8525 6730 10034 -1107 -886 -813 O ATOM 15152 CB THR B 350 27.418 -3.246 -5.464 1.00 44.20 C ANISOU15152 CB THR B 350 5696 3769 7330 -1009 -815 -954 C ATOM 15153 OG1 THR B 350 27.739 -4.617 -5.228 1.00 58.17 O ANISOU15153 OG1 THR B 350 7404 5587 9110 -989 -769 -962 O ATOM 15154 CG2 THR B 350 26.941 -3.077 -6.908 1.00 45.45 C ANISOU15154 CG2 THR B 350 5841 3936 7494 -977 -842 -964 C ATOM 15155 H THR B 350 27.935 -0.866 -6.190 1.00 55.87 H ATOM 15156 HA THR B 350 28.914 -2.495 -4.263 1.00 60.17 H ATOM 15157 HB THR B 350 26.700 -2.975 -4.870 1.00 53.05 H ATOM 15158 HG1 THR B 350 27.067 -5.098 -5.375 1.00 69.80 H ATOM 15159 HG21 THR B 350 26.157 -3.627 -7.065 1.00 54.54 H ATOM 15160 HG22 THR B 350 26.714 -2.149 -7.076 1.00 54.54 H ATOM 15161 HG23 THR B 350 27.642 -3.346 -7.522 1.00 54.54 H ATOM 15162 N LEU B 351 30.559 -3.830 -5.610 1.00 56.44 N ANISOU15162 N LEU B 351 7196 5482 8765 -1111 -815 -819 N ATOM 15163 CA LEU B 351 31.797 -4.207 -6.294 1.00 48.57 C ANISOU15163 CA LEU B 351 6163 4569 7722 -1138 -820 -763 C ATOM 15164 C LEU B 351 31.557 -4.880 -7.639 1.00 58.69 C ANISOU15164 C LEU B 351 7394 5891 9015 -1094 -818 -776 C ATOM 15165 O LEU B 351 30.874 -5.900 -7.719 1.00 70.32 O ANISOU15165 O LEU B 351 8824 7364 10531 -1041 -782 -822 O ATOM 15166 CB LEU B 351 32.633 -5.138 -5.421 1.00 47.00 C ANISOU15166 CB LEU B 351 5930 4416 7511 -1157 -778 -743 C ATOM 15167 CG LEU B 351 33.818 -5.769 -6.147 1.00 49.48 C ANISOU15167 CG LEU B 351 6195 4819 7785 -1175 -774 -692 C ATOM 15168 CD1 LEU B 351 34.694 -4.664 -6.689 1.00 63.58 C ANISOU15168 CD1 LEU B 351 8017 6626 9516 -1230 -825 -631 C ATOM 15169 CD2 LEU B 351 34.598 -6.665 -5.218 1.00 50.41 C ANISOU15169 CD2 LEU B 351 6280 4978 7893 -1193 -733 -673 C ATOM 15170 H LEU B 351 30.387 -4.293 -4.906 1.00 67.73 H ATOM 15171 HA LEU B 351 32.319 -3.405 -6.455 1.00 58.28 H ATOM 15172 HB2 LEU B 351 32.982 -4.633 -4.670 1.00 56.40 H ATOM 15173 HB3 LEU B 351 32.067 -5.857 -5.100 1.00 56.40 H ATOM 15174 HG LEU B 351 33.496 -6.301 -6.891 1.00 59.37 H ATOM 15175 HD11 LEU B 351 35.450 -5.059 -7.151 1.00 76.30 H ATOM 15176 HD12 LEU B 351 34.175 -4.123 -7.304 1.00 76.30 H ATOM 15177 HD13 LEU B 351 35.006 -4.119 -5.950 1.00 76.30 H ATOM 15178 HD21 LEU B 351 35.342 -7.051 -5.705 1.00 60.49 H ATOM 15179 HD22 LEU B 351 34.926 -6.137 -4.473 1.00 60.49 H ATOM 15180 HD23 LEU B 351 34.013 -7.368 -4.894 1.00 60.49 H ATOM 15181 N ASP B 352 32.153 -4.319 -8.685 1.00 76.11 N ANISOU15181 N ASP B 352 9605 8132 11183 -1117 -856 -733 N ATOM 15182 CA ASP B 352 32.022 -4.863 -10.034 1.00 78.60 C ANISOU15182 CA ASP B 352 9875 8486 11502 -1080 -859 -739 C ATOM 15183 C ASP B 352 33.120 -5.897 -10.295 1.00 73.64 C ANISOU15183 C ASP B 352 9189 7943 10847 -1091 -833 -701 C ATOM 15184 O ASP B 352 34.285 -5.545 -10.491 1.00 67.51 O ANISOU15184 O ASP B 352 8418 7214 10019 -1140 -853 -639 O ATOM 15185 CB ASP B 352 32.112 -3.729 -11.058 1.00 88.37 C ANISOU15185 CB ASP B 352 11146 9718 12711 -1099 -914 -712 C ATOM 15186 CG ASP B 352 31.609 -4.135 -12.430 1.00 96.25 C ANISOU15186 CG ASP B 352 12108 10737 13726 -1053 -920 -732 C ATOM 15187 OD1 ASP B 352 30.987 -5.215 -12.547 1.00 99.32 O ANISOU15187 OD1 ASP B 352 12451 11131 14155 -1002 -883 -776 O ATOM 15188 OD2 ASP B 352 31.830 -3.365 -13.391 1.00 93.53 O ANISOU15188 OD2 ASP B 352 11781 10402 13355 -1068 -963 -705 O ATOM 15189 H ASP B 352 32.645 -3.614 -8.641 1.00 91.34 H ATOM 15190 HA ASP B 352 31.160 -5.297 -10.127 1.00 94.32 H ATOM 15191 HB2 ASP B 352 31.574 -2.982 -10.750 1.00106.04 H ATOM 15192 HB3 ASP B 352 33.039 -3.456 -11.147 1.00106.04 H ATOM 15193 N LEU B 353 32.745 -7.171 -10.300 1.00 58.85 N ANISOU15193 N LEU B 353 7262 6090 9009 -1044 -788 -737 N ATOM 15194 CA LEU B 353 33.720 -8.252 -10.401 1.00 49.56 C ANISOU15194 CA LEU B 353 6029 4990 7811 -1051 -756 -705 C ATOM 15195 C LEU B 353 34.162 -8.535 -11.830 1.00 55.64 C ANISOU15195 C LEU B 353 6763 5818 8559 -1041 -770 -679 C ATOM 15196 O LEU B 353 33.357 -8.482 -12.767 1.00 58.26 O ANISOU15196 O LEU B 353 7089 6133 8914 -1002 -784 -711 O ATOM 15197 CB LEU B 353 33.133 -9.546 -9.843 1.00 47.28 C ANISOU15197 CB LEU B 353 5695 4699 7569 -1003 -699 -755 C ATOM 15198 CG LEU B 353 33.258 -9.917 -8.369 1.00 44.92 C ANISOU15198 CG LEU B 353 5401 4385 7282 -1016 -663 -764 C ATOM 15199 CD1 LEU B 353 32.927 -11.404 -8.226 1.00 44.31 C ANISOU15199 CD1 LEU B 353 5262 4332 7242 -967 -607 -802 C ATOM 15200 CD2 LEU B 353 34.634 -9.614 -7.820 1.00 56.07 C ANISOU15200 CD2 LEU B 353 6824 5838 8640 -1082 -671 -697 C ATOM 15201 H LEU B 353 31.930 -7.437 -10.246 1.00 70.62 H ATOM 15202 HA LEU B 353 34.505 -8.024 -9.879 1.00 59.47 H ATOM 15203 HB2 LEU B 353 32.183 -9.533 -10.037 1.00 56.73 H ATOM 15204 HB3 LEU B 353 33.536 -10.277 -10.338 1.00 56.73 H ATOM 15205 HG LEU B 353 32.608 -9.411 -7.857 1.00 53.90 H ATOM 15206 HD11 LEU B 353 33.002 -11.655 -7.292 1.00 53.17 H ATOM 15207 HD12 LEU B 353 32.021 -11.556 -8.538 1.00 53.17 H ATOM 15208 HD13 LEU B 353 33.552 -11.919 -8.759 1.00 53.17 H ATOM 15209 HD21 LEU B 353 34.663 -9.866 -6.884 1.00 67.28 H ATOM 15210 HD22 LEU B 353 35.292 -10.121 -8.321 1.00 67.28 H ATOM 15211 HD23 LEU B 353 34.808 -8.664 -7.913 1.00 67.28 H ATOM 15212 N ALA B 354 35.443 -8.865 -11.985 1.00 55.95 N ANISOU15212 N ALA B 354 6777 5928 8554 -1077 -766 -621 N ATOM 15213 CA ALA B 354 35.927 -9.471 -13.219 1.00 51.61 C ANISOU15213 CA ALA B 354 6181 5443 7987 -1063 -765 -599 C ATOM 15214 C ALA B 354 35.381 -10.891 -13.272 1.00 53.69 C ANISOU15214 C ALA B 354 6385 5723 8292 -1007 -713 -645 C ATOM 15215 O ALA B 354 34.898 -11.405 -12.261 1.00 56.71 O ANISOU15215 O ALA B 354 6762 6077 8708 -989 -677 -682 O ATOM 15216 CB ALA B 354 37.443 -9.484 -13.253 1.00 45.32 C ANISOU15216 CB ALA B 354 5372 4715 7132 -1117 -771 -525 C ATOM 15217 H ALA B 354 36.051 -8.748 -11.388 1.00 67.14 H ATOM 15218 HA ALA B 354 35.597 -8.975 -13.985 1.00 61.93 H ATOM 15219 HB1 ALA B 354 37.737 -9.891 -14.083 1.00 54.38 H ATOM 15220 HB2 ALA B 354 37.768 -8.571 -13.200 1.00 54.38 H ATOM 15221 HB3 ALA B 354 37.771 -9.997 -12.498 1.00 54.38 H ATOM 15222 N PRO B 355 35.442 -11.528 -14.450 1.00 51.88 N ANISOU15222 N PRO B 355 6112 5538 8062 -979 -708 -643 N ATOM 15223 CA PRO B 355 34.952 -12.907 -14.590 1.00 50.72 C ANISOU15223 CA PRO B 355 5908 5410 7953 -925 -658 -686 C ATOM 15224 C PRO B 355 35.545 -13.842 -13.524 1.00 55.79 C ANISOU15224 C PRO B 355 6520 6082 8595 -934 -609 -676 C ATOM 15225 O PRO B 355 36.772 -13.981 -13.440 1.00 56.88 O ANISOU15225 O PRO B 355 6645 6277 8690 -975 -606 -618 O ATOM 15226 CB PRO B 355 35.425 -13.296 -15.987 1.00 52.90 C ANISOU15226 CB PRO B 355 6147 5747 8207 -915 -667 -659 C ATOM 15227 CG PRO B 355 35.483 -11.998 -16.738 1.00 40.84 C ANISOU15227 CG PRO B 355 4664 4202 6653 -941 -727 -634 C ATOM 15228 CD PRO B 355 35.848 -10.947 -15.744 1.00 49.10 C ANISOU15228 CD PRO B 355 5765 5215 7677 -992 -751 -608 C ATOM 15229 HA PRO B 355 33.984 -12.935 -14.551 1.00 60.86 H ATOM 15230 HB2 PRO B 355 36.303 -13.705 -15.936 1.00 63.48 H ATOM 15231 HB3 PRO B 355 34.785 -13.902 -16.394 1.00 63.48 H ATOM 15232 HG2 PRO B 355 36.158 -12.057 -17.432 1.00 49.01 H ATOM 15233 HG3 PRO B 355 34.614 -11.810 -17.126 1.00 49.01 H ATOM 15234 HD2 PRO B 355 36.805 -10.789 -15.756 1.00 58.92 H ATOM 15235 HD3 PRO B 355 35.352 -10.132 -15.918 1.00 58.92 H ATOM 15236 N PRO B 356 34.680 -14.466 -12.703 1.00 58.05 N ANISOU15236 N PRO B 356 6796 6331 8929 -898 -571 -733 N ATOM 15237 CA PRO B 356 35.150 -15.188 -11.515 1.00 62.18 C ANISOU15237 CA PRO B 356 7301 6871 9455 -910 -527 -727 C ATOM 15238 C PRO B 356 35.560 -16.635 -11.766 1.00 61.35 C ANISOU15238 C PRO B 356 7128 6829 9354 -884 -477 -726 C ATOM 15239 O PRO B 356 36.056 -17.288 -10.851 1.00 64.76 O ANISOU15239 O PRO B 356 7539 7282 9783 -895 -439 -716 O ATOM 15240 CB PRO B 356 33.932 -15.141 -10.596 1.00 54.80 C ANISOU15240 CB PRO B 356 6388 5861 8572 -878 -511 -792 C ATOM 15241 CG PRO B 356 32.797 -15.218 -11.523 1.00 57.00 C ANISOU15241 CG PRO B 356 6659 6111 8887 -826 -519 -843 C ATOM 15242 CD PRO B 356 33.210 -14.450 -12.763 1.00 58.12 C ANISOU15242 CD PRO B 356 6814 6275 8992 -846 -568 -803 C ATOM 15243 HA PRO B 356 35.885 -14.711 -11.099 1.00 74.62 H ATOM 15244 HB2 PRO B 356 33.941 -15.902 -9.995 1.00 65.76 H ATOM 15245 HB3 PRO B 356 33.921 -14.307 -10.102 1.00 65.76 H ATOM 15246 HG2 PRO B 356 32.620 -16.146 -11.742 1.00 68.40 H ATOM 15247 HG3 PRO B 356 32.018 -14.809 -11.115 1.00 68.40 H ATOM 15248 HD2 PRO B 356 32.900 -14.906 -13.561 1.00 69.74 H ATOM 15249 HD3 PRO B 356 32.880 -13.539 -12.722 1.00 69.74 H ATOM 15250 N THR B 357 35.363 -17.129 -12.980 1.00 47.45 N ANISOU15250 N THR B 357 5332 5097 7598 -850 -476 -735 N ATOM 15251 CA THR B 357 35.773 -18.481 -13.300 1.00 43.89 C ANISOU15251 CA THR B 357 4818 4708 7149 -826 -430 -731 C ATOM 15252 C THR B 357 36.427 -18.463 -14.670 1.00 50.48 C ANISOU15252 C THR B 357 5633 5599 7949 -834 -452 -689 C ATOM 15253 O THR B 357 36.364 -17.461 -15.373 1.00 56.63 O ANISOU15253 O THR B 357 6446 6362 8710 -850 -502 -674 O ATOM 15254 CB THR B 357 34.575 -19.436 -13.261 1.00 43.18 C ANISOU15254 CB THR B 357 4698 4592 7119 -761 -390 -804 C ATOM 15255 OG1 THR B 357 33.623 -19.066 -14.260 1.00 49.21 O ANISOU15255 OG1 THR B 357 5470 5322 7903 -727 -418 -840 O ATOM 15256 CG2 THR B 357 33.908 -19.370 -11.903 1.00 42.24 C ANISOU15256 CG2 THR B 357 4601 4413 7034 -754 -370 -845 C ATOM 15257 H THR B 357 34.997 -16.703 -13.631 1.00 56.93 H ATOM 15258 HA THR B 357 36.427 -18.782 -12.651 1.00 52.66 H ATOM 15259 HB THR B 357 34.875 -20.345 -13.416 1.00 51.82 H ATOM 15260 HG1 THR B 357 32.966 -19.589 -14.239 1.00 59.05 H ATOM 15261 HG21 THR B 357 33.149 -19.974 -11.877 1.00 50.69 H ATOM 15262 HG22 THR B 357 34.538 -19.625 -11.211 1.00 50.69 H ATOM 15263 HG23 THR B 357 33.598 -18.467 -11.730 1.00 50.69 H ATOM 15264 N LYS B 358 37.097 -19.549 -15.036 1.00 81.75 N ANISOU15264 N LYS B 358 10077 9829 11157 -495 -2222 -5135 N ATOM 15265 CA LYS B 358 37.642 -19.661 -16.378 1.00 81.43 C ANISOU15265 CA LYS B 358 9980 9778 11182 -419 -2187 -5204 C ATOM 15266 C LYS B 358 36.512 -19.655 -17.402 1.00 83.72 C ANISOU15266 C LYS B 358 10319 10103 11390 -380 -2102 -5202 C ATOM 15267 O LYS B 358 36.605 -18.981 -18.425 1.00 84.22 O ANISOU15267 O LYS B 358 10349 10174 11476 -333 -2058 -5238 O ATOM 15268 CB LYS B 358 