>>4PJU:HELIX   28 AD1 THR A  549  SER A  579  1                                  31    
TAKEKKTQLDDRTKITELFAVALPQLLAKYS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 28 AD1 THR A 549 SER A 579 1 31 ATOM 7004 N THR A 549 56.029 -2.365 -27.029 1.00 86.90 N ANISOU 7004 N THR A 549 10348 13174 9498 1635 -295 -161 N ATOM 7005 CA THR A 549 57.277 -1.600 -27.204 1.00 92.21 C ANISOU 7005 CA THR A 549 10923 13939 10175 1631 -244 -76 C ATOM 7006 C THR A 549 58.508 -2.493 -27.363 1.00109.07 C ANISOU 7006 C THR A 549 13017 16129 12297 1710 -204 -161 C ATOM 7007 O THR A 549 58.442 -3.693 -27.139 1.00108.73 O ANISOU 7007 O THR A 549 13019 16033 12261 1763 -226 -285 O ATOM 7008 CB THR A 549 57.560 -0.618 -26.028 1.00 97.42 C ANISOU 7008 CB THR A 549 11562 14494 10959 1577 -268 23 C ATOM 7009 OG1 THR A 549 58.624 0.269 -26.396 1.00109.79 O ANISOU 7009 OG1 THR A 549 13026 16162 12528 1568 -223 123 O ATOM 7010 CG2 THR A 549 57.987 -1.351 -24.764 1.00 84.25 C ANISOU 7010 CG2 THR A 549 9934 12689 9386 1607 -302 -46 C ATOM 7011 H THR A 549 55.763 -2.422 -26.213 1.00104.28 H ATOM 7012 HA THR A 549 57.198 -1.069 -28.012 1.00110.66 H ATOM 7013 HB THR A 549 56.761 -0.104 -25.833 1.00116.90 H ATOM 7014 HG1 THR A 549 58.784 0.803 -25.767 1.00131.75 H ATOM 7015 HG21 THR A 549 58.155 -0.713 -24.053 1.00101.10 H ATOM 7016 HG22 THR A 549 57.287 -1.960 -24.483 1.00101.10 H ATOM 7017 HG23 THR A 549 58.797 -1.857 -24.932 1.00101.10 H ATOM 7018 N ALA A 550 59.634 -1.885 -27.732 1.00109.85 N ANISOU 7018 N ALA A 550 13021 16327 12388 1714 -148 -92 N ATOM 7019 CA ALA A 550 60.888 -2.611 -27.909 1.00101.64 C ANISOU 7019 CA ALA A 550 11925 15340 11352 1783 -102 -165 C ATOM 7020 C ALA A 550 61.229 -3.459 -26.693 1.00102.36 C ANISOU 7020 C ALA A 550 12054 15278 11560 1815 -153 -247 C ATOM 7021 O ALA A 550 61.323 -4.681 -26.783 1.00102.91 O ANISOU 7021 O ALA A 550 12148 15335 11620 1875 -162 -378 O ATOM 7022 CB ALA A 550 62.013 -1.638 -28.175 1.00107.44 C ANISOU 7022 CB ALA A 550 12552 16164 12105 1769 -44 -54 C ATOM 7023 H ALA A 550 59.697 -1.042 -27.887 1.00131.81 H ATOM 7024 HA ALA A 550 60.810 -3.199 -28.676 1.00121.96 H ATOM 7025 HB1 ALA A 550 62.838 -2.134 -28.290 1.00128.92 H ATOM 7026 HB2 ALA A 550 61.812 -1.136 -28.981 1.00128.92 H ATOM 7027 HB3 ALA A 550 62.092 -1.033 -27.420 1.00128.92 H ATOM 7028 N LYS A 551 61.405 -2.797 -25.553 1.00116.45 N ANISOU 7028 N LYS A 551 13843 16945 13456 1773 -193 -170 N ATOM 7029 CA LYS A 551 61.890 -3.457 -24.345 1.00115.13 C ANISOU 7029 CA LYS A 551 13707 16634 13402 1794 -244 -226 C ATOM 7030 C LYS A 551 60.923 -4.522 -23.832 1.00110.24 C ANISOU 7030 C LYS A 551 13192 15907 12788 1806 -304 -331 C ATOM 7031 O LYS A 551 61.348 -5.527 -23.261 1.00108.28 O ANISOU 7031 O LYS A 551 12965 15580 12598 1846 -338 -420 O ATOM 7032 CB LYS A 551 62.159 -2.429 -23.238 1.00112.87 C ANISOU 7032 CB LYS A 551 13415 16247 13223 1740 -279 -117 C ATOM 7033 CG LYS A 551 62.993 -1.228 -23.679 1.00119.77 C ANISOU 7033 CG LYS A 551 14183 17214 14110 1721 -230 6 C ATOM 7034 CD LYS A 551 64.363 -1.646 -24.213 1.00122.05 C ANISOU 7034 CD LYS A 551 14381 17584 14407 1782 -175 -28 C ATOM 7035 CE LYS A 551 65.243 -0.439 -24.513 1.00120.39 C ANISOU 7035 CE LYS A 551 14062 17448 14232 1762 -130 103 C ATOM 7036 NZ LYS A 551 65.481 0.404 -23.305 1.00119.79 N ANISOU 7036 NZ LYS A 551 13986 17242 14285 1721 -191 192 N ATOM 7037 H LYS A 551 61.248 -1.957 -25.453 1.00139.73 H ATOM 7038 HA LYS A 551 62.730 -3.897 -24.548 1.00138.15 H ATOM 7039 HB2 LYS A 551 61.309 -2.093 -22.913 1.00135.44 H ATOM 7040 HB3 LYS A 551 62.635 -2.868 -22.516 1.00135.44 H ATOM 7041 HG2 LYS A 551 62.524 -0.757 -24.386 1.00143.73 H ATOM 7042 HG3 LYS A 551 63.131 -0.640 -22.920 1.00143.73 H ATOM 7043 HD2 LYS A 551 64.812 -2.191 -23.549 1.00146.46 H ATOM 7044 HD3 LYS A 551 64.246 -2.147 -25.035 1.00146.46 H ATOM 7045 