38.468 -20.934 -16.519 1.00 82.18 C ANISOU15268 CB LYS B 358 10039 9838 11348 -388 -2218 -5245 C ATOM 15269 CG LYS B 358 39.679 -20.981 -15.615 1.00 87.92 C ANISOU15269 CG LYS B 358 10710 10527 12169 -420 -2303 -5251 C ATOM 15270 CD LYS B 358 40.071 -22.418 -15.329 1.00100.27 C ANISOU15270 CD LYS B 358 12273 12064 13760 -414 -2338 -5261 C ATOM 15271 CE LYS B 358 41.270 -22.525 -14.402 1.00 95.67 C ANISOU15271 CE LYS B 358 11636 11441 13272 -448 -2425 -5262 C ATOM 15272 NZ LYS B 358 42.528 -22.118 -15.078 1.00 91.88 N ANISOU15272 NZ LYS B 358 11061 10927 12920 -404 -2444 -5323 N ATOM 15273 H LYS B 358 37.248 -20.228 -14.530 1.00 98.10 H ATOM 15274 HA LYS B 358 38.219 -18.901 -16.555 1.00 97.72 H ATOM 15275 HB2 LYS B 358 37.907 -21.695 -16.302 1.00 98.62 H ATOM 15276 HB3 LYS B 358 38.778 -21.005 -17.435 1.00 98.62 H ATOM 15277 HG2 LYS B 358 40.425 -20.540 -16.051 1.00105.51 H ATOM 15278 HG3 LYS B 358 39.472 -20.546 -14.773 1.00105.51 H ATOM 15279 HD2 LYS B 358 39.324 -22.872 -14.908 1.00120.32 H ATOM 15280 HD3 LYS B 358 40.298 -22.856 -16.165 1.00120.32 H ATOM 15281 HE2 LYS B 358 41.135 -21.944 -13.638 1.00114.80 H ATOM 15282 HE3 LYS B 358 41.366 -23.445 -14.110 1.00114.80 H ATOM 15283 HZ1 LYS B 358 42.677 -22.641 -15.783 1.00110.25 H ATOM 15284 HZ2 LYS B 358 42.466 -21.273 -15.353 1.00110.25 H ATOM 15285 HZ3 LYS B 358 43.213 -22.190 -14.515 1.00110.25 H ATOM 15286 N LYS B 359 35.444 -20.397 -17.118 1.00 74.10 N ANISOU15286 N LYS B 359 9178 8902 10076 -400 -2079 -5158 N ATOM 15287 CA LYS B 359 34.314 -20.505 -18.037 1.00 73.42 C ANISOU15287 CA LYS B 359 9142 8846 9908 -367 -2002 -5149 C ATOM 15288 C LYS B 359 33.765 -19.135 -18.405 1.00 73.73 C ANISOU15288 C LYS B 359 9190 8912 9911 -369 -1961 -5133 C ATOM 15289 O LYS B 359 33.649 -18.797 -19.580 1.00 76.10 O ANISOU15289 O LYS B 359 9472 9225 10218 -314 -1906 -5165 O ATOM 15290 CB LYS B 359 33.194 -21.329 -17.413 1.00 77.10 C ANISOU15290 CB LYS B 359 9696 9326 10274 -405 -1992 -5091 C ATOM 15291 CG LYS B 359 32.137 -21.768 -18.409 1.00 78.37 C ANISOU15291 CG LYS B 359 9905 9510 10362 -365 -1917 -5085 C ATOM 15292 CD LYS B 359 30.859 -22.227 -17.716 1.00 89.37 C ANISOU15292 CD LYS B 359 11390 10920 11646 -414 -1904 -5015 C ATOM 15293 CE LYS B 359 30.914 -23.667 -17.246 1.00 96.15 C ANISOU15293 CE LYS B 359 12272 11762 12499 -423 -1930 -5011 C ATOM 15294 NZ LYS B 359 31.270 -24.597 -18.347 1.00102.56 N ANISOU15294 NZ LYS B 359 13055 12565 13349 -354 -1901 -5065 N ATOM 15295 H LYS B 359 35.349 -20.852 -16.394 1.00 88.92 H ATOM 15296 HA LYS B 359 34.602 -20.947 -18.851 1.00 88.10 H ATOM 15297 HB2 LYS B 359 33.576 -22.127 -17.015 1.00 92.52 H ATOM 15298 HB3 LYS B 359 32.756 -20.797 -16.730 1.00 92.52 H ATOM 15299 HG2 LYS B 359 31.915 -21.022 -18.988 1.00 94.04 H ATOM 15300 HG3 LYS B 359 32.480 -22.508 -18.933 1.00 94.04 H ATOM 15301 HD2 LYS B 359 30.704 -21.666 -16.940 1.00107.24 H ATOM 15302 HD3 LYS B 359 30.118 -22.145 -18.336 1.00107.24 H ATOM 15303 HE2 LYS B 359 31.585 -23.750 -16.551 1.00115.38 H ATOM 15304 HE3 LYS B 359 30.044 -23.923 -16.902 1.00115.38 H ATOM 15305 HZ1 LYS B 359 31.294 -25.433 -18.043 1.00123.07 H ATOM 15306 HZ2 LYS B 359 30.664 -24.544 -18.998 1.00123.07 H ATOM 15307 HZ3 LYS B 359 32.069 -24.386 -18.678 1.00123.07 H ATOM 15308 N LEU B 360 33.426 -18.354 -17.387 1.00 72.83 N ANISOU15308 N LEU B 360 9105 8807 9759 -433 -1988 -5081 N ATOM 15309 CA LEU B 360 32.909 -17.006 -17.579 1.00 72.46 C ANISOU15309 CA LEU B 360 9069 8785 9677 -443 -1957 -5060 C ATOM 15310 C LEU B 360 33.945 -16.049 -18.160 1.00 72.83 C ANISOU15310 C LEU B 360 9032 8822 9817 -410 -1964 -5113 C ATOM 15311 O LEU B 360 33.591 -15.055 -18.790 1.00 72.56 O ANISOU15311 O LEU B 360 8996 8808 9765 -392 -1921 -5115 O ATOM 15312 CB LEU B 360 32.391 -16.457 -16.251 1.00 72.21 C ANISOU15312 CB LEU B 360 9087 8761 9588 -521 -1991 -4991 C ATOM 15313 CG LEU B 360 31.103 -17.104 -15.746 1.00 71.70 C ANISOU15313 CG LEU B 360 9116 8712 9415 -557 -1970 -4929 C ATOM 15314 CD1 LEU B 360 30.785 -16.662 -14.333 1.00 71.55 C ANISOU15314 CD1 LEU B 360 9139 8694 9354 -637 -2012 -4865 C ATOM 15315 CD2 LEU B 360 29.968 -16.754 -16.672 1.00 71.13 C ANISOU15315 CD2 LEU B 360 9088 8668 9271 -528 -1895 -4914 C ATOM 15316 H LEU B 360 33.488 -18.586 -16.561 1.00 87.39 H ATOM 15317 HA LEU B 360 32.162 -17.043 -18.196 1.00 86.95 H ATOM 15318 HB2 LEU B 360 33.072 -16.593 -15.574 1.00 86.65 H ATOM 15319 HB3 LEU B 360 32.220 -15.507 -16.355 1.00 86.65 H ATOM 15320 HG LEU B 360 31.208 -18.068 -15.746 1.00 86.04 H ATOM 15321 HD11 LEU B 360 29.964 -17.090 -14.046 1.00 85.86 H ATOM 15322 HD12 LEU B 360 31.515 -16.920 -13.750 1.00 85.86 H ATOM 15323 HD13 LEU B 360 30.677 -15.698 -14.321 1.00 85.86 H ATOM 15324 HD21 LEU B 360 29.154 -17.168 -16.345 1.00 85.36 H ATOM 15325 HD22 LEU B 360 29.863 -15.789 -16.692 1.00 85.36 H ATOM 15326 HD23 LEU B 360 30.173 -17.083 -17.561 1.00 85.36 H HETATM15327 N MSE B 361 35.223 -16.341 -17.948 1.00 84.99 N ANISOU15327 N MSE B 361 10505 10329 11458 -402 -2017 -5155 N HETATM15328 CA MSE B 361 36.283 -15.517 -18.509 1.00 81.86 C ANISOU15328 CA MSE B 361 10025 9918 11160 -370 -2026 -5208 C HETATM15329 C MSE B 361 36.435 -15.748 -19.998 1.00 88.96 C ANISOU15329 C MSE B 361 10892 10818 12090 -290 -1968 -5267 C HETATM15330 O MSE B 361 36.866 -14.867 -20.736 1.00 93.51 O ANISOU15330 O MSE B 361 11420 11395 12714 -257 -1945 -5303 O HETATM15331 CB MSE B 361 37.613 -15.837 -17.858 1.00 85.90 C ANISOU15331 CB MSE B 361 10473 10389 11775 -384 -2103 -5234 C HETATM15332 CG MSE B 361 38.653 -14.778 -18.132 1.00 93.94 C ANISOU15332 CG MSE B 361 11412 11392 12891 -371 -2122 -5273 C HETATM15333 SE MSE B 361 40.461 -15.269 -17.593 1.00 92.96 SE ANISOU15333 SE MSE B 361 11193 11208 12919 -375 -2214 -5316 SE HETATM15334 CE MSE B 361 41.456 -14.323 -18.980 1.00 92.08 C ANISOU15334 CE MSE B 361 10985 11080 12921 -305 -2183 -5396 C HETATM15335 H MSE B 361 35.501 -17.009 -17.483 1.00101.99 H HETATM15336 HA MSE B 361 36.082 -14.582 -18.349 1.00 98.23 H HETATM15337 HB2 MSE B 361 37.490 -15.898 -16.898 1.00103.08 H HETATM15338 HB3 MSE B 361 37.943 -16.680 -18.206 1.00103.08 H HETATM15339 HG2 MSE B 361 38.669 -14.596 -19.084 1.00112.73 H HETATM15340 HG3 MSE B 361 38.410 -13.972 -17.649 1.00112.73 H HETATM15341 HE1 MSE B 361 42.405 -14.474 -18.845 1.00110.49 H HETATM15342 HE2 MSE B 361 41.187 -14.662 -19.848 1.00110.49 H HETATM15343 HE3 MSE B 361 41.260 -13.376 -18.918 1.00110.49 H HETATM15344 N MSE B 362 36.120 -16.959 -20.428 1.00 94.82 N ANISOU15344 N MSE B 362 11661 11559 12808 -259 -1944 -5277 N HETATM15345 CA MSE B 362 36.163 -17.294 -21.837 1.00 97.72 C ANISOU15345 CA MSE B 362 12007 11928 13194 -183 -1883 -5326 C HETATM15346 C MSE B 362 34.906 -16.793 -22.528 1.00103.60 C ANISOU15346 C MSE B 362 12808 12713 13842 -170 -1808 -5296 C HETATM15347 O MSE B 362 34.959 -16.319 -23.661 1.00109.00 O ANISOU15347 O MSE B 362 13466 13406 14544 -118 -1756 -5330 O HETATM15348 CB MSE B 362 36.275 -18.800 -22.005 1.00101.43 C ANISOU15348 CB MSE B 362 12487 12381 13671 -157 -1886 -5344 C HETATM15349 CG MSE B 362 36.477 -19.234 -23.431 1.00105.73 C ANISOU15349 CG MSE B 362 13004 12922 14247 -77 -1828 -5398 C HETATM15350 SE MSE B 362 35.165 -20.557 -23.945 1.00146.16 SE ANISOU15350 SE MSE B 362 18211 18066 19257 -55 -1768 -5368 SE HETATM15351 CE MSE B 362 35.512 -21.933 -22.599 1.00102.69 C ANISOU15351 CE MSE B 362 12723 12532 13763 -104 -1848 -5349 C HETATM15352 H MSE B 362 35.876 -17.609 -19.919 1.00113.79 H HETATM15353 HA MSE B 362 36.941 -16.881 -22.243 1.00117.26 H HETATM15354 HB2 MSE B 362 37.031 -19.118 -21.488 1.00121.72 H HETATM15355 HB3 MSE B 362 35.458 -19.213 -21.682 1.00121.72 H HETATM15356 HG2 MSE B 362 36.383 -18.467 -24.017 1.00126.88 H HETATM15357 HG3 MSE B 362 37.359 -19.626 -23.526 1.00126.88 H HETATM15358 HE1 MSE B 362 34.906 -22.676 -22.744 1.00123.23 H HETATM15359 HE2 MSE B 362 36.431 -22.233 -22.684 1.00123.23 H HETATM15360 HE3 MSE B 362 35.368 -21.555 -21.717 1.00123.23 H ATOM 15361 N TRP B 363 33.772 -16.907 -21.845 1.00 77.13 N ANISOU15361 N TRP B 363 9534 9383 10390 -218 -1803 -5231 N ATOM 15362 CA TRP B 363 32.524 -16.364 -22.357 1.00 74.04 C ANISOU15362 CA TRP B 363 9199 9027 9905 -215 -1739 -5193 C ATOM 15363 C TRP B 363 32.673 -14.878 -22.653 1.00 74.83 C ANISOU15363 C TRP B 363 9268 9139 10024 -213 -1725 -5200 C ATOM 15364 O TRP B 363 32.212 -14.399 -23.684 1.00 83.25 O ANISOU15364 O TRP B 363 10339 10226 11066 -173 -1663 -5209 O ATOM 15365 CB TRP B 363 31.386 -16.592 -21.364 1.00 73.40 C ANISOU15365 CB TRP B 363 9204 8961 9724 -278 -1748 -5118 C ATOM 15366 CG TRP B 363 30.926 -18.011 -21.302 1.00 77.05 C ANISOU15366 CG TRP B 363 9711 9419 10146 -273 -1741 -5105 C ATOM 15367 CD1 TRP B 363 31.460 -19.072 -21.967 1.00 77.38 C ANISOU15367 CD1 TRP B 363 9724 9445 10233 -223 -1734 -5152 C ATOM 15368 CD2 TRP B 363 29.831 -18.528 -20.535 1.00 84.79 C ANISOU15368 CD2 TRP B 363 10774 10410 11033 -322 -1741 -5040 C ATOM 15369 NE1 TRP B 363 30.769 -20.219 -21.664 1.00 77.56 N ANISOU15369 NE1 TRP B 363 9806 9468 10195 -237 -1730 -5121 N ATOM 15370 CE2 TRP B 363 29.765 -19.912 -20.787 1.00 81.60 C ANISOU15370 CE2 TRP B 363 10386 9996 10622 -298 -1734 -5052 C ATOM 15371 CE3 TRP B 363 28.898 -17.955 -19.660 1.00 83.34 C ANISOU15371 CE3 TRP B 363 10653 10241 10772 -384 -1746 -4972 C ATOM 15372 CZ2 TRP B 363 28.811 -20.729 -20.196 1.00 85.17 C ANISOU15372 CZ2 TRP B 363 10913 10454 10995 -334 -1732 -4999 C ATOM 15373 CZ3 TRP B 363 27.953 -18.771 -19.072 1.00 72.94 C ANISOU15373 CZ3 TRP B 363 9410 8927 9376 -419 -1743 -4920 C ATOM 15374 CH2 TRP B 363 27.918 -20.141 -19.344 1.00 78.22 C ANISOU15374 CH2 TRP B 363 10092 9587 10042 -394 -1736 -4934 C ATOM 15375 H TRP B 363 33.701 -17.294 -21.080 1.00 92.56 H ATOM 15376 HA TRP B 363 32.298 -16.816 -23.185 1.00 88.84 H ATOM 15377 HB2 TRP B 363 31.687 -16.339 -20.477 1.00 88.08 H ATOM 15378 HB3 TRP B 363 30.628 -16.045 -21.624 1.00 88.08 H ATOM 15379 HD1 TRP B 363 32.188 -19.027 -22.545 1.00 92.86 H ATOM 15380 HE1 TRP B 363 30.941 -21.003 -21.974 1.00 93.07 H ATOM 15381 HE3 TRP B 363 28.920 -17.044 -19.475 1.00100.01 H ATOM 15382 HZ2 TRP B 363 28.782 -21.641 -20.372 1.00102.21 H ATOM 15383 HZ3 TRP B 363 27.329 -18.403 -18.489 1.00 87.53 H ATOM 15384 HH2 TRP B 363 27.268 -20.667 -18.937 1.00 93.87 H ATOM 15385 N LYS B 364 33.325 -14.151 -21.752 1.00 73.87 N ANISOU15385 N LYS B 364 9114 9005 9947 -257 -1781 -5195 N ATOM 15386 CA LYS B 364 33.505 -12.715 -21.929 1.00 72.24 C ANISOU15386 CA LYS B 364 8877 8809 9761 -260 -1773 -5200 C ATOM 15387 C LYS B 364 34.431 -12.383 -23.096 1.00 77.89 C ANISOU15387 C LYS B 364 9516 9514 10565 -194 -1748 -5272 C ATOM 15388 O LYS B 364 34.323 -11.314 -23.693 1.00 81.84 O ANISOU15388 O LYS B 364 9999 10030 11065 -177 -1713 -5280 O ATOM 15389 CB LYS B 364 34.039 -12.072 -20.653 1.00 72.44 C ANISOU15389 CB LYS B 364 8886 8822 9817 -323 -1843 -5177 C ATOM 15390 CG LYS B 364 34.155 -10.565 -20.766 1.00 74.82 C ANISOU15390 CG LYS B 364 9161 9136 10133 -332 -1834 -5177 C ATOM 15391 CD LYS B 364 34.670 -9.926 -19.498 1.00 89.18 C ANISOU15391 CD LYS B 364 10964 10941 11979 -396 -1902 -5150 C ATOM 15392 CE LYS B 364 34.944 -8.437 -19.705 1.00 99.41 C ANISOU15392 CE LYS B 364 12223 12246 13304 -398 -1895 -5159 C ATOM 15393 NZ LYS B 364 33.703 -7.626 -19.874 1.00103.88 N ANISOU15393 NZ LYS B 364 12850 12847 13772 -410 -1845 -5113 N ATOM 15394 H LYS B 364 33.673 -14.465 -21.031 1.00 88.64 H ATOM 15395 HA LYS B 364 32.641 -12.317 -22.118 1.00 86.68 H ATOM 15396 HB2 LYS B 364 33.436 -12.273 -19.920 1.00 86.93 H ATOM 15397 HB3 LYS B 364 34.922 -12.428 -20.464 1.00 86.93 H ATOM 15398 HG2 LYS B 364 34.771 -10.348 -21.483 1.00 89.79 H ATOM 15399 HG3 LYS B 364 33.279 -10.193 -20.956 1.00 89.79 H ATOM 15400 HD2 LYS B 364 34.005 -10.019 -18.798 1.00107.02 H ATOM 15401 HD3 LYS B 364 35.499 -10.355 -19.236 1.00107.02 H ATOM 15402 HE2 LYS B 364 35.420 -8.095 -18.932 1.00119.30 H ATOM 15403 HE3 LYS B 364 35.485 -8.325 -20.503 1.00119.30 H ATOM 15404 HZ1 LYS B 364 33.913 -6.770 -19.991 1.00124.65 H ATOM 15405 HZ2 LYS B 364 33.248 -7.912 -20.584 1.00124.65 H ATOM 15406 HZ3 LYS B 364 33.189 -7.703 -19.152 1.00124.65 H ATOM 15407 N GLU B 365 35.351 -13.286 -23.414 1.00 94.03 N ANISOU15407 N GLU B 365 11512 11528 12686 -157 -1766 -5323 N ATOM 15408 CA GLU B 365 36.226 -13.089 -24.562 1.00 92.66 C ANISOU15408 CA GLU B 365 11268 11340 12598 -91 -1739 -5392 C ATOM 15409 C GLU B 365 35.468 -13.331 -25.867 1.00 95.46 C ANISOU15409 C GLU B 365 11651 11718 12900 -33 -1655 -5400 C ATOM 15410 O GLU B 365 35.405 -12.454 -26.727 1.00104.81 O ANISOU15410 O GLU B 365 12817 12917 14090 0 -1608 -5417 O ATOM 15411 CB GLU B 365 37.436 -14.016 -24.487 1.00 97.34 C ANISOU15411 CB GLU B 365 11803 11890 13292 -69 -1784 -5442 C ATOM 15412 CG GLU B 365 38.367 -13.872 -25.682 1.00113.07 C ANISOU15412 CG GLU B 365 13722 13861 15378 1 -1754 -5514 C ATOM 15413 CD GLU B 365 39.405 -14.975 -25.770 1.00130.37 C ANISOU15413 CD GLU B 365 15866 16009 17660 32 -1787 -5562 C ATOM 15414 OE1 GLU B 365 39.154 -16.087 -25.258 1.00130.70 O ANISOU15414 OE1 GLU B 365 15944 16046 17671 15 -1811 -5542 O ATOM 15415 OE2 GLU B 365 40.478 -14.727 -26.361 1.00134.04 O ANISOU15415 OE2 GLU B 365 16257 16443 18229 72 -1789 -5619 O ATOM 15416 H GLU B 365 35.489 -14.017 -22.983 1.00112.83 H ATOM 15417 HA GLU B 365 36.546 -12.173 -24.564 1.00111.19 H ATOM 15418 HB2 GLU B 365 37.942 -13.810 -23.686 1.00116.81 H ATOM 15419 HB3 GLU B 365 37.127 -14.935 -24.457 1.00116.81 H ATOM 15420 HG2 GLU B 365 37.839 -13.894 -26.496 1.00135.68 H ATOM 15421 HG3 GLU B 365 38.836 -13.026 -25.615 1.00135.68 H ATOM 15422 N THR B 366 34.908 -14.532 -26.007 1.00 76.85 N ANISOU15422 N THR B 366 9862 11770 7567 1716 -835 -1120 N ATOM 15423 CA THR B 366 34.187 -14.935 -27.219 1.00 73.28 C ANISOU15423 CA THR B 366 9468 11267 7110 1755 -726 -1104 C ATOM 15424 C THR B 366 32.705 -14.604 -27.111 1.00 72.84 C ANISOU15424 C THR B 366 9540 11184 6952 1654 -657 -1092 C ATOM 15425 O THR B 366 31.861 -15.254 -27.722 1.00 71.36 O ANISOU15425 O THR B 366 9457 10941 6716 1678 -608 -1063 O ATOM 15426 CB THR B 366 34.334 -16.451 -27.493 1.00 72.94 C ANISOU15426 CB THR B 366 9498 11167 7049 1869 -793 -1061 C ATOM 15427 OG1 THR B 366 33.726 -17.205 -26.434 1.00 65.57 O ANISOU15427 OG1 THR B 366 8708 10204 6002 1842 -901 -1024 O ATOM 15428 CG2 THR B 366 35.800 -16.836 -27.605 1.00 83.35 C ANISOU15428 CG2 THR B 366 10692 12509 8466 1972 -863 -1071 C ATOM 15429 H THR B 366 34.932 -15.144 -25.403 1.00 92.22 H ATOM 15430 HA THR B 366 34.550 -14.453 -27.979 1.00 87.94 H ATOM 15431 HB THR B 366 33.898 -16.669 -28.332 1.00 87.53 H ATOM 15432 HG1 THR B 366 33.807 -18.028 -26.584 1.00 78.69 H ATOM 15433 HG21 THR B 366 35.880 -17.787 -27.777 1.00100.01 H ATOM 15434 HG22 THR B 366 36.215 -16.348 -28.333 1.00100.01 H ATOM 15435 HG23 THR B 366 36.262 -16.624 -26.779 1.00100.01 H ATOM 15436 N GLY B 367 32.398 -13.590 -26.317 1.00 81.54 N ANISOU15436 N GLY B 367 10632 12325 8022 1542 -656 -1114 N ATOM 15437 CA GLY B 367 31.040 -13.116 -26.170 1.00 83.55 C ANISOU15437 CA GLY B 367 10995 12562 8187 1438 -587 -1108 C ATOM 15438 C GLY B 367 30.902 -11.819 -26.928 1.00 90.94 C ANISOU15438 C GLY B 367 11836 13531 9185 1381 -445 -1149 C ATOM 15439 O GLY B 367 31.906 -11.201 -27.312 1.00 74.76 O ANISOU15439 O GLY B 367 9636 11527 7242 1408 -419 -1184 O ATOM 15440 H GLY B 367 32.971 -13.154 -25.847 1.00 97.84 H ATOM 15441 HA2 GLY B 367 30.417 -13.766 -26.531 1.00100.26 H ATOM 15442 HA3 GLY B 367 30.838 -12.963 -25.234 1.00100.26 H ATOM 15443 N GLY B 368 29.656 -11.408 -27.141 1.00 78.68 N ANISOU15443 N GLY B 368 10372 11956 7566 1301 -355 -1144 N ATOM 15444 CA GLY B 368 29.372 -10.219 -27.913 1.00 71.94 C ANISOU15444 CA GLY B 368 9444 11128 6762 1244 -212 -1179 C ATOM 15445 C GLY B 368 28.794 -10.593 -29.257 1.00 63.35 C ANISOU15445 C GLY B 368 8392 9992 5685 1293 -97 -1165 C ATOM 15446 O GLY B 368 29.023 -11.688 -29.771 1.00 60.12 O ANISOU15446 O GLY B 368 8014 9543 5286 1394 -124 -1138 O ATOM 15447 H GLY B 368 28.955 -11.808 -26.843 1.00 94.41 H ATOM 15448 HA2 GLY B 368 28.733 -9.662 -27.441 1.00 86.33 H ATOM 15449 HA3 GLY B 368 30.188 -9.712 -28.052 1.00 86.33 H ATOM 15450 N VAL B 369 28.054 -9.664 -29.839 1.00 65.30 N ANISOU15450 N VAL B 369 8632 10244 5934 1222 33 -1184 N ATOM 15451 CA VAL B 369 27.285 -9.960 -31.027 1.00 67.48 C ANISOU15451 CA VAL B 369 8963 10473 6203 1249 147 -1168 C ATOM 15452 C VAL B 369 28.243 -10.227 -32.178 1.00 63.95 C ANISOU15452 C VAL B 369 8402 10026 5869 1360 190 -1180 C ATOM 15453 O VAL B 369 28.028 -11.135 -32.979 1.00 58.93 O ANISOU15453 O VAL B 369 7819 9341 5230 1438 216 -1152 O ATOM 15454 CB VAL B 369 26.273 -8.821 -31.346 1.00 59.96 C ANISOU15454 CB VAL B 369 8025 9530 5227 1141 277 -1188 C ATOM 15455 CG1 VAL B 369 25.571 -8.391 -30.069 1.00 50.99 C ANISOU15455 CG1 VAL B 369 6972 8407 3995 1027 222 -1186 C ATOM 15456 CG2 VAL B 369 26.945 -7.614 -32.001 1.00 56.88 C ANISOU15456 CG2 VAL B 369 7471 9192 4949 1125 372 -1237 C ATOM 15457 H VAL B 369 27.982 -8.853 -29.564 1.00 78.36 H ATOM 15458 HA VAL B 369 26.776 -10.771 -30.874 1.00 80.98 H ATOM 15459 HB VAL B 369 25.601 -9.159 -31.959 1.00 71.95 H ATOM 15460 HG11 VAL B 369 24.943 -7.681 -30.278 1.00 61.19 H ATOM 15461 HG12 VAL B 369 25.099 -9.152 -29.697 1.00 61.19 H ATOM 15462 HG13 VAL B 369 26.234 -8.071 -29.437 1.00 61.19 H ATOM 15463 HG21 VAL B 369 26.273 -6.937 -32.178 1.00 68.26 H ATOM 15464 HG22 VAL B 369 27.619 -7.263 -31.399 1.00 68.26 H ATOM 15465 HG23 VAL B 369 27.358 -7.896 -32.833 1.00 68.26 H ATOM 15466 N GLU B 370 29.319 -9.448 -32.220 1.00 68.77 N ANISOU15466 N GLU B 370 8857 10695 6579 1367 194 -1220 N ATOM 15467 CA GLU B 370 30.300 -9.529 -33.291 1.00 72.93 C ANISOU15467 CA GLU B 370 9258 11231 7222 1464 241 -1237 C ATOM 15468 C GLU B 370 30.992 -10.895 -33.359 1.00 77.13 C ANISOU15468 C GLU B 370 9808 11732 7768 1587 144 -1207 C ATOM 15469 O GLU B 370 31.149 -11.456 -34.446 1.00 81.18 O ANISOU15469 O GLU B 370 10305 12213 8327 1673 198 -1197 O ATOM 15470 CB GLU B 370 31.333 -8.404 -33.148 1.00 81.54 C ANISOU15470 CB GLU B 370 10180 12392 8410 1440 250 -1286 C ATOM 15471 CG GLU B 370 32.272 -8.505 -31.930 1.00 99.77 C ANISOU15471 CG GLU B 370 12443 14739 10724 1445 105 -1292 C ATOM 15472 CD GLU B 370 31.569 -8.328 -30.584 1.00 99.67 C ANISOU15472 CD GLU B 370 12532 14732 10605 1344 30 -1281 C ATOM 15473 OE1 GLU B 370 30.465 -7.731 -30.547 1.00 82.67 O ANISOU15473 OE1 GLU B 370 10450 12571 8390 1250 104 -1282 O ATOM 15474 OE2 GLU B 370 32.129 -8.782 -29.559 1.00 95.27 O ANISOU15474 OE2 GLU B 370 11983 14189 10027 1359 -104 -1271 O ATOM 15475 H GLU B 370 29.504 -8.854 -31.626 1.00 82.53 H ATOM 15476 HA GLU B 370 29.841 -9.396 -34.135 1.00 87.52 H ATOM 15477 HB2 GLU B 370 31.889 -8.397 -33.943 1.00 97.85 H ATOM 15478 HB3 GLU B 370 30.858 -7.561 -33.079 1.00 97.85 H ATOM 15479 HG2 GLU B 370 32.691 -9.380 -31.931 1.00119.72 H ATOM 15480 HG3 GLU B 370 32.950 -7.816 -32.002 1.00119.72 H ATOM 15481 N LYS B 371 31.396 -11.431 -32.209 1.00 71.01 N ANISOU15481 N LYS B 371 9064 10962 6953 1596 1 -1192 N ATOM 15482 CA LYS B 371 32.075 -12.725 -32.176 1.00 74.48 C ANISOU15482 CA LYS B 371 9521 11374 7403 1710 -100 -1163 C ATOM 15483 C LYS B 371 31.057 -13.834 -32.427 1.00 75.87 C ANISOU15483 C LYS B 371 9860 11478 7488 1738 -99 -1116 C ATOM 15484 O LYS B 371 31.354 -14.832 -33.096 1.00 73.21 O ANISOU15484 O LYS B 371 9537 11103 7176 1842 -110 -1093 O ATOM 15485 CB LYS B 371 32.766 -12.965 -30.830 1.00 76.24 C ANISOU15485 CB LYS B 371 9736 11625 7606 1706 -254 -1160 C ATOM 15486 CG LYS B 371 33.442 -11.746 -30.234 1.00 92.69 C ANISOU15486 CG LYS B 371 11695 13780 9742 1639 -264 -1204 C ATOM 15487 CD LYS B 371 34.752 -11.419 -30.926 1.00 99.95 C ANISOU15487 CD LYS B 371 12442 14739 10796 1712 -239 -1237 C ATOM 15488 CE LYS B 371 35.869 -12.321 -30.442 1.00 87.98 C ANISOU15488 CE LYS B 371 10889 13227 9312 1806 -375 -1224 C ATOM 15489 NZ LYS B 371 37.195 -11.699 -30.682 1.00 97.84 N ANISOU15489 NZ LYS B 371 11960 14533 10683 1843 -373 -1264 N ATOM 15490 H LYS B 371 31.290 -11.067 -31.437 1.00 85.21 H ATOM 15491 HA LYS B 371 32.745 -12.757 -32.876 1.00 89.37 H ATOM 15492 HB2 LYS B 371 32.102 -13.272 -30.193 1.00 91.49 H ATOM 15493 HB3 LYS B 371 33.444 -13.648 -30.949 1.00 91.49 H ATOM 15494 HG2 LYS B 371 32.854 -10.981 -30.323 1.00111.23 H ATOM 15495 HG3 LYS B 371 33.631 -11.915 -29.297 1.00111.23 H ATOM 15496 HD2 LYS B 371 34.650 -11.546 -31.882 1.00119.94 H ATOM 15497 HD3 LYS B 371 34.996 -10.500 -30.732 1.00119.94 H ATOM 15498 HE2 LYS B 371 35.770 -12.472 -29.489 1.00105.57 H