HE2 LYS A 551 66.103 -0.747 -24.839 1.00144.47 H ATOM 7046 HE3 LYS A 551 64.810 0.111 -25.184 1.00144.47 H ATOM 7047 HZ1 LYS A 551 65.997 1.097 -23.516 1.00143.74 H ATOM 7048 HZ2 LYS A 551 64.706 0.706 -22.988 1.00143.74 H ATOM 7049 HZ3 LYS A 551 65.884 -0.076 -22.674 1.00143.74 H ATOM 7050 N GLU A 552 59.628 -4.306 -24.037 1.00101.69 N ANISOU 7050 N GLU A 552 12169 14814 11652 1769 -321 -317 N ATOM 7051 CA GLU A 552 58.626 -5.240 -23.547 1.00101.63 C ANISOU 7051 CA GLU A 552 12258 14699 11657 1776 -376 -403 C ATOM 7052 C GLU A 552 58.669 -6.578 -24.299 1.00 95.67 C ANISOU 7052 C GLU A 552 11506 13997 10849 1852 -372 -540 C ATOM 7053 O GLU A 552 58.444 -7.627 -23.694 1.00 93.38 O ANISOU 7053 O GLU A 552 11268 13605 10609 1879 -424 -628 O ATOM 7054 CB GLU A 552 57.231 -4.621 -23.624 1.00111.41 C ANISOU 7054 CB GLU A 552 13552 15911 12868 1716 -392 -352 C ATOM 7055 CG GLU A 552 56.891 -3.645 -22.509 1.00114.36 C ANISOU 7055 CG GLU A 552 13954 16174 13325 1643 -420 -258 C ATOM 7056 CD GLU A 552 55.607 -2.879 -22.795 1.00108.98 C ANISOU 7056 CD GLU A 552 13301 15485 12619 1582 -426 -201 C ATOM 7057 OE1 GLU A 552 55.041 -3.056 -23.896 1.00100.66 O ANISOU 7057 OE1 GLU A 552 12246 14518 11482 1595 -411 -224 O ATOM 7058 OE2 GLU A 552 55.163 -2.105 -21.922 1.00109.30 O ANISOU 7058 OE2 GLU A 552 13367 15432 12729 1520 -448 -137 O ATOM 7059 H GLU A 552 59.306 -3.627 -24.456 1.00122.02 H ATOM 7060 HA GLU A 552 58.811 -5.426 -22.614 1.00121.95 H ATOM 7061 HB2 GLU A 552 57.152 -4.143 -24.464 1.00133.69 H ATOM 7062 HB3 GLU A 552 56.576 -5.336 -23.595 1.00133.69 H ATOM 7063 HG2 GLU A 552 56.773 -4.136 -21.681 1.00137.24 H ATOM 7064 HG3 GLU A 552 57.612 -3.002 -22.417 1.00137.24 H ATOM 7065 N LYS A 553 58.948 -6.556 -25.605 1.00 86.94 N ANISOU 7065 N LYS A 553 10342 13048 9642 1884 -314 -557 N ATOM 7066 CA LYS A 553 59.080 -7.817 -26.354 1.00 93.74 C ANISOU 7066 CA LYS A 553 11196 13968 10452 1961 -308 -697 C ATOM 7067 C LYS A 553 60.479 -8.426 -26.232 1.00 92.72 C ANISOU 7067 C LYS A 553 10997 13855 10378 2017 -287 -761 C ATOM 7068 O LYS A 553 60.683 -9.598 -26.568 1.00 93.18 O ANISOU 7068 O LYS A 553 11047 13926 10433 2082 -296 -891 O ATOM 7069 CB LYS A 553 58.672 -7.695 -27.835 1.00 89.76 C ANISOU 7069 CB LYS A 553 10675 13626 9805 1977 -260 -712 C ATOM 7070 CG LYS A 553 59.015 -6.396 -28.527 1.00 89.53 C ANISOU 7070 CG LYS A 553 10585 13726 9706 1933 -194 -585 C ATOM 7071 CD LYS A 553 58.324 -6.296 -29.883 1.00 92.88 C ANISOU 7071 CD LYS A 553 11021 14286 9984 1935 -168 -593 C ATOM 7072 CE LYS A 553 58.704 -5.020 -30.642 1.00 98.22 C ANISOU 7072 CE LYS A 553 11631 15102 10585 1887 -103 -459 C ATOM 7073 NZ LYS A 553 58.371 -5.112 -32.100 1.00 90.06 N ANISOU 7073 NZ LYS A 553 10597 14231 9390 1903 -66 -486 N ATOM 7074 H LYS A 553 59.063 -5.845 -26.073 1.00104.32 H ATOM 7075 HA LYS A 553 58.468 -8.455 -25.954 1.00112.48 H ATOM 7076 HB2 LYS A 553 59.108 -8.407 -28.329 1.00107.71 H ATOM 7077 HB3 LYS A 553 57.711 -7.806 -27.895 1.00107.71 H ATOM 7078 HG2 LYS A 553 58.721 -5.652 -27.979 1.00107.43 H ATOM 7079 HG3 LYS A 553 59.974 -6.351 -28.669 1.00107.43 H ATOM 7080 HD2 LYS A 553 58.581 -7.057 -30.427 1.00111.46 H ATOM 7081 HD3 LYS A 553 57.363 -6.291 -29.750 1.00111.46 H ATOM 7082 HE2 LYS A 553 58.217 -4.270 -30.268 1.00117.86 H ATOM 7083 HE3 LYS A 553 59.659 -4.873 -30.559 1.00117.86 H ATOM 7084 HZ1 LYS A 553 58.603 -4.359 -32.513 1.00108.07 H ATOM 7085 HZ2 LYS A 553 58.811 -5.792 -32.470 1.00108.07 H ATOM 7086 HZ3 LYS A 553 57.497 -5.242 -32.205 1.00108.07 H ATOM 7087 N LYS A 554 61.442 -7.641 -25.760 1.00 72.78 N ANISOU 7087 N LYS A 554 8416 11323 7914 1992 -262 -672 N ATOM 7088 CA LYS A 554 62.699 -8.220 -25.327 1.00 77.68 C ANISOU 7088 CA LYS A 554 8980 11906 8627 2034 -264 -726 C ATOM 7089 C LYS A 554 62.387 -9.085 -24.108 1.00 78.64 C ANISOU 7089 C LYS A 554 9176 11850 