ATOM 15499 HE3 LYS B 371 35.835 -13.162 -30.924 1.00105.57 H ATOM 15500 HZ1 LYS B 371 37.840 -12.239 -30.393 1.00117.41 H ATOM 15501 HZ2 LYS B 371 37.308 -11.551 -31.552 1.00117.41 H ATOM 15502 HZ3 LYS B 371 37.250 -10.924 -30.248 1.00117.41 H ATOM 15503 N LEU B 372 29.855 -13.650 -31.882 1.00 64.63 N ANISOU15503 N LEU B 372 8560 10036 5959 1644 -88 -1100 N ATOM 15504 CA LEU B 372 28.792 -14.642 -31.994 1.00 59.01 C ANISOU15504 CA LEU B 372 8014 9258 5150 1656 -91 -1055 C ATOM 15505 C LEU B 372 28.409 -14.914 -33.442 1.00 65.26 C ANISOU15505 C LEU B 372 8812 10009 5974 1711 32 -1047 C ATOM 15506 O LEU B 372 28.176 -16.061 -33.823 1.00 63.82 O ANISOU15506 O LEU B 372 8714 9773 5760 1786 10 -1011 O ATOM 15507 CB LEU B 372 27.556 -14.181 -31.232 1.00 58.63 C ANISOU15507 CB LEU B 372 8082 9204 4992 1534 -80 -1047 C ATOM 15508 CG LEU B 372 27.449 -14.635 -29.782 1.00 57.17 C ANISOU15508 CG LEU B 372 7984 9018 4719 1499 -224 -1025 C ATOM 15509 CD1 LEU B 372 26.280 -13.952 -29.111 1.00 59.26 C ANISOU15509 CD1 LEU B 372 8342 9286 4890 1370 -196 -1026 C ATOM 15510 CD2 LEU B 372 27.269 -16.132 -29.719 1.00 57.17 C ANISOU15510 CD2 LEU B 372 8102 8960 4662 1581 -305 -977 C ATOM 15511 H LEU B 372 29.630 -12.949 -31.438 1.00 77.55 H ATOM 15512 HA LEU B 372 29.095 -15.475 -31.601 1.00 70.81 H ATOM 15513 HB2 LEU B 372 27.543 -13.211 -31.232 1.00 70.36 H ATOM 15514 HB3 LEU B 372 26.772 -14.512 -31.697 1.00 70.36 H ATOM 15515 HG LEU B 372 28.260 -14.400 -29.305 1.00 68.60 H ATOM 15516 HD11 LEU B 372 26.226 -14.252 -28.190 1.00 71.12 H ATOM 15517 HD12 LEU B 372 26.417 -12.992 -29.140 1.00 71.12 H ATOM 15518 HD13 LEU B 372 25.466 -14.185 -29.584 1.00 71.12 H ATOM 15519 HD21 LEU B 372 27.202 -16.403 -28.790 1.00 68.61 H ATOM 15520 HD22 LEU B 372 26.457 -16.372 -30.193 1.00 68.61 H ATOM 15521 HD23 LEU B 372 28.034 -16.559 -30.135 1.00 68.61 H ATOM 15522 N PHE B 373 28.339 -13.856 -34.242 1.00 76.19 N ANISOU15522 N PHE B 373 10109 11420 7420 1673 160 -1081 N ATOM 15523 CA PHE B 373 27.927 -13.977 -35.636 1.00 72.97 C ANISOU15523 CA PHE B 373 9704 10978 7044 1715 287 -1077 C ATOM 15524 C PHE B 373 29.069 -14.397 -36.552 1.00 68.88 C ANISOU15524 C PHE B 373 9071 10463 6637 1834 297 -1087 C ATOM 15525 O PHE B 373 28.855 -14.593 -37.745 1.00 72.46 O ANISOU15525 O PHE B 373 9519 10887 7124 1882 395 -1083 O ATOM 15526 CB PHE B 373 27.354 -12.652 -36.144 1.00 68.32 C ANISOU15526 CB PHE B 373 9068 10415 6475 1623 425 -1110 C ATOM 15527 CG PHE B 373 25.889 -12.469 -35.865 1.00 69.28 C ANISOU15527 CG PHE B 373 9330 10508 6485 1527 469 -1091 C ATOM 15528 CD1 PHE B 373 24.932 -12.999 -36.723 1.00 67.31 C ANISOU15528 CD1 PHE B 373 9180 10203 6193 1545 550 -1063 C ATOM 15529 CD2 PHE B 373 25.466 -11.744 -34.763 1.00 68.90 C ANISOU15529 CD2 PHE B 373 9313 10489 6378 1418 433 -1101 C ATOM 15530 CE1 PHE B 373 23.585 -12.820 -36.472 1.00 64.95 C ANISOU15530 CE1 PHE B 373 9008 9877 5792 1456 592 -1046 C ATOM 15531 CE2 PHE B 373 24.122 -11.564 -34.512 1.00 68.17 C ANISOU15531 CE2 PHE B 373 9347 10371 6184 1329 475 -1085 C ATOM 15532 CZ PHE B 373 23.179 -12.104 -35.368 1.00 63.89 C ANISOU15532 CZ PHE B 373 8904 9773 5600 1348 555 -1057 C ATOM 15533 H PHE B 373 28.526 -13.052 -34.000 1.00 91.43 H ATOM 15534 HA PHE B 373 27.231 -14.649 -35.700 1.00 87.57 H ATOM 15535 HB2 PHE B 373 27.829 -11.922 -35.717 1.00 81.98 H ATOM 15536 HB3 PHE B 373 27.479 -12.607 -37.105 1.00 81.98 H ATOM 15537 HD1 PHE B 373 25.202 -13.484 -37.469 1.00 80.77 H ATOM 15538 HD2 PHE B 373 26.096 -11.380 -34.184 1.00 82.68 H ATOM 15539 HE1 PHE B 373 22.952 -13.184 -37.049 1.00 77.94 H ATOM 15540 HE2 PHE B 373 23.849 -11.081 -33.766 1.00 81.81 H ATOM 15541 HZ PHE B 373 22.273 -11.983 -35.198 1.00 76.67 H ATOM 15542 N SER B 374 30.274 -14.520 -36.003 1.00 80.73 N ANISOU15542 N SER B 374 10480 11999 8195 1882 196 -1099 N ATOM 15543 CA SER B 374 31.453 -14.823 -36.812 1.00 81.42 C ANISOU15543 CA SER B 374 10445 12097 8395 1992 202 -1113 C ATOM 15544 C SER B 374 32.144 -16.140 -36.451 1.00 73.94 C ANISOU15544 C SER B 374 9526 11123 7444 2096 72 -1083 C ATOM 15545 O SER B 374 33.160 -16.483 -37.053 1.00 73.91 O ANISOU15545 O SER B 374 9425 11127 7532 2192 64 -1092 O ATOM 15546 CB SER B 374 32.456 -13.675 -36.711 1.00 78.78 C ANISOU15546 CB SER B 374 9942 11833 8159 1967 216 -1162 C ATOM 15547 OG SER B 374 32.692 -13.329 -35.359 1.00 81.65 O ANISOU15547 OG SER B 374 10304 12234 8487 1905 112 -1170 O ATOM 15548 H SER B 374 30.437 -14.432 -35.163 1.00 96.87 H ATOM 15549 HA SER B 374 31.177 -14.887 -37.740 1.00 97.71 H ATOM 15550 HB2 SER B 374 33.293 -13.951 -37.118 1.00 94.54 H ATOM 15551 HB3 SER B 374 32.100 -12.903 -37.178 1.00 94.54 H ATOM 15552 HG SER B 374 31.975 -13.088 -34.995 1.00 97.99 H ATOM 15553 N LEU B 375 31.591 -16.870 -35.483 1.00 64.90 N ANISOU15553 N LEU B 375 8514 9950 6195 2075 -28 -1048 N ATOM 15554 CA LEU B 375 32.147 -18.155 -35.059 1.00 65.28 C ANISOU15554 CA LEU B 375 8604 9970 6228 2168 -156 -1016 C ATOM 15555 C LEU B 375 31.078 -19.253 -34.995 1.00 60.76 C ANISOU15555 C LEU B 375 8210 9329 5546 2179 -179 -966 C ATOM 15556 O LEU B 375 29.915 -18.962 -34.717 1.00 63.79 O ANISOU15556 O LEU B 375 8699 9697 5842 2091 -141 -956 O ATOM 15557 CB LEU B 375 32.778 -18.004 -33.678 1.00 73.00 C ANISOU15557 CB LEU B 375 9556 10990 7192 2136 -291 -1023 C ATOM 15558 CG LEU B 375 33.917 -17.001 -33.513 1.00 62.73 C ANISOU15558 CG LEU B 375 8083 9759 5991 2125 -295 -1070 C ATOM 15559 CD1 LEU B 375 34.466 -17.103 -32.109 1.00 58.77 C ANISOU15559 CD1 LEU B 375 7580 9288 5461 2103 -441 -1068 C ATOM 15560 CD2 LEU B 375 35.006 -17.260 -34.526 1.00 64.06 C ANISOU15560 CD2 LEU B 375 8128 9934 6279 2236 -266 -1084 C ATOM 15561 H LEU B 375 30.885 -16.640 -35.050 1.00 77.88 H ATOM 15562 HA LEU B 375 32.836 -18.431 -35.684 1.00 78.33 H ATOM 15563 HB2 LEU B 375 32.079 -17.741 -33.058 1.00 87.60 H ATOM 15564 HB3 LEU B 375 33.125 -18.870 -33.413 1.00 87.60 H ATOM 15565 HG LEU B 375 33.579 -16.101 -33.648 1.00 75.27 H ATOM 15566 HD11 LEU B 375 35.190 -16.465 -32.006 1.00 70.52 H ATOM 15567 HD12 LEU B 375 33.757 -16.904 -31.478 1.00 70.52 H ATOM 15568 HD13 LEU B 375 34.796 -18.004 -31.964 1.00 70.52 H ATOM 15569 HD21 LEU B 375 35.715 -16.611 -34.400 1.00 76.88 H ATOM 15570 HD22 LEU B 375 35.351 -18.157 -34.395 1.00 76.88 H ATOM 15571 HD23 LEU B 375 34.634 -17.176 -35.418 1.00 76.88 H ATOM 15572 N PRO B 376 31.477 -20.524 -35.209 1.00 64.28 N ANISOU15572 N PRO B 376 8693 9735 5996 2288 -246 -936 N ATOM 15573 CA PRO B 376 30.529 -21.652 -35.223 1.00 73.15 C ANISOU15573 CA PRO B 376 9982 10791 7021 2310 -269 -888 C ATOM 15574 C PRO B 376 29.773 -21.877 -33.902 1.00 71.12 C ANISOU15574 C PRO B 376 9857 10523 6642 2234 -364 -863 C ATOM 15575 O PRO B 376 30.261 -21.491 -32.836 1.00 73.71 O ANISOU15575 O PRO B 376 10147 10893 6966 2193 -453 -876 O ATOM 15576 CB PRO B 376 31.430 -22.868 -35.495 1.00 71.31 C ANISOU15576 CB PRO B 376 9730 10531 6832 2443 -347 -867 C ATOM 15577 CG PRO B 376 32.719 -22.327 -35.976 1.00 69.80 C ANISOU15577 CG PRO B 376 9361 10389 6771 2494 -328 -905 C ATOM 15578 CD PRO B 376 32.868 -20.996 -35.320 1.00 70.74 C ANISOU15578 CD PRO B 376 9401 10572 6907 2393 -317 -944 C ATOM 15579 HA PRO B 376 29.893 -21.552 -35.948 1.00 87.78 H ATOM 15580 HB2 PRO B 376 31.556 -23.367 -34.673 1.00 85.57 H ATOM 15581 HB3 PRO B 376 31.022 -23.427 -36.174 1.00 85.57 H ATOM 15582 HG2 PRO B 376 33.440 -22.920 -35.711 1.00 83.76 H ATOM 15583 HG3 PRO B 376 32.692 -22.230 -36.940 1.00 83.76 H ATOM 15584 HD2 PRO B 376 33.264 -21.093 -34.440 1.00 84.89 H ATOM 15585 HD3 PRO B 376 33.385 -20.397 -35.880 1.00 84.89 H ATOM 15586 N ALA B 377 28.604 -22.514 -33.982 1.00 64.15 N ANISOU15586 N ALA B 377 9128 9584 5661 2217 -346 -826 N ATOM 15587 CA ALA B 377 27.809 -22.847 -32.797 1.00 68.15 C ANISOU15587 CA ALA B 377 9774 10074 6046 2150 -434 -798 C ATOM 15588 C ALA B 377 28.456 -24.001 -32.039 1.00 65.08 C ANISOU15588 C ALA B 377 9422 9669 5637 2225 -587 -770 C ATOM 15589 O ALA B 377 28.429 -24.046 -30.805 1.00 65.37 O ANISOU15589 O ALA B 377 9504 9719 5613 2177 -694 -762 O ATOM 15590 CB ALA B 377 26.371 -23.200 -33.197 1.00 69.84 C ANISOU15590 CB ALA B 377 10139 10231 6165 2114 -362 -768 C ATOM 15591 H ALA B 377 28.245 -22.768 -34.721 1.00 76.98 H ATOM 15592 HA ALA B 377 27.778 -22.077 -32.208 1.00 81.78 H ATOM 15593 HB1 ALA B 377 25.866 -23.416 -32.398 1.00 83.81 H ATOM 15594 HB2 ALA B 377 25.972 -22.439 -33.646 1.00 83.81 H ATOM 15595 HB3 ALA B 377 26.389 -23.965 -33.794 1.00 83.81 H ATOM 15596 N GLN B 378 29.015 -24.941 -32.796 1.00 68.17 N ANISOU15596 N GLN B 378 9794 10028 6078 2343 -596 -754 N ATOM 15597 CA GLN B 378 29.895 -25.962 -32.247 1.00 73.34 C ANISOU15597 CA GLN B 378 10447 10675 6743 2430 -734 -734 C ATOM 15598 C GLN B 378 31.333 -25.516 -32.512 1.00 67.98 C ANISOU15598 C GLN B 378 9588 10048 6194 2487 -743 -770 C ATOM 15599 O GLN B 378 31.781 -25.556 -33.657 1.00 66.71 O ANISOU15599 O GLN B 378 9348 9882 6118 2558 -665 -782 O ATOM 15600 CB GLN B 378 29.638 -27.314 -32.916 1.00 72.86 C ANISOU15600 CB GLN B 378 10478 10547 6658 2528 -739 -693 C ATOM 15601 CG GLN B 378 30.372 -28.462 -32.251 1.00 72.70 C ANISOU15601 CG GLN B 378 10482 10511 6629 2611 -888 -666 C ATOM 15602 CD GLN B 378 29.790 -28.788 -30.893 1.00 75.56 C ANISOU15602 CD GLN B 378 10968 10864 6877 2548 -1000 -640 C ATOM 15603 OE1 GLN B 378 28.591 -28.624 -30.669 1.00 71.08 O ANISOU15603 OE1 GLN B 378 10516 10275 6216 2466 -963 -626 O ATOM 15604 NE2 GLN B 378 30.636 -29.241 -29.974 1.00 79.01 N ANISOU15604 NE2 GLN B 378 11381 11318 7320 2583 -1138 -633 N ATOM 15605 H GLN B 378 28.896 -25.008 -33.645 1.00 81.80 H ATOM 15606 HA GLN B 378 29.757 -26.046 -31.291 1.00 88.00 H ATOM 15607 HB2 GLN B 378 28.688 -27.507 -32.880 1.00 87.43 H ATOM 15608 HB3 GLN B 378 29.930 -27.268 -33.840 1.00 87.43 H ATOM 15609 HG2 GLN B 378 30.301 -29.252 -32.809 1.00 87.24 H ATOM 15610 HG3 GLN B 378 31.303 -28.218 -32.132 1.00 87.24 H ATOM 15611 HE21 GLN B 378 31.469 -29.336 -30.166 1.00 94.81 H ATOM 15612 HE22 GLN B 378 30.351 -29.439 -29.187 1.00 94.81 H ATOM 15613 N PRO B 379 32.056 -25.077 -31.462 1.00 63.93 N ANISOU15613 N PRO B 379 9010 9585 5697 2455 -838 -788 N ATOM 15614 CA PRO B 379 33.410 -24.530 -31.621 1.00 67.87 C ANISOU15614 CA PRO B 379 9333 10138 6316 2497 -848 -826 C ATOM 15615 C PRO B 379 34.394 -25.466 -32.318 1.00 77.25 C ANISOU15615 C PRO B 379 10461 11306 7582 2634 -879 -816 C ATOM 15616 O PRO B 379 34.295 -26.688 -32.175 1.00 72.62 O ANISOU15616 O PRO B 379 9969 10672 6950 2700 -954 -777 O ATOM 15617 CB PRO B 379 33.857 -24.292 -30.177 1.00 57.65 C ANISOU15617 CB PRO B 379 8027 8885 4993 2447 -977 -831 C ATOM 15618 CG PRO B 379 32.619 -24.072 -29.441 1.00 58.88 C ANISOU15618 CG PRO B 379 8315 9026 5031 2340 -979 -815 C ATOM 15619 CD PRO B 379 31.610 -24.986 -30.061 1.00 64.26 C ANISOU15619 CD PRO B 379 9136 9638 5644 2370 -936 -776 C ATOM 15620 HA PRO B 379 33.380 -23.683 -32.093 1.00 81.44 H ATOM 15621 HB2 PRO B 379 34.322 -25.076 -29.843 1.00 69.18 H ATOM 15622 HB3 PRO B 379 34.427 -23.509 -30.134 1.00 69.18 H ATOM 15623 HG2 PRO B 379 32.752 -24.295 -28.507 1.00 70.66 H ATOM 15624 HG3 PRO B 379 32.344 -23.147 -29.536 1.00 70.66 H ATOM 15625 HD2 PRO B 379 31.639 -25.859 -29.639 1.00 77.12 H ATOM 15626 HD3 PRO B 379 30.723 -24.596 -30.012 1.00 77.12 H ATOM 15627 N LEU B 380 35.342 -24.878 -33.045 1.00 76.44 N ANISOU15627 N LEU B 380 10203 11242 7599 2675 -821 -852 N ATOM 15628 CA LEU B 380 36.290 -25.635 -33.852 1.00 69.76 C ANISOU15628 CA LEU B 380 9285 10381 6839 2803 -830 -849 C ATOM 15629 C LEU B 380 37.727 -25.287 -33.483 1.00 68.64 C ANISOU15629 C LEU B 380 8989 10296 6794 2841 -900 -878 C ATOM 15630 O LEU B 380 38.205 -24.185 -33.744 1.00 72.09 O ANISOU15630 O LEU B 380 9300 10785 7307 2806 -837 -920 O ATOM 15631 CB LEU B 380 36.042 -25.369 -35.337 1.00 70.39 C ANISOU15631 CB LEU B 380 9324 10444 6976 2832 -678 -862 C ATOM 15632 CG LEU B 380 34.650 -25.772 -35.834 1.00 61.92 C ANISOU15632 CG LEU B 380 8400 9313 5815 2805 -603 -832 C ATOM 15633 CD1 LEU B 380 34.445 -25.352 -37.285 1.00 58.50 C ANISOU15633 CD1 LEU B 380 7912 8870 5444 2824 -447 -849 C ATOM 15634 CD2 LEU B 380 34.417 -27.271 -35.664 1.00 59.46 C ANISOU15634 CD2 LEU B 380 8215 8940 5439 2880 -689 -782 C ATOM 15635 H LEU B 380 35.457 -24.027 -33.086 1.00 91.73 H ATOM 15636 HA LEU B 380 36.158 -26.583 -33.690 1.00 83.71 H ATOM 15637 HB2 LEU B 380 36.149 -24.420 -35.504 1.00 84.47 H ATOM 15638 HB3 LEU B 380 36.694 -25.867 -35.855 1.00 84.47 H ATOM 15639 HG LEU B 380 33.986 -25.311 -35.299 1.00 74.31 H ATOM 15640 HD11 LEU B 380 33.557 -25.621 -37.568 1.00 70.19 H ATOM 15641 HD12 LEU B 380 34.536 -24.388 -37.350 1.00 70.19 H ATOM 15642 HD13 LEU B 380 35.115 -25.786 -37.836 1.00 70.19 H ATOM 15643 HD21 LEU B 380 33.530 -27.491 -35.987 1.00 71.36 H ATOM 15644 HD22 LEU B 380 35.085 -27.754 -36.176 1.00 71.36 H ATOM 15645 HD23 LEU B 380 34.493 -27.497 -34.724 1.00 71.36 H ATOM 15646 N TRP B 381 38.421 -26.254 -32.898 1.00 79.24 N ANISOU15646 N TRP B 381 10344 11627 8134 2915 -1031 -856 N ATOM 15647 CA TRP B 381 39.732 -26.008 -32.315 1.00 82.56 C ANISOU15647 CA TRP B 381 10637 12101 8630 2944 -1120 -879 C ATOM 15648 C TRP B 381 40.866 -25.833 -33.333 1.00 86.66 C ANISOU15648 C TRP B 381 10999 12643 9284 3032 -1067 -908 C ATOM 15649 O TRP B 381 41.884 -25.219 -33.021 1.00 97.29 O ANISOU15649 O TRP B 381 12214 14046 10706 3033 -1101 -940 O ATOM 15650 CB TRP B 381 40.076 -27.129 -31.337 1.00 71.80 C ANISOU15650 CB TRP B 381 9344 10717 7218 2995 -1279 -844 C ATOM 15651 CG TRP B 381 39.049 -27.312 -30.259 1.00 73.12 C ANISOU15651 CG TRP B 381 9661 10865 7255 2910 -1342 -816 C ATOM 15652 CD1 TRP B 381 38.076 -26.430 -29.892 1.00 73.61 C ANISOU15652 CD1 TRP B 381 9776 10941 7252 2789 -1287 -826 C ATOM 15653 CD2 TRP B 381 38.898 -28.453 -29.405 1.00 78.11 C ANISOU15653 CD2 TRP B 381 10411 11461 7807 2940 -1472 -774 C ATOM 15654 NE1 TRP B 381 37.333 -26.949 -28.861 1.00 69.55 N ANISOU15654 NE1 TRP B 381 9403 10400 6621 2742 -1375 -793 N ATOM 15655 CE2 TRP B 381 37.817 -28.189 -28.545 1.00 73.15 C ANISOU15655 CE2 TRP B 381 9902 10826 7066 2833 -1489 -761 C ATOM 15656 CE3 TRP B 381 39.577 -29.672 -29.285 1.00 79.75 C ANISOU15656 CE3 TRP B 381 10634 11641 8028 3048 -1576 -746 C ATOM 15657 CZ2 TRP B 381 37.395 -29.099 -27.581 1.00 82.86 C ANISOU15657 CZ2 TRP B 381 11265 12023 8197 2829 -1606 -721 C ATOM 15658 CZ3 TRP B 381 39.157 -30.574 -28.325 1.00 72.56 C ANISOU15658 CZ3 TRP B 381 9855 10697 7018 3045 -1692 -706 C ATOM 15659 CH2 TRP B 381 38.075 -30.284 -27.488 1.00 76.59 C ANISOU15659 CH2 TRP B 381 10482 11201 7416 2936 -1706 -693 C ATOM 15660 H TRP B 381 38.153 -27.068 -32.826 1.00 95.08 H ATOM 15661 HA TRP B 381 39.683 -25.186 -31.801 1.00 99.07 H ATOM 15662 HB2 TRP B 381 40.145 -27.963 -31.828 1.00 86.15 H ATOM 15663 HB3 TRP B 381 40.923 -26.926 -30.911 1.00 86.15 H ATOM 15664 HD1 TRP B 381 37.939 -25.595 -30.279 1.00 88.33 H ATOM 15665 HE1 TRP B 381 36.668 -26.559 -28.479 1.00 83.45 H ATOM 15666 HE3 TRP B 381 40.297 -29.871 -29.840 1.00 95.70 H ATOM 15667 HZ2 TRP B 381 36.677 -28.911 -27.021 1.00 99.44 H ATOM 15668 HZ3 TRP B 381 39.600 -31.387 -28.237 1.00 87.08 H ATOM 15669 HH2 TRP B 381 37.814 -30.909 -26.850 1.00 91.90 H ATOM 15670 N ASN B 382 40.698 -26.369 -34.538 1.00 87.81 N ANISOU15670 N ASN B 382 11157 12748 9460 3105 -985 -898 N ATOM 15671 CA ASN B 382 41.738 -26.281 -35.560 1.00 91.99 C ANISOU15671 CA ASN B 382 11543 13294 10115 3193 -933 -923 C ATOM 15672 C ASN B 382 41.385 -25.215 -36.589 1.00 84.07 C ANISOU15672 C ASN B 382 10473 12308 9160 3147 -772 -956 C ATOM 15673 O ASN B 382 40.275 -25.209 -37.112 1.00 92.06 O ANISOU15673 O ASN B 382 11579 13285 10117 3109 -683 -943 O ATOM 15674 CB ASN B 382 41.909 -27.633 -36.256 1.00 95.84 C ANISOU15674 CB ASN B 382 12077 13723 10613 3315 -952 -890 C ATOM 15675 CG ASN B 382 43.245 -27.765 -36.970 1.00 91.68 C ANISOU15675 CG ASN B 382 11403 13218 10214 3420 -950 -911 C ATOM 15676 OD1 ASN B 382 43.773 -26.800 -37.526 1.00 85.05 O ANISOU15676 OD1 ASN B 382 10429 12422 9462 3407 -870 -952 O ATOM 15677 ND2 ASN B 382 43.798 -28.970 -36.954 1.00 99.13 N ANISOU15677 ND2 ASN B 382 12369 14129 11168 3525 -1038 -884 N ATOM 15678 H ASN B 382 39.992 -26.789 -34.790 1.00105.37 H ATOM 15679 HA ASN B 382 42.581 -26.040 -35.144 1.00110.39 H ATOM 15680 HB2 ASN B 382 41.853 -28.339 -35.594 1.00115.00 H ATOM 15681 HB3 ASN B 382 41.206 -27.740 -36.915 1.00115.00 H ATOM 15682 HD21 ASN B 382 44.554 -29.102 -37.342 1.00118.96 H ATOM 15683 HD22 ASN B 382 43.400 -29.620 -36.555 1.00118.96 H ATOM 15684 N ASN B 383 42.323 -24.320 -36.882 1.00 70.17 N ANISOU15684 N ASN B 383 8552 10605 7505 3150 -735 -1000 N ATOM 15685 CA ASN B 383 42.074 -23.253 -37.846 1.00 68.60 C ANISOU15685 CA ASN B 383 8277 10427 7359 3106 -584 -1034 C ATOM 15686 C ASN B 383 41.759 -23.779 -39.239 1.00 74.15 C ANISOU15686 C ASN B 383 9001 11082 8090 3176 -480 -1023 C ATOM 15687 O ASN B 383 41.088 -23.107 -40.024 1.00 76.22 O ANISOU15687 O ASN B 383 9261 11341 8356 3129 -350 -1037 O ATOM 15688 CB ASN B 383 43.271 -22.313 -37.939 1.00 68.55 C ANISOU15688 CB ASN B 383 8089 10489 7469 3111 -573 -1081 C ATOM 15689 CG ASN B 383 43.213 -21.177 -36.936 1.00 82.98 C ANISOU15689 CG ASN B 383 9882 12373 9275 2998 -596 -1108 C ATOM 15690 OD1 ASN B 383 42.179 -20.908 -36.328 1.00 86.73 O ANISOU15690 OD1 ASN B 383 10463 12838 9654 2904 -593 -1096 O ATOM 15691 ND2 ASN B 383 44.332 -20.486 -36.778 1.00101.23 N ANISOU15691 ND2 ASN B 383 12042 14743 11677 3005 -616 -1145 N ATOM 15692 H ASN B 383 43.111 -24.308 -36.538 1.00 84.20 H ATOM 15693 HA ASN B 383 41.312 -22.733 -37.546 1.00 82.32 H ATOM 15694 HB2 ASN B 383 44.082 -22.818 -37.772 1.00 82.27 H ATOM 15695 HB3 ASN B 383 43.300 -21.926 -38.828 1.00 82.27 H ATOM 15696 HD21 ASN B 383 44.358 -19.831 -36.222 1.00121.48 H ATOM 15697 HD22 ASN B 383 45.033 -20.693 -37.231 1.00121.48 H ATOM 15698 N ARG B 384 42.256 -24.974 -39.544 1.00 92.53 N ANISOU15698 N ARG B 384 11347 13373 10439 3290 -537 -997 N ATOM 15699 CA ARG B 384 41.980 -25.615 -40.826 1.00 97.11 C ANISOU15699 CA ARG B 384 11954 13903 11041 3364 -450 -982 C ATOM 15700 C ARG B 384 40.484 -25.841 -40.987 1.00 90.60 C ANISOU15700 C ARG B 384 11288 13027 10108 3307 -390 -953 C ATOM 15701 O ARG B 384 39.917 -25.594 -42.054 1.00 92.53 O ANISOU15701 O ARG B 384 11539 13253 10367 3302 -262 -958 O ATOM 15702 CB ARG B 384 42.719 -26.951 -40.939 1.00103.52 C ANISOU15702 CB ARG B 384 12774 14681 11878 3492 -540 -955 C ATOM 15703 CG ARG B 384 44.194 -26.832 -41.302 1.00108.99 C ANISOU15703 CG ARG B 384 13299 15413 12699 3574 -560 -985 C ATOM 15704 CD ARG B 384 44.791 -28.184 -41.699 1.00110.29 C ANISOU15704 CD ARG B 384 13479 15536 12892 3706 -621 -957 C ATOM 15705 NE ARG B 384 44.215 -28.693 -42.944 1.00119.61 N ANISOU15705 NE ARG B 384 14710 16664 14074 3755 -517 -942 N ATOM 15706 CZ ARG B 384 44.308 -29.955 -43.357 1.00123.11 C ANISOU15706 CZ ARG B 384 15212 17054 14511 3855 -552 -909 C ATOM 15707 NH1 ARG B 384 44.950 -30.856 -42.623 1.00120.87 N ANISOU15707 NH1 ARG B 384 14945 16761 14219 3919 -688 -887 N ATOM 15708 NH2 ARG B 384 43.747 -30.321 -44.504 1.00112.12 N ANISOU15708 NH2 ARG B 384 13862 15616 13120 3892 -449 -898 N ATOM 15709 H ARG B 384 42.760 -25.438 -39.023 1.00111.04 H ATOM 15710 HA ARG B 384 42.281 -25.038 -41.545 1.00116.53 H ATOM 15711 HB2 ARG B 384 42.662 -27.410 -40.087 1.00124.23 H ATOM 15712 HB3 ARG B 384 42.290 -27.485 -41.626 1.00124.23 H ATOM 15713 HG2 ARG B 384 44.291 -26.226 -42.053 1.00130.79 H ATOM 15714 HG3 ARG B 384 44.686 -26.497 -40.536 1.00130.79 H ATOM 15715 HD2 ARG B 384 45.748 -28.085 -41.827 1.00132.35 H ATOM 15716 HD3 ARG B 384 44.613 -28.829 -40.998 1.00132.35 H ATOM 15717 HE ARG B 384 43.788 -28.139 -43.444 1.00143.54 H ATOM 15718 HH11 ARG B 384 45.314 -30.625 -41.879 1.00145.04 H ATOM 15719 HH12 ARG B 384 45.006 -31.671 -42.894 1.00145.04 H ATOM 15720 HH21 ARG B 384 43.329 -29.741 -44.982 1.00134.54 H ATOM 15721 HH22 ARG B 384 43.806 -31.137 -44.771 1.00134.54 H ATOM 15722 N LEU B 385 39.850 -26.308 -39.917 1.00 71.68 N ANISOU15722 N LEU B 385 9020 10611 7604 3264 -483 -922 N ATOM 15723 CA LEU B 385 38.413 -26.514 -39.916 1.00 70.27 C ANISOU15723 CA LEU B 385 8998 10385 7315 3202 -438 -893 C ATOM 15724 C LEU B 385 37.661 -25.191 -39.709 1.00 70.65 C ANISOU15724 C LEU B 385 9042 10468 7333 3072 -355 -919 C ATOM 15725 O LEU B 385 36.552 -25.025 -40.214 1.00 76.77 O ANISOU15725 O LEU B 385 9901 11214 8055 3023 -259 -910 O ATOM 15726 CB LEU B 385 38.022 -27.543 -38.849 1.00 72.03 C ANISOU15726 CB LEU B 385 9362 10573 7434 3207 -570 -850 C ATOM 15727 