8854 2035 -358 -785 C ATOM 7090 O LYS A 554 62.729 -10.270 -24.073 1.00 68.71 O ANISOU 7090 O LYS A 554 7909 10558 7638 2090 -387 -904 O ATOM 7091 CB LYS A 554 63.733 -7.130 -25.005 1.00 87.15 C ANISOU 7091 CB LYS A 554 10108 13118 9885 2004 -229 -607 C ATOM 7092 CG LYS A 554 65.073 -7.633 -24.438 1.00 83.64 C ANISOU 7092 CG LYS A 554 9606 12611 9562 2041 -240 -650 C ATOM 7093 CD LYS A 554 65.765 -8.632 -25.363 1.00 87.76 C ANISOU 7093 CD LYS A 554 10059 13228 10057 2117 -192 -780 C ATOM 7094 CE LYS A 554 66.803 -9.446 -24.619 1.00 85.10 C ANISOU 7094 CE LYS A 554 9687 12781 9865 2153 -236 -852 C ATOM 7095 NZ LYS A 554 67.881 -8.612 -24.025 1.00 83.17 N ANISOU 7095 NZ LYS A 554 9384 12493 9725 2129 -228 -751 N ATOM 7096 H LYS A 554 61.392 -6.786 -25.682 1.00 87.34 H ATOM 7097 HA LYS A 554 63.055 -8.788 -26.028 1.00 93.21 H ATOM 7098 HB2 LYS A 554 63.927 -6.642 -25.820 1.00104.58 H ATOM 7099 HB3 LYS A 554 63.348 -6.527 -24.350 1.00104.58 H ATOM 7100 HG2 LYS A 554 65.667 -6.876 -24.314 1.00100.36 H ATOM 7101 HG3 LYS A 554 64.912 -8.072 -23.588 1.00100.36 H ATOM 7102 HD2 LYS A 554 65.104 -9.241 -25.728 1.00105.31 H ATOM 7103 HD3 LYS A 554 66.210 -8.151 -26.078 1.00105.31 H ATOM 7104 HE2 LYS A 554 66.368 -9.929 -23.899 1.00102.11 H ATOM 7105 HE3 LYS A 554 67.215 -10.071 -25.236 1.00102.11 H ATOM 7106 HZ1 LYS A 554 68.466 -9.130 -23.599 1.00 99.81 H ATOM 7107 HZ2 LYS A 554 68.305 -8.162 -24.666 1.00 99.81 H ATOM 7108 HZ3 LYS A 554 67.533 -8.032 -23.446 1.00 99.81 H ATOM 7109 N THR A 555 61.705 -8.492 -23.128 1.00 86.37 N ANISOU 7109 N THR A 555 10226 12718 9873 1972 -405 -702 N ATOM 7110 CA THR A 555 61.331 -9.199 -21.904 1.00 77.36 C ANISOU 7110 CA THR A 555 9165 11408 8820 1961 -491 -740 C ATOM 7111 C THR A 555 60.517 -10.428 -22.250 1.00 77.95 C ANISOU 7111 C THR A 555 9284 11466 8866 2003 -525 -859 C ATOM 7112 O THR A 555 60.693 -11.487 -21.650 1.00 72.78 O ANISOU 7112 O THR A 555 8651 10714 8287 2031 -586 -939 O ATOM 7113 CB THR A 555 60.478 -8.327 -20.965 1.00 70.80 C ANISOU 7113 CB THR A 555 8411 10480 8009 1884 -521 -639 C ATOM 7114 OG1 THR A 555 61.149 -7.090 -20.708 1.00 73.39 O ANISOU 7114 OG1 THR A 555 8693 10829 8364 1844 -494 -524 O ATOM 7115 CG2 THR A 555 60.233 -9.041 -19.645 1.00 72.29 C ANISOU 7115 CG2 THR A 555 8681 10500 8284 1868 -603 -671 C ATOM 7116 H THR A 555 61.444 -7.673 -23.149 1.00103.64 H ATOM 7117 HA THR A 555 62.130 -9.478 -21.430 1.00 92.83 H ATOM 7118 HB THR A 555 59.620 -8.149 -21.381 1.00 84.96 H ATOM 7119 HG1 THR A 555 61.274 -6.676 -21.428 1.00 88.07 H ATOM 7120 HG21 THR A 555 59.695 -8.483 -19.062 1.00 86.74 H ATOM 7121 HG22 THR A 555 59.766 -9.876 -19.801 1.00 86.74 H ATOM 7122 HG23 THR A 555 61.079 -9.229 -19.208 1.00 86.74 H ATOM 7123 N GLN A 556 59.620 -10.279 -23.220 1.00 89.16 N ANISOU 7123 N GLN A 556 10717 12976 10182 2006 -492 -868 N ATOM 7124 CA GLN A 556 58.799 -11.394 -23.662 1.00 92.43 C ANISOU 7124 CA GLN A 556 11171 13382 10569 2051 -527 -981 C ATOM 7125 C GLN A 556 59.700 -12.559 -24.074 1.00 90.92 C ANISOU 7125 C GLN A 556 10917 13224 10404 2130 -531 -1110 C ATOM 7126 O GLN A 556 59.657 -13.626 -23.462 1.00 83.80 O ANISOU 7126 O GLN A 556 10039 12215 9585 2156 -601 -1190 O ATOM 7127 CB GLN A 556 57.877 -10.984 -24.815 1.00 86.19 C ANISOU 7127 CB GLN A 556 10391 12702 9657 2047 -488 -970 C ATOM 7128 CG GLN A 556 56.740 -11.969 -25.038 1.00 87.24 C ANISOU 7128 CG GLN A 556 10586 12785 9778 2078 -541 -1064 C ATOM 7129 CD GLN A 556 55.997 -11.735 -26.336 1.00 90.31 C ANISOU 7129 CD GLN A 556 10977 13293 10045 2089 -510 -1075 C ATOM 7130 OE1 GLN A 556 56.076 -10.656 -26.920 1.00 96.79 O ANISOU 7130 OE1 GLN A 556 11772 14216 10790 2052 -455 -985 O ATOM 7131 NE2 GLN A 556 55.265 -12.750 -26.795 1.00 87.18 N ANISOU 7131 NE2 GLN A 556 10613 12881 9632 2140 -553 -1183 N ATOM 7132 H GLN A 556 59.469 -9.541 -23.635 1.00106.99 