CG LEU B 385 38.459 -28.991 -39.108 1.00 74.89 C ANISOU15727 CG LEU B 385 9766 10887 7803 3331 -642 -815 C ATOM 15728 CD1 LEU B 385 37.782 -29.926 -38.121 1.00 71.30 C ANISOU15728 CD1 LEU B 385 9471 10391 7228 3317 -751 -770 C ATOM 15729 CD2 LEU B 385 38.155 -29.426 -40.537 1.00 82.69 C ANISOU15729 CD2 LEU B 385 10766 11830 8822 3396 -529 -807 C ATOM 15730 H LEU B 385 40.234 -26.514 -39.176 1.00 86.01 H ATOM 15731 HA LEU B 385 38.150 -26.871 -40.779 1.00 84.32 H ATOM 15732 HB2 LEU B 385 38.415 -27.270 -38.005 1.00 86.44 H ATOM 15733 HB3 LEU B 385 37.055 -27.544 -38.768 1.00 86.44 H ATOM 15734 HG LEU B 385 39.417 -29.059 -38.973 1.00 89.87 H ATOM 15735 HD11 LEU B 385 38.070 -30.835 -38.299 1.00 85.56 H ATOM 15736 HD12 LEU B 385 38.034 -29.669 -37.220 1.00 85.56 H ATOM 15737 HD13 LEU B 385 36.820 -29.855 -38.229 1.00 85.56 H ATOM 15738 HD21 LEU B 385 38.447 -30.343 -40.656 1.00 99.23 H ATOM 15739 HD22 LEU B 385 37.200 -29.359 -40.691 1.00 99.23 H ATOM 15740 HD23 LEU B 385 38.631 -28.845 -41.151 1.00 99.23 H ATOM 15741 N LEU B 386 38.269 -24.248 -38.993 1.00 69.97 N ANISOU15741 N LEU B 386 8858 10444 7283 3017 -390 -952 N ATOM 15742 CA LEU B 386 37.622 -22.968 -38.715 1.00 70.73 C ANISOU15742 CA LEU B 386 8945 10576 7354 2892 -320 -978 C ATOM 15743 C LEU B 386 37.398 -22.148 -39.981 1.00 78.32 C ANISOU15743 C LEU B 386 9834 11545 8377 2877 -158 -1007 C ATOM 15744 O LEU B 386 36.395 -21.437 -40.089 1.00 78.78 O ANISOU15744 O LEU B 386 9943 11603 8387 2785 -71 -1012 O ATOM 15745 CB LEU B 386 38.447 -22.137 -37.729 1.00 74.21 C ANISOU15745 CB LEU B 386 9282 11084 7830 2844 -392 -1010 C ATOM 15746 CG LEU B 386 37.896 -20.738 -37.419 1.00 75.95 C ANISOU15746 CG LEU B 386 9477 11348 8033 2716 -321 -1041 C ATOM 15747 CD1 LEU B 386 36.702 -20.803 -36.467 1.00 70.27 C ANISOU15747 CD1 LEU B 386 8912 10606 7182 2622 -360 -1015 C ATOM 15748 CD2 LEU B 386 38.991 -19.832 -36.881 1.00 69.19 C ANISOU15748 CD2 LEU B 386 8472 10563 7255 2694 -361 -1082 C ATOM 15749 H LEU B 386 39.056 -24.325 -38.657 1.00 83.97 H ATOM 15750 HA LEU B 386 36.756 -23.135 -38.311 1.00 84.88 H ATOM 15751 HB2 LEU B 386 38.501 -22.621 -36.890 1.00 89.05 H ATOM 15752 HB3 LEU B 386 39.339 -22.024 -38.094 1.00 89.05 H ATOM 15753 HG LEU B 386 37.581 -20.346 -38.248 1.00 91.14 H ATOM 15754 HD11 LEU B 386 36.384 -19.902 -36.297 1.00 84.33 H ATOM 15755 HD12 LEU B 386 35.999 -21.330 -36.878 1.00 84.33 H ATOM 15756 HD13 LEU B 386 36.983 -21.217 -35.636 1.00 84.33 H ATOM 15757 HD21 LEU B 386 38.614 -18.958 -36.695 1.00 83.03 H ATOM 15758 HD22 LEU B 386 39.349 -20.218 -36.067 1.00 83.03 H ATOM 15759 HD23 LEU B 386 39.692 -19.755 -37.547 1.00 83.03 H ATOM 15760 N LYS B 387 38.331 -22.212 -40.927 1.00 87.49 N ANISOU15760 N LYS B 387 10877 12717 9648 2965 -116 -1025 N ATOM 15761 CA LYS B 387 38.186 -21.387 -42.119 1.00 88.27 C ANISOU15761 CA LYS B 387 10898 12828 9813 2950 36 -1055 C ATOM 15762 C LYS B 387 37.072 -21.887 -43.018 1.00 88.23 C ANISOU15762 C LYS B 387 11007 12762 9755 2958 130 -1027 C ATOM 15763 O LYS B 387 36.509 -21.106 -43.756 1.00 88.31 O ANISOU15763 O LYS B 387 10999 12777 9779 2907 256 -1045 O ATOM 15764 CB LYS B 387 39.484 -21.234 -42.912 1.00 89.23 C ANISOU15764 CB LYS B 387 10855 12979 10068 3036 62 -1085 C ATOM 15765 CG LYS B 387 39.850 -19.759 -43.124 1.00 99.36 C ANISOU15765 CG LYS B 387 12000 14326 11426 2970 144 -1136 C ATOM 15766 CD LYS B 387 40.518 -19.483 -44.465 1.00103.13 C ANISOU15766 CD LYS B 387 12350 14814 12020 3036 248 -1163 C ATOM 15767 CE LYS B 387 40.890 -18.003 -44.598 1.00 99.95 C ANISOU15767 CE LYS B 387 11812 14477 11689 2967 324 -1213 C ATOM 15768 NZ LYS B 387 42.257 -17.688 -44.067 1.00104.55 N ANISOU15768 NZ LYS B 387 12256 15115 12353 2997 243 -1242 N ATOM 15769 H LYS B 387 39.034 -22.706 -40.905 1.00104.99 H ATOM 15770 HA LYS B 387 37.931 -20.497 -41.830 1.00105.92 H ATOM 15771 HB2 LYS B 387 40.207 -21.659 -42.425 1.00107.08 H ATOM 15772 HB3 LYS B 387 39.377 -21.648 -43.783 1.00107.08 H ATOM 15773 HG2 LYS B 387 39.041 -19.226 -43.079 1.00119.23 H ATOM 15774 HG3 LYS B 387 40.463 -19.485 -42.424 1.00119.23 H ATOM 15775 HD2 LYS B 387 41.329 -20.010 -44.535 1.00123.75 H ATOM 15776 HD3 LYS B 387 39.905 -19.710 -45.182 1.00123.75 H ATOM 15777 HE2 LYS B 387 40.870 -17.757 -45.536 1.00119.94 H ATOM 15778 HE3 LYS B 387 40.247 -17.471 -44.103 1.00119.94 H ATOM 15779 HZ1 LYS B 387 42.428 -16.820 -44.165 1.00125.46 H ATOM 15780 HZ2 LYS B 387 42.302 -17.895 -43.203 1.00125.46 H ATOM 15781 HZ3 LYS B 387 42.870 -18.156 -44.510 1.00125.46 H ATOM 15782 N LEU B 388 36.750 -23.174 -42.943 1.00 90.71 N ANISOU15782 N LEU B 388 11438 13019 10008 3019 67 -984 N ATOM 15783 CA LEU B 388 35.589 -23.721 -43.645 1.00 93.46 C ANISOU15783 CA LEU B 388 11915 13307 10290 3020 143 -953 C ATOM 15784 C LEU B 388 34.307 -22.943 -43.310 1.00 96.69 C ANISOU15784 C LEU B 388 12411 13715 10611 2893 206 -953 C ATOM 15785 O LEU B 388 33.440 -22.746 -44.167 1.00101.40 O ANISOU15785 O LEU B 388 13053 14286 11189 2867 323 -949 O ATOM 15786 CB LEU B 388 35.401 -25.190 -43.267 1.00 91.11 C ANISOU15786 CB LEU B 388 11744 12953 9922 3089 40 -905 C ATOM 15787 CG LEU B 388 36.614 -26.115 -43.391 1.00 88.50 C ANISOU15787 CG LEU B 388 11348 12616 9661 3214 -46 -898 C ATOM 15788 CD1 LEU B 388 36.226 -27.563 -43.090 1.00 87.28 C ANISOU15788 CD1 LEU B 388 11336 12400 9427 3274 -134 -848 C ATOM 15789 CD2 LEU B 388 37.229 -25.996 -44.771 1.00 88.45 C ANISOU15789 CD2 LEU B 388 11229 12613 9766 3289 56 -920 C ATOM 15790 H LEU B 388 37.189 -23.758 -42.490 1.00108.85 H ATOM 15791 HA LEU B 388 35.738 -23.668 -44.602 1.00112.15 H ATOM 15792 HB2 LEU B 388 35.110 -25.227 -42.342 1.00109.34 H ATOM 15793 HB3 LEU B 388 34.705 -25.558 -43.834 1.00109.34 H ATOM 15794 HG LEU B 388 37.283 -25.845 -42.743 1.00106.20 H ATOM 15795 HD11 LEU B 388 37.012 -28.125 -43.176 1.00104.74 H ATOM 15796 HD12 LEU B 388 35.879 -27.615 -42.185 1.00104.74 H ATOM 15797 HD13 LEU B 388 35.546 -27.845 -43.722 1.00104.74 H ATOM 15798 HD21 LEU B 388 37.994 -26.589 -44.828 1.00106.15 H ATOM 15799 HD22 LEU B 388 36.566 -26.246 -45.434 1.00106.15 H ATOM 15800 HD23 LEU B 388 37.509 -25.078 -44.913 1.00106.15 H ATOM 15801 N PHE B 389 34.197 -22.515 -42.056 1.00 81.90 N ANISOU15801 N PHE B 389 10562 11873 8685 2814 125 -957 N ATOM 15802 CA PHE B 389 33.071 -21.707 -41.598 1.00 73.32 C ANISOU15802 CA PHE B 389 9548 10792 7516 2688 173 -960 C ATOM 15803 C PHE B 389 33.230 -20.246 -42.020 1.00 79.97 C ANISOU15803 C PHE B 389 10267 11689 8430 2620 281 -1007 C ATOM 15804 O PHE B 389 32.410 -19.725 -42.776 1.00 85.32 O ANISOU15804 O PHE B 389 10967 12354 9096 2574 406 -1013 O ATOM 15805 CB PHE B 389 32.955 -21.794 -40.074 1.00 71.52 C ANISOU15805 CB PHE B 389 9388 10579 7209 2630 43 -947 C ATOM 15806 CG PHE B 389 31.738 -21.104 -39.506 1.00 68.12 C ANISOU15806 CG PHE B 389 9051 10150 6683 2503 79 -945 C ATOM 15807 CD1 PHE B 389 31.783 -19.762 -39.148 1.00 65.76 C ANISOU15807 CD1 PHE B 389 8671 9906 6407 2408 119 -983 C ATOM 15808 CD2 PHE B 389 30.555 -21.805 -39.307 1.00 69.87 C ANISOU15808 CD2 PHE B 389 9441 10316 6790 2478 70 -904 C ATOM 15809 CE1 PHE B 389 30.668 -19.130 -38.613 1.00 65.52 C ANISOU15809 CE1 PHE B 389 8728 9878 6289 2291 151 -982 C ATOM 15810 CE2 PHE B 389 29.439 -21.178 -38.774 1.00 70.00 C ANISOU15810 CE2 PHE B 389 9544 10334 6720 2362 102 -903 C ATOM 15811 CZ PHE B 389 29.495 -19.838 -38.426 1.00 66.90 C ANISOU15811 CZ PHE B 389 9069 9997 6351 2268 143 -941 C ATOM 15812 H PHE B 389 34.772 -22.683 -41.439 1.00 98.29 H ATOM 15813 HA PHE B 389 32.251 -22.049 -41.987 1.00 87.98 H ATOM 15814 HB2 PHE B 389 32.910 -22.729 -39.819 1.00 85.83 H ATOM 15815 HB3 PHE B 389 33.739 -21.384 -39.678 1.00 85.83 H ATOM 15816 HD1 PHE B 389 32.569 -19.280 -39.271 1.00 78.91 H ATOM 15817 HD2 PHE B 389 30.510 -22.705 -39.537 1.00 83.84 H ATOM 15818 HE1 PHE B 389 30.710 -18.230 -38.382 1.00 78.62 H ATOM 15819 HE2 PHE B 389 28.651 -21.657 -38.650 1.00 84.00 H ATOM 15820 HZ PHE B 389 28.747 -19.417 -38.071 1.00 80.28 H ATOM 15821 N THR B 390 34.288 -19.596 -41.536 1.00 75.70 N ANISOU15821 N THR B 390 9595 11207 7960 2616 234 -1041 N ATOM 15822 CA THR B 390 34.509 -18.170 -41.786 1.00 77.84 C ANISOU15822 CA THR B 390 9745 11535 8297 2547 323 -1088 C ATOM 15823 C THR B 390 34.590 -17.844 -43.280 1.00 83.19 C ANISOU15823 C THR B 390 10344 12206 9056 2586 465 -1107 C ATOM 15824 O THR B 390 34.349 -16.705 -43.689 1.00 77.42 O ANISOU15824 O THR B 390 9552 11507 8359 2518 570 -1138 O ATOM 15825 CB THR B 390 35.783 -17.664 -41.078 1.00 87.86 C ANISOU15825 CB THR B 390 10878 12866 9638 2554 240 -1120 C ATOM 15826 OG1 THR B 390 36.921 -18.407 -41.529 1.00 95.33 O ANISOU15826 OG1 THR B 390 11745 13809 10668 2675 194 -1119 O ATOM 15827 CG2 THR B 390 35.648 -17.817 -39.569 1.00 81.01 C ANISOU15827 CG2 THR B 390 10083 12010 8689 2499 109 -1105 C ATOM 15828 H THR B 390 34.899 -19.961 -41.054 1.00 90.84 H ATOM 15829 HA THR B 390 33.758 -17.675 -41.422 1.00 93.41 H ATOM 15830 HB THR B 390 35.912 -16.724 -41.279 1.00105.43 H ATOM 15831 HG1 THR B 390 37.615 -18.132 -41.144 1.00114.40 H ATOM 15832 HG21 THR B 390 36.453 -17.498 -39.131 1.00 97.22 H ATOM 15833 HG22 THR B 390 34.890 -17.303 -39.251 1.00 97.22 H ATOM 15834 HG23 THR B 390 35.515 -18.750 -39.342 1.00 97.22 H ATOM 15835 N ARG B 391 34.928 -18.851 -44.082 1.00 91.48 N ANISOU15835 N ARG B 391 11400 13217 10140 2697 466 -1087 N ATOM 15836 CA ARG B 391 34.930 -18.736 -45.537 1.00 84.34 C ANISOU15836 CA ARG B 391 10441 12298 9305 2743 596 -1098 C ATOM 15837 C ARG B 391 33.583 -18.201 -46.013 1.00 84.69 C ANISOU15837 C ARG B 391 10569 12321 9288 2658 718 -1094 C ATOM 15838 O ARG B 391 33.516 -17.301 -46.850 1.00 79.38 O ANISOU15838 O ARG B 391 9818 11670 8674 2629 839 -1123 O ATOM 15839 CB ARG B 391 35.170 -20.112 -46.153 1.00 74.52 C ANISOU15839 CB ARG B 391 9243 11001 8069 2864 566 -1066 C ATOM 15840 CG ARG B 391 35.599 -20.129 -47.583 1.00 90.97 C ANISOU15840 CG ARG B 391 11239 13077 10248 2939 671 -1080 C ATOM 15841 CD ARG B 391 36.118 -21.524 -47.918 1.00 92.67 C ANISOU15841 CD ARG B 391 11482 13248 10479 3065 606 -1051 C ATOM 15842 NE ARG B 391 35.164 -22.562 -47.532 1.00 85.91 N ANISOU15842 NE ARG B 391 10800 12333 9509 3067 555 -1002 N ATOM 15843 CZ ARG B 391 35.352 -23.866 -47.707 1.00 86.18 C ANISOU15843 CZ ARG B 391 10895 12319 9530 3165 494 -969 C ATOM 15844 NH1 ARG B 391 36.467 -24.325 -48.267 1.00 76.05 N ANISOU15844 NH1 ARG B 391 9514 11042 8342 3272 475 -978 N ATOM 15845 NH2 ARG B 391 34.410 -24.715 -47.319 1.00 85.96 N ANISOU15845 NH2 ARG B 391 11028 12239 9393 3156 452 -926 N ATOM 15846 H ARG B 391 35.166 -19.628 -43.800 1.00109.77 H ATOM 15847 HA ARG B 391 35.632 -18.131 -45.823 1.00101.20 H ATOM 15848 HB2 ARG B 391 35.861 -20.558 -45.639 1.00 89.42 H ATOM 15849 HB3 ARG B 391 34.346 -20.620 -46.092 1.00 89.42 H ATOM 15850 HG2 ARG B 391 34.842 -19.931 -48.156 1.00109.16 H ATOM 15851 HG3 ARG B 391 36.314 -19.488 -47.721 1.00109.16 H ATOM 15852 HD2 ARG B 391 36.266 -21.589 -48.874 1.00111.20 H ATOM 15853 HD3 ARG B 391 36.947 -21.680 -47.439 1.00111.20 H ATOM 15854 HE ARG B 391 34.428 -22.310 -47.164 1.00103.09 H ATOM 15855 HH11 ARG B 391 37.079 -23.775 -48.520 1.00 91.26 H ATOM 15856 HH12 ARG B 391 36.578 -25.171 -48.375 1.00 91.26 H ATOM 15857 HH21 ARG B 391 33.688 -24.420 -46.956 1.00103.15 H ATOM 15858 HH22 ARG B 391 34.523 -25.561 -47.427 1.00103.15 H ATOM 15859 N CYS B 392 32.514 -18.748 -45.440 1.00 82.43 N ANISOU15859 N CYS B 392 10441 11993 8884 2617 681 -1057 N ATOM 15860 CA CYS B 392 31.160 -18.543 -45.945 1.00 80.99 C ANISOU15860 CA CYS B 392 10363 11776 8633 2553 787 -1043 C ATOM 15861 C CYS B 392 30.497 -17.271 -45.398 1.00 87.71 C ANISOU15861 C CYS B 392 11214 12664 9447 2420 834 -1066 C ATOM 15862 O CYS B 392 29.279 -17.111 -45.502 1.00 84.58 O ANISOU15862 O CYS B 392 10924 12240 8973 2352 899 -1051 O ATOM 15863 CB CYS B 392 30.293 -19.766 -45.610 1.00 79.76 C ANISOU15863 CB CYS B 392 10383 11556 8367 2573 727 -992 C ATOM 15864 SG CYS B 392 30.945 -21.360 -46.183 1.00 73.55 S ANISOU15864 SG CYS B 392 9617 10720 7609 2727 666 -959 S ATOM 15865 H CYS B 392 32.548 -19.251 -44.744 1.00 98.91 H ATOM 15866 HA CYS B 392 31.198 -18.463 -46.911 1.00 97.19 H ATOM 15867 HB2 CYS B 392 30.197 -19.820 -44.646 1.00 95.71 H ATOM 15868 HB3 CYS B 392 29.421 -19.645 -46.016 1.00 95.71 H ATOM 15869 HG CYS B 392 30.184 -22.231 -45.863 1.00 88.26 H ATOM 15870 N LEU B 393 31.300 -16.368 -44.834 1.00 98.44 N ANISOU15870 N LEU B 393 12455 14086 10864 2384 804 -1103 N ATOM 15871 CA LEU B 393 30.791 -15.144 -44.204 1.00 91.94 C ANISOU15871 CA LEU B 393 11623 13302 10009 2259 836 -1127 C ATOM 15872 C LEU B 393 31.054 -13.896 -45.050 1.00101.62 C ANISOU15872 C LEU B 393 12715 14571 11327 2225 964 -1172 C ATOM 15873 O LEU B 393 32.158 -13.350 -45.017 1.00109.87 O ANISOU15873 O LEU B 393 13617 15665 12463 2246 948 -1206 O ATOM 15874 CB LEU B 393 31.444 -14.958 -42.830 1.00 96.09 C ANISOU15874 CB LEU B 393 12116 13869 10523 2229 704 -1137 C ATOM 15875 CG LEU B 393 30.837 -15.712 -41.643 1.00 91.37 C ANISOU15875 CG LEU B 393 11666 13244 9808 2201 587 -1100 C ATOM 15876 CD1 LEU B 393 30.843 -17.206 -41.862 1.00 89.54 C ANISOU15876 CD1 LEU B 393 11522 12953 9545 2303 524 -1057 C ATOM 15877 CD2 LEU B 393 31.597 -15.380 -40.380 1.00 90.19 C ANISOU15877 CD2 LEU B 393 11460 13143 9664 2171 468 -1116 C ATOM 15878 H LEU B 393 32.156 -16.441 -44.803 1.00118.13 H ATOM 15879 HA LEU B 393 29.833 -15.227 -44.075 1.00110.33 H ATOM 15880 HB2 LEU B 393 32.371 -15.237 -42.899 1.00115.30 H ATOM 15881 HB3 LEU B 393 31.414 -14.013 -42.610 1.00115.30 H ATOM 15882 HG LEU B 393 29.917 -15.429 -41.524 1.00109.65 H ATOM 15883 HD11 LEU B 393 30.451 -17.640 -41.088 1.00107.45 H ATOM 15884 HD12 LEU B 393 30.323 -17.411 -42.655 1.00107.45 H ATOM 15885 HD13 LEU B 393 31.759 -17.504 -41.980 1.00107.45 H ATOM 15886 HD21 LEU B 393 31.203 -15.864 -39.638 1.00108.22 H ATOM 15887 HD22 LEU B 393 32.524 -15.642 -40.491 1.00108.22 H ATOM 15888 HD23 LEU B 393 31.541 -14.425 -40.220 1.00108.22 H ATOM 15889 N THR B 394 30.046 -13.451 -45.803 1.00129.68 N ANISOU15889 N THR B 394 16314 18103 14854 2174 1090 -1171 N ATOM 15890 CA THR B 394 30.173 -12.258 -46.648 1.00138.03 C ANISOU15890 CA THR B 394 17255 19197 15992 2138 1221 -1212 C ATOM 15891 C THR B 394 30.682 -11.067 -45.837 1.00138.87 C ANISOU15891 C THR B 394 17261 19371 16131 2059 1196 -1251 C ATOM 15892 O THR B 394 31.526 -10.298 -46.302 1.00132.94 O ANISOU15892 O THR B 394 16363 18665 15482 2071 1244 -1290 O ATOM 15893 CB THR B 394 28.824 -11.856 -47.302 1.00131.12 C ANISOU15893 CB THR B 394 16464 18292 15062 2068 1349 -1203 C ATOM 15894 OG1 THR B 394 28.265 -12.972 -48.005 1.00125.27 O ANISOU15894 OG1 THR B 394 15828 17488 14283 2135 1370 -1165 O ATOM 15895 CG2 THR B 394 29.013 -10.690 -48.276 1.00119.37 C ANISOU15895 CG2 THR B 394 14856 16812 13688 2008 1468 -1227 C ATOM 15896 H THR B 394 29.272 -13.824 -45.842 1.00155.61 H ATOM 15897 HA THR B 394 30.812 -12.437 -47.356 1.00165.63 H ATOM 15898 HB THR B 394 28.206 -11.574 -46.609 1.00157.34 H ATOM 15899 HG1 THR B 394 28.130 -13.608 -47.473 1.00150.33 H ATOM 15900 HG21 THR B 394 28.162 -10.451 -48.676 1.00143.25 H ATOM 15901 HG22 THR B 394 29.368 -9.919 -47.806 1.00143.25 H ATOM 15902 HG23 THR B 394 29.632 -10.942 -48.980 1.00143.25 H TER 15903 THR B 394 HETATM15904 O HOH A1101 59.042 35.599 -9.363 1.00 55.83 O HETATM15905 O HOH A1102 47.788 18.973 -0.179 1.00 21.73 O HETATM15906 O HOH A1103 14.611 -16.058 -21.746 1.00 51.64 O HETATM15907 O HOH A1104 41.892 -12.534 2.489 1.00 49.21 O HETATM15908 O HOH A1105 53.124 7.820 4.609 1.00 57.74 O HETATM15909 O HOH A1106 31.675 8.470 -2.426 1.00 39.28 O HETATM15910 O HOH A1107 61.751 -13.137 -11.287 1.00 54.02 O HETATM15911 O HOH A1108 48.529 2.040 -3.997 1.00 54.91 O HETATM15912 O HOH A1109 52.190 -4.303 -16.477 1.00 62.93 O HETATM15913 O HOH A1110 47.228 -12.825 -20.360 1.00 56.02 O HETATM15914 O HOH A1111 35.550 -1.415 0.204 1.00 51.64 O HETATM15915 O HOH A1112 56.818 40.330 3.568 1.00 32.92 O HETATM15916 O HOH A1113 72.900 36.507 25.795 1.00 63.13 O HETATM15917 O HOH A1114 56.337 24.681 1.958 1.00 39.50 O HETATM15918 O HOH A1115 45.390 -26.064 2.357 1.00 58.87 O HETATM15919 O HOH A1116 42.516 8.484 -10.132 1.00 43.68 O HETATM15920 O HOH A1117 30.762 10.605 6.750 1.00 55.87 O HETATM15921 O HOH A1118 -0.197 -6.913 -46.429 1.00 70.08 O HETATM15922 O HOH A1119 40.247 -11.831 0.625 1.00 57.90 O HETATM15923 O HOH B 501 19.227 18.736 6.832 1.00 52.71 O HETATM15924 O HOH B 502 36.978 -21.551 -12.904 1.00 36.48 O HETATM15925 O HOH B 503 29.126 17.657 2.245 1.00 40.36 O CONECT 1 2 CONECT 2 1 3 5 9 CONECT 3 2 4 17 CONECT 4 3 CONECT 5 2 6 10 11 CONECT 6 5 7 12 13 CONECT 7 6 8 CONECT 8 7 14 15 16 CONECT 9 2 CONECT 10 5 CONECT 11 5 CONECT 12 6 CONECT 13 6 CONECT 14 8 CONECT 15 8 CONECT 16 8 CONECT 17 3 CONECT 105 125 CONECT 125 105 126 133 CONECT 126 125 127 129 134 CONECT 127 126 128 142 CONECT 128 127 CONECT 129 126 130 135 136 CONECT 130 129 131 137 138 CONECT 131 130 132 CONECT 132 131 139 140 141 CONECT 133 125 CONECT 134 126 CONECT 135 129 CONECT 136 129 CONECT 137 130 CONECT 138 130 CONECT 139 132 CONECT 140 132 CONECT 141 132 CONECT 142 127 CONECT 184 192 CONECT 192 184 193 200 CONECT 193 192 194 196 201 CONECT 194 193 195 209 CONECT 195 194 CONECT 196 193 197 202 203 CONECT 197 196 198 204 205 CONECT 198 197 199 CONECT 199 198 206 207 208 CONECT 200 192 CONECT 201 193 CONECT 202 196 CONECT 203 196 CONECT 204 197 CONECT 205 197 CONECT 206 199 CONECT 207 199 CONECT 208 199 CONECT 209 194 CONECT 805 818 CONECT 818 805 819 826 CONECT 819 818 820 822 827 CONECT 820 819 821 835 CONECT 821 820 CONECT 822 819 823 828 829 CONECT 823 822 824 830 831 CONECT 824 823 825 CONECT 825 824 832 833 834 CONECT 826 818 CONECT 827 819 CONECT 828 822 CONECT 829 822 CONECT 830 823 CONECT 831 823 CONECT 832 825 CONECT 833 825 CONECT 834 825 CONECT 835 820 CONECT 881 897 CONECT 897 881 898 905 CONECT 898 897 899 901 906 CONECT 899 898 900 914 CONECT 900 899 CONECT 901 898 902 907 908 CONECT 902 901 903 909 910 CONECT 903 902 904 CONECT 904 903 911 912 913 CONECT 905 897 CONECT 906 898 CONECT 907 901 CONECT 908 901 CONECT 909 902 CONECT 910 902 CONECT 911 904 CONECT 912 904 CONECT 913 904 CONECT 914 899 CONECT 1035 1055 CONECT 1055 1035 1056 1063 CONECT 1056 1055 1057 1059 1064 CONECT 1057 1056 1058 1072 CONECT 1058 1057 CONECT 1059 1056 1060 1065 1066 CONECT 1060 1059 1061 1067 1068 CONECT 1061 1060 1062 CONECT 1062 1061 1069 1070 1071 CONECT 1063 1055 CONECT 1064 1056 CONECT 1065 1059 CONECT 1066 1059 CONECT 1067 1060 CONECT 1068 1060 CONECT 1069 1062 CONECT 1070 1062 CONECT 1071 1062 CONECT 1072 1057 CONECT 1261 1273 CONECT 1273 1261 1274 1281 CONECT 1274 1273 1275 1277 1282 CONECT 1275 1274 1276 1290 CONECT 1276 1275 CONECT 1277 1274 1278 1283 1284 CONECT 1278 1277 1279 1285 1286 CONECT 1279 1278 1280 CONECT 1280 1279 1287 1288 1289 CONECT 1281 1273 CONECT 1282 1274 CONECT 1283 1277 CONECT 1284 1277 CONECT 1285 1278 CONECT 1286 1278 CONECT 1287 1280 CONECT 1288 1280 CONECT 1289 1280 CONECT 1290 1275 CONECT 1802 1821 CONECT 1821 1802 1822 1829 CONECT 1822 1821 1823 1825 1830 CONECT 1823 1822 1824 1838 CONECT 1824 1823 CONECT 1825 1822 1826 1831 1832 CONECT 1826 1825 1827 1833 1834 CONECT 1827 1826 1828 CONECT 1828 1827 1835 1836 1837 CONECT 1829 1821 CONECT 1830 1822 CONECT 1831 1825 CONECT 1832 1825 CONECT 1833 1826 CONECT 1834 1826 CONECT 1835 1828 CONECT 1836 1828 CONECT 1837 1828 CONECT 1838 1823 1839 1846 CONECT 1839 1838 1840 1842 1847 CONECT 1840 1839 1841 1855 CONECT 1841 1840 CONECT 1842 1839 1843 1848 1849 CONECT 1843 1842 1844 1850 1851 CONECT 1844 1843 1845 CONECT 1845 1844 1852 1853 1854 CONECT 1846 1838 CONECT 1847 1839 CONECT 1848 1842 CONECT 1849 1842 CONECT 1850 1843 CONECT 1851 1843 CONECT 1852 1845 CONECT 1853 1845 CONECT 1854 1845 CONECT 1855 1840 CONECT 2238 2246 CONECT 2246 2238 2247 2254 CONECT 2247 2246 2248 2250 2255 CONECT 2248 2247 2249 2263 CONECT 2249 2248 CONECT 2250 2247 2251 2256 2257 CONECT 2251 2250 2252 2258 2259 CONECT 2252 2251 2253 CONECT 2253 2252 2260 2261 2262 CONECT 2254 2246 CONECT 2255 2247 CONECT 2256 2250 CONECT 2257 2250 CONECT 2258 2251 CONECT 2259 2251 CONECT 2260 2253 CONECT 2261 2253 CONECT 2262 2253 CONECT 2263 2248 CONECT 2287 2304 CONECT 2304 2287 2305 2312 CONECT 2305 2304 2306 2308 2313 CONECT 2306 2305 2307 2321 CONECT 2307 2306 CONECT 2308 2305 2309 2314 2315 CONECT 2309 2308 2310 2316 2317 CONECT 2310 2309 2311 CONECT 2311 2310 2318 2319 2320 CONECT 2312 2304 CONECT 2313 2305 CONECT 2314 2308 CONECT 2315 2308 CONECT 2316 2309 CONECT 2317 2309 