H ATOM 7133 HA GLN A 556 58.244 -11.690 -22.924 1.00110.92 H ATOM 7134 HB2 GLN A 556 57.489 -10.118 -24.617 1.00103.43 H ATOM 7135 HB3 GLN A 556 58.396 -10.936 -25.633 1.00103.43 H ATOM 7136 HG2 GLN A 556 57.102 -12.868 -25.059 1.00104.69 H ATOM 7137 HG3 GLN A 556 56.104 -11.885 -24.310 1.00104.69 H ATOM 7138 HE21 GLN A 556 55.233 -13.490 -26.358 1.00104.62 H ATOM 7139 HE22 GLN A 556 54.825 -12.665 -27.529 1.00104.62 H ATOM 7140 N LEU A 557 60.534 -12.330 -25.086 1.00 88.48 N ANISOU 7140 N LEU A 557 10523 13063 10033 2164 -457 -1128 N ATOM 7141 CA LEU A 557 61.462 -13.343 -25.585 1.00 88.00 C ANISOU 7141 CA LEU A 557 10389 13051 9998 2240 -447 -1256 C ATOM 7142 C LEU A 557 62.281 -13.974 -24.462 1.00 82.21 C ANISOU 7142 C LEU A 557 9641 12179 9417 2247 -510 -1286 C ATOM 7143 O LEU A 557 62.490 -15.187 -24.449 1.00 71.58 O ANISOU 7143 O LEU A 557 8275 10790 8133 2300 -558 -1410 O ATOM 7144 CB LEU A 557 62.404 -12.715 -26.609 1.00 94.44 C ANISOU 7144 CB LEU A 557 11111 14036 10737 2257 -343 -1235 C ATOM 7145 CG LEU A 557 63.517 -13.617 -27.148 1.00 93.29 C ANISOU 7145 CG LEU A 557 10872 13950 10623 2331 -313 -1364 C ATOM 7146 CD1 LEU A 557 62.939 -14.648 -28.114 1.00 77.33 C ANISOU 7146 CD1 LEU A 557 8856 11999 8525 2396 -319 -1510 C ATOM 7147 CD2 LEU A 557 64.621 -12.775 -27.785 1.00 83.93 C ANISOU 7147 CD2 LEU A 557 9593 12898 9398 2330 -208 -1305 C ATOM 7148 H LEU A 557 60.582 -11.582 -25.508 1.00106.18 H ATOM 7149 HA LEU A 557 60.960 -14.046 -26.026 1.00105.60 H ATOM 7150 HB2 LEU A 557 61.877 -12.423 -27.369 1.00113.33 H ATOM 7151 HB3 LEU A 557 62.830 -11.946 -26.199 1.00113.33 H ATOM 7152 HG LEU A 557 63.909 -14.100 -26.404 1.00111.94 H ATOM 7153 HD11 LEU A 557 63.658 -15.209 -28.444 1.00 92.79 H ATOM 7154 HD12 LEU A 557 62.286 -15.190 -27.643 1.00 92.79 H ATOM 7155 HD13 LEU A 557 62.514 -14.185 -28.853 1.00 92.79 H ATOM 7156 HD21 LEU A 557 65.314 -13.366 -28.119 1.00100.71 H ATOM 7157 HD22 LEU A 557 64.244 -12.261 -28.515 1.00100.71 H ATOM 7158 HD23 LEU A 557 64.989 -12.178 -27.114 1.00100.71 H ATOM 7159 N ASP A 558 62.757 -13.143 -23.538 1.00 89.69 N ANISOU 7159 N ASP A 558 10594 13055 10427 2192 -517 -1173 N ATOM 7160 CA ASP A 558 63.451 -13.629 -22.349 1.00 89.95 C ANISOU 7160 CA ASP A 558 10631 12941 10604 2185 -590 -1182 C ATOM 7161 C ASP A 558 62.546 -14.570 -21.557 1.00 90.06 C ANISOU 7161 C ASP A 558 10732 12815 10670 2179 -688 -1232 C ATOM 7162 O ASP A 558 62.921 -15.704 -21.268 1.00 99.52 O ANISOU 7162 O ASP A 558 11912 13941 11958 2217 -751 -1328 O ATOM 7163 CB ASP A 558 63.885 -12.460 -21.455 1.00 92.79 C ANISOU 7163 CB ASP A 558 11004 13243 11009 2120 -589 -1041 C ATOM 7164 CG ASP A 558 65.020 -11.658 -22.048 1.00 93.38 C ANISOU 7164 CG ASP A 558 10978 13426 11077 2130 -507 -992 C ATOM 7165 OD1 ASP A 558 65.432 -11.956 -23.189 1.00101.65 O ANISOU 7165 OD1 ASP A 558 11950 14605 12069 2183 -440 -1062 O ATOM 7166 OD2 ASP A 558 65.492 -10.722 -21.372 1.00 82.23 O ANISOU 7166 OD2 ASP A 558 9562 11968 9715 2086 -509 -882 O ATOM 7167 H ASP A 558 62.690 -12.286 -23.577 1.00107.62 H ATOM 7168 HA ASP A 558 64.243 -14.121 -22.617 1.00107.94 H ATOM 7169 HB2 ASP A 558 63.131 -11.864 -21.327 1.00111.35 H ATOM 7170 HB3 ASP A 558 64.180 -12.810 -20.600 1.00111.35 H ATOM 7171 N ASP A 559 61.355 -14.089 -21.214 1.00 84.57 N ANISOU 7171 N ASP A 559 10126 12081 9925 2129 -700 -1164 N ATOM 7172 CA ASP A 559 60.411 -14.859 -20.413 1.00 79.71 C ANISOU 7172 CA ASP A 559 9598 11332 9357 2115 -784 -1192 C ATOM 7173 C ASP A 559 60.082 -16.209 -21.040 1.00 83.46 C ANISOU 7173 C ASP A 559 10054 11816 9840 2185 -821 -1333 C ATOM 7174 O ASP A 559 60.113 -17.237 -20.360 1.00 79.03 O ANISOU 7174 O ASP A 559 9510 11141 9377 2198 -905 -1392 O ATOM 7175 CB ASP A 559 59.126 -14.059 -20.208 1.00 78.91 C ANISOU 7175 CB ASP A 559 9581 11212 9191 2055 -770 -1105 C ATOM 7176 CG ASP