CONECT 2318 2311 CONECT 2319 2311 CONECT 2320 2311 CONECT 2321 2306 CONECT 2504 2516 CONECT 2516 2504 2517 2524 CONECT 2517 2516 2518 2520 2525 CONECT 2518 2517 2519 2533 CONECT 2519 2518 CONECT 2520 2517 2521 2526 2527 CONECT 2521 2520 2522 2528 2529 CONECT 2522 2521 2523 CONECT 2523 2522 2530 2531 2532 CONECT 2524 2516 CONECT 2525 2517 CONECT 2526 2520 CONECT 2527 2520 CONECT 2528 2521 CONECT 2529 2521 CONECT 2530 2523 CONECT 2531 2523 CONECT 2532 2523 CONECT 2533 2518 CONECT 3118 3130 CONECT 3130 3118 3131 3138 CONECT 3131 3130 3132 3134 3139 CONECT 3132 3131 3133 3147 CONECT 3133 3132 CONECT 3134 3131 3135 3140 3141 CONECT 3135 3134 3136 3142 3143 CONECT 3136 3135 3137 CONECT 3137 3136 3144 3145 3146 CONECT 3138 3130 CONECT 3139 3131 CONECT 3140 3134 CONECT 3141 3134 CONECT 3142 3135 CONECT 3143 3135 CONECT 3144 3137 CONECT 3145 3137 CONECT 3146 3137 CONECT 3147 3132 3148 3155 CONECT 3148 3147 3149 3151 3156 CONECT 3149 3148 3150 3164 CONECT 3150 3149 CONECT 3151 3148 3152 3157 3158 CONECT 3152 3151 3153 3159 3160 CONECT 3153 3152 3154 CONECT 3154 3153 3161 3162 3163 CONECT 3155 3147 CONECT 3156 3148 CONECT 3157 3151 CONECT 3158 3151 CONECT 3159 3152 CONECT 3160 3152 CONECT 3161 3154 CONECT 3162 3154 CONECT 3163 3154 CONECT 3164 3149 CONECT 3640 3662 CONECT 3662 3640 3663 3670 CONECT 3663 3662 3664 3666 3671 CONECT 3664 3663 3665 3679 CONECT 3665 3664 CONECT 3666 3663 3667 3672 3673 CONECT 3667 3666 3668 3674 3675 CONECT 3668 3667 3669 CONECT 3669 3668 3676 3677 3678 CONECT 3670 3662 CONECT 3671 3663 CONECT 3672 3666 CONECT 3673 3666 CONECT 3674 3667 CONECT 3675 3667 CONECT 3676 3669 CONECT 3677 3669 CONECT 3678 3669 CONECT 3679 3664 CONECT 3681 3701 CONECT 3701 3681 3702 3709 CONECT 3702 3701 3703 3705 3710 CONECT 3703 3702 3704 3718 CONECT 3704 3703 CONECT 3705 3702 3706 3711 3712 CONECT 3706 3705 3707 3713 3714 CONECT 3707 3706 3708 CONECT 3708 3707 3715 3716 3717 CONECT 3709 3701 CONECT 3710 3702 CONECT 3711 3705 CONECT 3712 3705 CONECT 3713 3706 CONECT 3714 3706 CONECT 3715 3708 CONECT 3716 3708 CONECT 3717 3708 CONECT 3718 3703 CONECT 3980 3992 CONECT 3992 3980 3993 4000 CONECT 3993 3992 3994 3996 4001 CONECT 3994 3993 3995 4009 CONECT 3995 3994 CONECT 3996 3993 3997 4002 4003 CONECT 3997 3996 3998 4004 4005 CONECT 3998 3997 3999 CONECT 3999 3998 4006 4007 4008 CONECT 4000 3992 CONECT 4001 3993 CONECT 4002 3996 CONECT 4003 3996 CONECT 4004 3997 CONECT 4005 3997 CONECT 4006 3999 CONECT 4007 3999 CONECT 4008 3999 CONECT 4009 3994 CONECT 4693 4702 CONECT 4702 4693 4703 4710 CONECT 4703 4702 4704 4706 4711 CONECT 4704 4703 4705 4719 CONECT 4705 4704 CONECT 4706 4703 4707 4712 4713 CONECT 4707 4706 4708 4714 4715 CONECT 4708 4707 4709 CONECT 4709 4708 4716 4717 4718 CONECT 4710 4702 CONECT 4711 4703 CONECT 4712 4706 CONECT 4713 4706 CONECT 4714 4707 CONECT 4715 4707 CONECT 4716 4709 CONECT 4717 4709 CONECT 4718 4709 CONECT 4719 4704 CONECT 6109 6118 CONECT 6118 6109 6119 6126 CONECT 6119 6118 6120 6122 6127 CONECT 6120 6119 6121 6135 CONECT 6121 6120 CONECT 6122 6119 6123 6128 6129 CONECT 6123 6122 6124 6130 6131 CONECT 6124 6123 6125 CONECT 6125 6124 6132 6133 6134 CONECT 6126 6118 CONECT 6127 6119 CONECT 6128 6122 CONECT 6129 6122 CONECT 6130 6123 CONECT 6131 6123 CONECT 6132 6125 CONECT 6133 6125 CONECT 6134 6125 CONECT 6135 6120 CONECT 6334 6343 CONECT 6343 6334 6344 6351 CONECT 6344 6343 6345 6347 6352 CONECT 6345 6344 6346 6360 CONECT 6346 6345 CONECT 6347 6344 6348 6353 6354 CONECT 6348 6347 6349 6355 6356 CONECT 6349 6348 6350 CONECT 6350 6349 6357 6358 6359 CONECT 6351 6343 CONECT 6352 6344 CONECT 6353 6347 CONECT 6354 6347 CONECT 6355 6348 CONECT 6356 6348 CONECT 6357 6350 CONECT 6358 6350 CONECT 6359 6350 CONECT 6360 6345 CONECT 6648 6665 CONECT 6665 6648 6666 6673 CONECT 6666 6665 6667 6669 6674 CONECT 6667 6666 6668 6682 CONECT 6668 6667 CONECT 6669 6666 6670 6675 6676 CONECT 6670 6669 6671 6677 6678 CONECT 6671 6670 6672 CONECT 6672 6671 6679 6680 6681 CONECT 6673 6665 CONECT 6674 6666 CONECT 6675 6669 CONECT 6676 6669 CONECT 6677 6670 CONECT 6678 6670 CONECT 6679 6672 CONECT 6680 6672 CONECT 6681 6672 CONECT 6682 6667 CONECT 9835 9845 CONECT 9845 9835 9846 9853 CONECT 9846 9845 9847 9849 9854 CONECT 9847 9846 9848 9862 CONECT 9848 9847 CONECT 9849 9846 9850 9855 9856 CONECT 9850 9849 9851 9857 9858 CONECT 9851 9850 9852 CONECT 9852 9851 9859 9860 9861 CONECT 9853 9845 CONECT 9854 9846 CONECT 9855 9849 CONECT 9856 9849 CONECT 9857 9850 CONECT 9858 9850 CONECT 9859 9852 CONECT 9860 9852 CONECT 9861 9852 CONECT 9862 9847 CONECT1045510470 CONECT10470104551047110478 CONECT1047110470104721047410479 CONECT10472104711047310487 CONECT1047310472 CONECT1047410471104751048010481 CONECT1047510474104761048210483 CONECT104761047510477 CONECT1047710476104841048510486 CONECT1047810470 CONECT1047910471 CONECT1048010474 CONECT1048110474 CONECT1048210475 CONECT1048310475 CONECT1048410477 CONECT1048510477 CONECT1048610477 CONECT1048710472 CONECT1096210979 CONECT10979109621098010987 CONECT1098010979109811098310988 CONECT10981109801098210996 CONECT1098210981 CONECT1098310980109841098910990 CONECT1098410983109851099110992 CONECT109851098410986 CONECT1098610985109931099410995 CONECT1098710979 CONECT1098810980 CONECT1098910983 CONECT1099010983 CONECT1099110984 CONECT1099210984 CONECT1099310986 CONECT1099410986 CONECT1099510986 CONECT1099610981 CONECT1108311100 CONECT11100110831110111108 CONECT1110111100111021110411109 CONECT11102111011110311117 CONECT1110311102 CONECT1110411101111051111011111 CONECT1110511104111061111211113 CONECT111061110511107 CONECT1110711106111141111511116 CONECT1110811100 CONECT1110911101 CONECT1111011104 CONECT1111111104 CONECT1111211105 CONECT1111311105 CONECT1111411107 CONECT1111511107 CONECT1111611107 CONECT1111711102 CONECT1113011139 CONECT11139111301114011147 CONECT1114011139111411114311148 CONECT11141111401114211156 CONECT1114211141 CONECT1114311140111441114911150 CONECT1114411143111451115111152 CONECT111451114411146 CONECT1114611145111531115411155 CONECT1114711139 CONECT1114811140 CONECT1114911143 CONECT1115011143 CONECT1115111144 CONECT1115211144 CONECT1115311146 CONECT1115411146 CONECT1115511146 CONECT1115611141 CONECT1203212045 CONECT12045120321204612053 CONECT1204612045120471204912054 CONECT12047120461204812062 CONECT1204812047 CONECT1204912046120501205512056 CONECT1205012049120511205712058 CONECT120511205012052 CONECT1205212051120591206012061 CONECT1205312045 CONECT1205412046 CONECT1205512049 CONECT1205612049 CONECT1205712050 CONECT1205812050 CONECT1205912052 CONECT1206012052 CONECT1206112052 CONECT1206212047 CONECT1220212221 CONECT12221122021222212229 CONECT1222212221122231222512230 CONECT12223122221222412238 CONECT1222412223 CONECT1222512222122261223112232 CONECT1222612225122271223312234 CONECT122271222612228 CONECT1222812227122351223612237 CONECT1222912221 CONECT1223012222 CONECT1223112225 CONECT1223212225 CONECT1223312226 CONECT1223412226 CONECT1223512228 CONECT1223612228 CONECT1223712228 CONECT1223812223 CONECT1244512457 CONECT12457124451245812465 CONECT1245812457124591246112466 CONECT12459124581246012474 CONECT1246012459 CONECT1246112458124621246712468 CONECT1246212461124631246912470 CONECT124631246212464 CONECT1246412463124711247212473 CONECT1246512457 CONECT1246612458 CONECT1246712461 CONECT1246812461 CONECT1246912462 CONECT1247012462 CONECT1247112464 CONECT1247212464 CONECT1247312464 CONECT1247412459 CONECT1288412897 CONECT12897128841289812905 CONECT1289812897128991290112906 CONECT12899128981290012914 CONECT1290012899 CONECT1290112898129021290712908 CONECT1290212901129031290912910 CONECT129031290212904 CONECT1290412903129111291212913 CONECT1290512897 CONECT1290612898 CONECT1290712901 CONECT1290812901 CONECT1290912902 CONECT1291012902 CONECT1291112904 CONECT1291212904 CONECT1291312904 CONECT1291412899 CONECT1338913397 CONECT13397133891339813405 CONECT1339813397133991340113406 CONECT13399133981340013414 CONECT1340013399 CONECT1340113398134021340713408 CONECT1340213401134031340913410 CONECT134031340213404 CONECT1340413403134111341213413 CONECT1340513397 CONECT1340613398 CONECT1340713401 CONECT1340813401 CONECT1340913402 CONECT1341013402 CONECT1341113404 CONECT1341213404 CONECT1341313404 CONECT1341413399 CONECT1423114249 CONECT14249142311425014257 CONECT1425014249142511425314258 CONECT14251142501425214266 CONECT1425214251 CONECT1425314250142541425914260 CONECT1425414253142551426114262 CONECT142551425414256 CONECT1425614255142631426414265 CONECT1425714249 CONECT1425814250 CONECT1425914253 CONECT1426014253 CONECT1426114254 CONECT1426214254 CONECT1426314256 CONECT1426414256 CONECT1426514256 CONECT1426614251 CONECT1430214317 CONECT14317143021431814325 CONECT1431814317143191432114326 CONECT14319143181432014334 CONECT1432014319 CONECT1432114318143221432714328 CONECT1432214321143231432914330 CONECT143231432214324 CONECT1432414323143311433214333 CONECT1432514317 CONECT1432614318 CONECT1432714321 CONECT1432814321 CONECT1432914322 CONECT1433014322 CONECT1433114324 CONECT1433214324 CONECT1433314324 CONECT1433414319 CONECT1451414531 CONECT14531145141453214539 CONECT1453214531145331453514540 CONECT14533145321453414548 CONECT1453414533 CONECT1453514532145361454114542 CONECT1453614535145371454314544 CONECT145371453614538 CONECT1453814537145451454614547 CONECT1453914531 CONECT1454014532 CONECT1454114535 CONECT1454214535 CONECT1454314536 CONECT1454414536 CONECT1454514538 CONECT1454614538 CONECT1454714538 CONECT1454814533 CONECT1531015327 CONECT15327153101532815335 CONECT1532815327153291533115336 CONECT15329153281533015344 CONECT1533015329 CONECT1533115328153321533715338 CONECT1533215331153331533915340 CONECT153331533215334 CONECT1533415333153411534215343 CONECT1533515327 CONECT1533615328 CONECT1533715331 CONECT1533815331 CONECT1533915332 CONECT1534015332 CONECT1534115334 CONECT1534215334 CONECT1534315334 CONECT15344153291534515352 CONECT1534515344153461534815353 CONECT15346153451534715361 CONECT1534715346 CONECT1534815345153491535415355 CONECT1534915348153501535615357 CONECT153501534915351 CONECT1535115350153581535915360 CONECT1535215344 CONECT1535315345 CONECT1535415348 CONECT1535515348 CONECT1535615349 CONECT1535715349 CONECT1535815351 CONECT1535915351 CONECT1536015351 CONECT1536115346 MASTER 504 0 36 57 0 0 0 6 7931 2 676 87 END