A 559 59.280 -12.967 -19.170 1.00 94.41 C ANISOU 7176 CG ASP A 559 11582 13106 11181 1980 -768 -979 C ATOM 7177 OD1 ASP A 559 60.399 -12.803 -18.631 1.00100.80 O ANISOU 7177 OD1 ASP A 559 12357 13886 12057 1975 -780 -953 O ATOM 7178 OD2 ASP A 559 58.281 -12.263 -18.903 1.00 96.03 O ANISOU 7178 OD2 ASP A 559 11851 13286 11350 1926 -757 -908 O ATOM 7179 H ASP A 559 61.068 -13.310 -21.436 1.00101.48 H ATOM 7180 HA ASP A 559 60.801 -15.024 -19.541 1.00 95.66 H ATOM 7181 HB2 ASP A 559 58.875 -13.643 -21.048 1.00 94.70 H ATOM 7182 HB3 ASP A 559 58.424 -14.659 -19.912 1.00 94.70 H ATOM 7183 N ARG A 560 59.771 -16.203 -22.333 1.00 85.31 N ANISOU 7183 N ARG A 560 10253 12186 9973 2227 -764 -1385 N ATOM 7184 CA ARG A 560 59.377 -17.423 -23.029 1.00 83.74 C ANISOU 7184 CA ARG A 560 10037 12007 9773 2298 -799 -1524 C ATOM 7185 C ARG A 560 60.489 -18.457 -22.995 1.00 87.33 C ANISOU 7185 C ARG A 560 10411 12441 10328 2355 -835 -1635 C ATOM 7186 O ARG A 560 60.236 -19.648 -22.806 1.00 83.57 O ANISOU 7186 O ARG A 560 9936 11887 9930 2394 -915 -1733 O ATOM 7187 CB ARG A 560 59.024 -17.123 -24.480 1.00 80.96 C ANISOU 7187 CB ARG A 560 9658 11821 9284 2333 -726 -1559 C ATOM 7188 CG ARG A 560 57.957 -16.078 -24.657 1.00 77.42 C ANISOU 7188 CG ARG A 560 9276 11399 8741 2277 -693 -1453 C ATOM 7189 CD ARG A 560 57.473 -16.075 -26.076 1.00 89.80 C ANISOU 7189 CD ARG A 560 10828 13109 10182 2317 -649 -1507 C ATOM 7190 NE ARG A 560 56.721 -17.291 -26.380 1.00 94.91 N ANISOU 7190 NE ARG A 560 11498 13713 10849 2376 -716 -1630 N ATOM 7191 CZ ARG A 560 55.462 -17.307 -26.813 1.00101.81 C ANISOU 7191 CZ ARG A 560 12431 14581 11670 2374 -739 -1633 C ATOM 7192 NH1 ARG A 560 54.792 -16.172 -27.016 1.00 94.22 N ANISOU 7192 NH1 ARG A 560 11514 13654 10631 2314 -700 -1521 N ATOM 7193 NH2 ARG A 560 54.866 -18.466 -27.053 1.00103.61 N ANISOU 7193 NH2 ARG A 560 12671 14761 11934 2434 -808 -1749 N ATOM 7194 H ARG A 560 59.780 -15.502 -22.831 1.00102.37 H ATOM 7195 HA ARG A 560 58.595 -17.801 -22.597 1.00100.48 H ATOM 7196 HB2 ARG A 560 59.822 -16.809 -24.935 1.00 97.16 H ATOM 7197 HB3 ARG A 560 58.710 -17.939 -24.898 1.00 97.16 H ATOM 7198 HG2 ARG A 560 57.207 -16.279 -24.075 1.00 92.90 H ATOM 7199 HG3 ARG A 560 58.322 -15.203 -24.453 1.00 92.90 H ATOM 7200 HD2 ARG A 560 56.890 -15.312 -26.215 1.00107.76 H ATOM 7201 HD3 ARG A 560 58.235 -16.030 -26.675 1.00107.76 H ATOM 7202 HE ARG A 560 57.118 -18.046 -26.272 1.00113.89 H ATOM 7203 HH11 ARG A 560 55.171 -15.416 -26.861 1.00113.06 H ATOM 7204 HH12 ARG A 560 53.980 -16.196 -27.298 1.00113.06 H ATOM 7205 HH21 ARG A 560 55.292 -19.202 -26.928 1.00124.33 H ATOM 7206 HH22 ARG A 560 54.054 -18.481 -27.338 1.00124.33 H ATOM 7207 N THR A 561 61.721 -17.995 -23.192 1.00 93.20 N ANISOU 7207 N THR A 561 11078 13251 11081 2360 -778 -1619 N ATOM 7208 CA THR A 561 62.882 -18.876 -23.170 1.00 94.64 C ANISOU 7208 CA THR A 561 11172 13413 11374 2410 -806 -1722 C ATOM 7209 C THR A 561 63.043 -19.521 -21.798 1.00 82.13 C ANISOU 7209 C THR A 561 9623 11640 9941 2382 -919 -1712 C ATOM 7210 O THR A 561 63.197 -20.738 -21.697 1.00 80.84 O ANISOU 7210 O THR A 561 9428 11412 9876 2425 -995 -1824 O ATOM 7211 CB THR A 561 64.187 -18.130 -23.539 1.00 91.99 C ANISOU 7211 CB THR A 561 10749 13171 11034 2412 -718 -1687 C ATOM 7212 OG1 THR A 561 64.290 -16.928 -22.767 1.00108.91 O ANISOU 7212 OG1 THR A 561 12935 15272 13174 2338 -702 -1531 O ATOM 7213 CG2 THR A 561 64.220 -17.781 -25.029 1.00 84.39 C ANISOU 7213 CG2 THR A 561 9731 12406 9928 2453 -608 -1728 C ATOM 7214 H THR A 561 61.911 -17.169 -23.341 1.00111.84 H ATOM 7215 HA THR A 561 62.750 -19.585 -23.819 1.00113.57 H ATOM 7216 HB THR A 561 64.947 -18.700 -23.344 1.00110.39 H ATOM 7217 HG1 THR A 561 63.634 -16.428 -22.924 1.00130.69 H ATOM 7218 HG21 THR A 561 65.043 -17.314 -25.241 1.00101.27 H ATOM 7219 HG22 THR A 561 64.170 -18.591 -25.560 1.00101.27 H ATOM 7220 HG23 THR A 561 63.468 -17.210 -25.252 1.00101.27 H ATOM 7221 N LYS A 562 63.003 -18.709 -20.747 1.00 58.80 N ANISOU 7221 N LYS A 562 6734 8600 7006 2308 -935 -1580 N ATOM 7222 CA LYS A 562 63.138 -19.219 -19.387 1.00 69.79 C ANISOU 7222 CA LYS A 562 8175 9817 8526 2271 -1042 -1555 C ATOM 7223 C LYS A 562 62.032 -20.231 -19.071 1.00 72.29 C ANISOU 7223 C LYS A 562 8554 10044 8869 2278 -1126 -1607 C ATOM 7224 O LYS A 562 62.278 -21.269 -18.450 1.00 68.16 O ANISOU 7224 O LYS A 562 8024 9407 8468 2288 -1225 -1663 O ATOM 7225 CB LYS A 562 63.118 -18.062 -18.384 1.00 76.67 C ANISOU 7225 CB LYS A 562 9119 10627 9386 2189 -1036 -1403 C ATOM 7226 CG LYS A 562 63.258 -18.495 -16.932 1.00 80.30 C ANISOU 7226 CG LYS A 562 9642 10909 9959 2141 -1145 -1365 C ATOM 7227 CD LYS A 562 63.387 -17.307 -15.980 1.00 81.16 C ANISOU 7227 CD LYS A 562 9815 10968 10055 2066 -1135 -1225 C ATOM 7228 CE LYS A 562 64.839 -17.096 -15.539 1.00 92.33 C ANISOU 7228 CE LYS A 562 11173 12340 11570 2062 -1158 -1202 C ATOM 7229 NZ LYS A 562 65.004 -15.970 -14.567 1.00 82.10 N ANISOU 7229 NZ LYS A 562 9939 10984 10270 1992 -1162 -1071 N ATOM 7230 H LYS A 562 62.898 -17.857 -20.794 1.00 70.56 H ATOM 7231 HA LYS A 562 63.992 -19.672 -19.304 1.00 83.75 H ATOM 7232 HB2 LYS A 562 63.854 -17.462 -18.585 1.00 92.00 H ATOM 7233 HB3 LYS A 562 62.276 -17.589 -18.471 1.00 92.00 H ATOM 7234 HG2 LYS A 562 62.472 -19.003 -16.675 1.00 96.36 H ATOM 7235 HG3 LYS A 562 64.053 -19.043 -16.839 1.00 96.36 H ATOM 7236 HD2 LYS A 562 63.085 -16.502 -16.430 1.00 97.39 H ATOM 7237 HD3 LYS A 562 62.850 -17.471 -15.189 1.00 97.39 H ATOM 7238 HE2 LYS A 562 65.160 -17.907 -15.114 1.00110.80 H ATOM 7239 HE3 LYS A 562 65.379 -16.896 -16.320 1.00110.80 H ATOM 7240 HZ1 LYS A 562 65.861 -15.887 -14.341 1.00 98.52 H ATOM 7241 HZ2 LYS A 562 64.726 -15.208 -14.933 1.00 98.52 H ATOM 7242 HZ3 LYS A 562 64.526 -16.130 -13.833 1.00 98.52 H ATOM 7243 N ILE A 563 60.816 -19.919 -19.506 1.00 87.48 N ANISOU 7243 N ILE A 563 10536 12016 10688 2272 -1091 -1586 N ATOM 7244 CA ILE A 563 59.673 -20.804 -19.319 1.00 86.15 C ANISOU 7244 CA ILE A 563 10422 11768 10541 2282 -1161 -1631 C ATOM 7245 C ILE A 563 59.907 -22.139 -20.010 1.00 81.79 C ANISOU 7245 C ILE A 563 9791 11232 10053 2366 -1211 -1788 C ATOM 7246 O ILE A 563 59.754 -23.200 -19.403 1.00 75.23 O ANISOU 7246 O ILE A 563 8968 10283 9334 2376 -1313 -1835 O ATOM 7247 CB ILE A 563 58.382 -20.157 -19.869 1.00 76.94 C ANISOU 7247 CB ILE A 563 9317 10664 9253 2267 -1105 -1588 C ATOM 7248 CG1 ILE A 563 57.908 -19.071 -18.901 1.00 78.18 C ANISOU 7248 CG1 ILE A 563 9564 10757 9383 2177 -1085 -1443 C ATOM 7249 CG2 ILE A 563 57.289 -21.201 -20.073 1.00 63.68 C ANISOU 7249 CG2 ILE A 563 7666 8932 7598 2305 -1169 -1667 C ATOM 7250 CD1 ILE A 563 56.635 -18.348 -19.323 1.00 76.57 C ANISOU 7250 CD1 ILE A 563 9419 10595 9080 2151 -1035 -1390 C ATOM 7251 H ILE A 563 60.625 -19.188 -19.918 1.00104.98 H ATOM 7252 HA ILE A 563 59.549 -20.971 -18.372 1.00103.38 H ATOM 7253 HB ILE A 563 58.581 -19.745 -20.724 1.00 92.33 H ATOM 7254 HG12 ILE A 563 57.741 -19.479 -18.037 1.00 93.81 H ATOM 7255 HG13 ILE A 563 58.609 -18.406 -18.816 1.00 93.81 H ATOM 7256 HG21 ILE A 563 56.495 -20.764 -20.418 1.00 76.42 H ATOM 7257 HG22 ILE A 563 57.602 -21.866 -20.706 1.00 76.42 H ATOM 7258 HG23 ILE A 563 57.092 -21.622 -19.222 1.00 76.42 H ATOM 7259 HD11 ILE A 563 56.413 -17.683 -18.653 1.00 91.89 H ATOM 7260 HD12 ILE A 563 56.786 -17.919 -20.180 1.00 91.89 H ATOM 7261 HD13 ILE A 563 55.916 -18.995 -19.399 1.00 91.89 H ATOM 7262 N THR A 564 60.275 -22.069 -21.284 1.00 82.34 N ANISOU 7262 N THR A 564 9785 11451 10051 2426 -1138 -1866 N ATOM 7263 CA THR A 564 60.500 -23.250 -22.100 1.00 88.14 C ANISOU 7263 CA THR A 564 10437 12224 10830 2513 -1171 -2029 C ATOM 7264 C THR A 564 61.578 -24.156 -21.506 1.00 93.73 C ANISOU 7264 C THR A 564 11074 12836 11703 2530 -1251 -2096 C ATOM 7265 O THR A 564 61.346 -25.349 -21.277 1.00 84.28 O ANISOU 7265 O THR A 564 9860 11549 10615 2563 -1353 -2183 O ATOM 7266 CB THR A 564 60.972 -22.842 -23.501 1.00 94.77 C ANISOU 7266 CB THR A 564 11203 13252 11554 2564 -1062 -2090 C ATOM 7267 OG1 THR A 564 60.282 -21.663 -23.933 1.00 85.41 O ANISOU 7267 OG1 THR A 564 10077 12158 10217 2526 -978 -1989 O ATOM 7268 CG2 THR A 564 60.784 -23.994 -24.490 1.00 93.48 C ANISOU 7268 CG2 THR A 564 10979 13143 11398 2655 -1091 -2263 C ATOM 7269 H THR A 564 60.403 -21.330 -21.706 1.00 98.81 H ATOM 7270 HA THR A 564 59.676 -23.755 -22.181 1.00105.77 H ATOM 7271 HB THR A 564 61.921 -22.645 -23.461 1.00113.72 H ATOM 7272 HG1 THR A 564 60.433 -21.030 -23.402 1.00102.49 H ATOM 7273 HG21 THR A 564 61.086 -23.725 -25.372 1.00112.18 H ATOM 7274 HG22 THR A 564 61.299 -24.764 -24.203 1.00112.18 H ATOM 7275 HG23 THR A 564 59.847 -24.240 -24.539 1.00112.18 H ATOM 7276 N GLU A 565 62.756 -23.575 -21.279 1.00 86.59 N ANISOU 7276 N GLU A 565 10124 11950 10827 2507 -1210 -2053 N ATOM 7277 CA GLU A 565 63.905 -24.301 -20.754 1.00 71.99 C ANISOU 7277 CA GLU A 565 8200 10011 9142 2519 -1280 -2110 C ATOM 7278 C GLU A 565 63.572 -24.989 -19.441 1.00 74.23 C ANISOU 7278 C GLU A 565 8546 10107 9552 2475 -1416 -2072 C ATOM 7279 O GLU A 565 63.967 -26.130 -19.217 1.00 88.57 O ANISOU 7279 O GLU A 565 10304 11837 11512 2504 -1514 -2165 O ATOM 7280 CB GLU A 565 65.098 -23.359 -20.548 1.00 80.28 C ANISOU 7280 CB GLU A 565 9212 11089 10203 2487 -1216 -2034 C ATOM 7281 CG GLU A 565 65.774 -22.883 -21.837 1.00 91.06 C ANISOU 7281 CG GLU A 565 10484 12633 11482 2536 -1088 -2089 C ATOM 7282 CD GLU A 565 66.936 -21.922 -21.587 1.00 99.23 C ANISOU 7282 CD GLU A 565 11477 13685 12541 2503 -1027 -2002 C ATOM 7283 OE1 GLU A 565 67.271 -21.671 -20.408 1.00 93.22 O ANISOU 7283 OE1 GLU A 565 10758 12790 11870 2446 -1093 -1910 O ATOM 7284 OE2 GLU A 565 67.512 -21.414 -22.576 1.00101.54 O ANISOU 7284 OE2 GLU A 565 11696 14124 12762 2535 -914 -2025 O ATOM 7285 H GLU A 565 62.915 -22.743 -21.426 1.00103.91 H ATOM 7286 HA GLU A 565 64.167 -24.983 -21.392 1.00 86.39 H ATOM 7287 HB2 GLU A 565 64.791 -22.572 -20.070 1.00 96.34 H ATOM 7288 HB3 GLU A 565 65.768 -23.820 -20.019 1.00 96.34 H ATOM 7289 HG2 GLU A 565 66.121 -23.653 -22.313 1.00109.27 H ATOM 7290 HG3 GLU A 565 65.119 -22.423 -22.384 1.00109.27 H ATOM 7291 N LEU A 566 62.857 -24.297 -18.565 1.00 73.28 N ANISOU 7291 N LEU A 566 8541 9922 9381 2401 -1422 -1935 N ATOM 7292 CA LEU A 566 62.511 -24.874 -17.275 1.00 78.93 C ANISOU 7292 CA LEU A 566 9326 10464 10198 2350 -1542 -1886 C ATOM 7293 C LEU A 566 61.433 -25.950 -17.397 1.00 77.70 C ANISOU 7293 C LEU A 566 9189 10259 10073 2383 -1615 -1956 C ATOM 7294 O LEU A 566 61.534 -27.009 -16.774 1.00 75.87 O ANISOU 7294 O LEU A 566 8943 9905 9978 2383 -1734 -1995 O ATOM 7295 CB LEU A 566 62.070 -23.782 -16.299 1.00 72.93 C ANISOU 7295 CB LEU A 566 8685 9656 9369 2260 -1518 -1724 C ATOM 7296 CG LEU A 566 61.364 -24.239 -15.019 1.00 76.06 C ANISOU 7296 CG LEU A 566 9182 9894 9823 2200 -1619 -1658 C ATOM 7297 CD1 LEU A 566 62.150 -25.266 -14.215 1.00 75.90 C ANISOU 7297 CD1 LEU A 566 9130 9739 9970 2192 -1750 -1691 C ATOM 7298 CD2 LEU A 566 61.086 -23.026 -14.166 1.00 84.06 C ANISOU 7298 CD2 LEU A 566 10301 10882 10757 2116 -1575 -1511 C ATOM 7299 H LEU A 566 62.563 -23.499 -18.691 1.00 87.94 H ATOM 7300 HA LEU A 566 63.303 -25.295 -16.903 1.00 94.71 H ATOM 7301 HB2 LEU A 566 62.857 -23.282 -16.030 1.00 87.52 H ATOM 7302 HB3 LEU A 566 61.460 -23.189 -16.766 1.00 87.52 H ATOM 7303 HG LEU A 566 60.512 -24.636 -15.256 1.00 91.27 H ATOM 7304 HD11 LEU A 566 61.641 -25.504 -13.425 1.00 91.08 H ATOM 7305 HD12 LEU A 566 62.295 -26.052 -14.765 1.00 91.08 H ATOM 7306 HD13 LEU A 566 63.002 -24.880 -13.957 1.00 91.08 H ATOM 7307 HD21 LEU A 566 60.639 -23.308 -13.353 1.00100.87 H ATOM 7308 HD22 LEU A 566 61.927 -22.594 -13.949 1.00100.87 H ATOM 7309 HD23 LEU A 566 60.518 -22.416 -14.662 1.00100.87 H ATOM 7310 N PHE A 567 60.413 -25.691 -18.208 1.00 83.29 N ANISOU 7310 N PHE A 567 9925 11059 10664 2410 -1551 -1971 N ATOM 7311 CA PHE A 567 59.227 -26.543 -18.207 1.00 80.39 C ANISOU 7311 CA PHE A 567 9593 10631 10321 2431 -1619 -2011 C ATOM 7312 C PHE A 567 59.232 -27.659 -19.243 1.00 79.61 C ANISOU 7312 C PHE A 567 9397 10580 10272 2529 -1656 -2178 C ATOM 7313 O PHE A 567 58.445 -28.600 -19.138 1.00 69.17 O ANISOU 7313 O PHE A 567 8083 9181 9019 2554 -1742 -2226 O ATOM 7314 CB PHE A 567 57.976 -25.683 -18.325 1.00 77.13 C ANISOU 7314 CB PHE A 567 9276 10253 9774 2397 -1550 -1924 C ATOM 7315 CG PHE A 567 57.611 -25.016 -17.042 1.00 73.67 C ANISOU 7315 CG PHE A 567 8946 9714 9329 2302 -1556 -1777 C ATOM 7316 CD1 PHE A 567 56.890 -25.705 -16.086 1.00 70.33 C ANISOU 7316 CD1 PHE A 567 8586 9150 8985 2268 -1646 -1745 C ATOM 7317 CD2 PHE A 567 58.022 -23.722 -16.770 1.00 72.60 C ANISOU 7317 CD2 PHE A 567 8846 9625 9114 2245 -1475 -1673 C ATOM 7318 CE1 PHE A 567 56.562 -25.114 -14.891 1.00 69.93 C ANISOU 7318 CE1 PHE A 567 8638 9011 8921 2179 -1648 -1616 C ATOM 7319 CE2 PHE A 567 57.697 -23.120 -15.573 1.00 70.89 C ANISOU 7319 CE2 PHE A 567 8727 9315 8891 2159 -1483 -1548 C ATOM 7320 CZ PHE A 567 56.967 -23.818 -14.631 1.00 70.21 C ANISOU 7320 CZ PHE A 567 8710 9094 8872 2125 -1567 -1522 C ATOM 7321 H PHE A 567 60.381 -25.036 -18.763 1.00 99.95 H ATOM 7322 HA PHE A 567 59.183 -26.976 -17.340 1.00 96.47 H ATOM 7323 HB2 PHE A 567 58.128 -24.993 -18.989 1.00 92.55 H ATOM 7324 HB3 PHE A 567 57.232 -26.244 -18.594 1.00 92.55 H ATOM 7325 HD1 PHE A 567 56.617 -26.577 -16.257 1.00 84.39 H ATOM 7326 HD2 PHE A 567 58.514 -23.252 -17.403 1.00 87.12 H ATOM 7327 HE1 PHE A 567 56.069 -25.584 -14.259 1.00 83.92 H ATOM 7328 HE2 PHE A 567 57.969 -22.248 -15.399 1.00 85.06 H ATOM 7329 HZ PHE A 567 56.743 -23.415 -13.823 1.00 84.25 H ATOM 7330 N ALA A 568 60.113 -27.560 -20.233 1.00 84.59 N ANISOU 7330 N ALA A 568 9933 11335 10872 2584 -1591 -2269 N ATOM 7331 CA ALA A 568 60.340 -28.673 -21.142 1.00 90.10 C ANISOU 7331 CA ALA A 568 10525 12074 11634 2678 -1631 -2444 C ATOM 7332 C ALA A 568 60.773 -29.858 -20.300 1.00 95.64 C ANISOU 7332 C ALA A 568 11180 12621 12537 2678 -1773 -2491 C ATOM 7333 O ALA A 568 60.297 -30.981 -20.474 1.00101.42 O ANISOU 7333 O ALA A 568 11897 13299 13340 2680 -1852 -2563 O ATOM 7334 CB ALA A 568 61.415 -28.331 -22.152 1.00 95.13 C ANISOU 7334 CB ALA A 568 11066 12860 12218 2724 -1533 -2524 C ATOM 7335 H ALA A 568 60.589 -26.863 -20.397 1.00101.51 H ATOM 7336 HA ALA A 568 59.521 -28.897 -21.611 1.00108.11 H ATOM 7337 HB1 ALA A 568 61.545 -29.089 -22.743 1.00114.15 H ATOM 7338 HB2 ALA A 568 61.132 -27.557 -22.663 1.00114.15 H ATOM 7339 HB3 ALA A 568 62.239 -28.134 -21.680 1.00114.15 H ATOM 7340 N VAL A 569 61.671 -29.572 -19.366 1.00 90.09 N ANISOU 7340 N VAL A 569 10480 11840 11907 2618 -1796 -2414 N ATOM 7341 CA VAL A 569 62.197 -30.558 -18.437 1.00 86.85 C ANISOU 7341 CA VAL A 569 10034 11273 11691 2600 -1937 -2433 C ATOM 7342 C VAL A 569 61.207 -30.869 -17.311 1.00 82.22 C ANISOU 7342 C VAL A 569 9553 10542 11144 2539 -2032 -2331 C ATOM 7343 O VAL A 569 61.055 -32.026 -16.907 1.00 76.01 O ANISOU 7343 O VAL A 569 8757 9643 10480 2505 -2139 -2361 O ATOM 7344 CB VAL A 569 63.504 -30.027 -17.811 1.00 73.90 C ANISOU 7344 CB VAL A 569 8372 9598 10108 2550 -1928 -2374 C ATOM 7345 CG1 VAL A 569 64.138 -31.057 -16.903 1.00 71.83 C ANISOU 7345 CG1 VAL A 569 8067 9171 10054 2528 -2081 -2397 C ATOM 7346 CG2 VAL A 569 64.475 -29.615 -18.902 1.00 75.24 C ANISOU 7346 CG2 VAL A 569 8440 9914 10233 2605 -1817 -2460 C ATOM 7347 H VAL A 569 62.001 -28.786 -19.250 1.00108.10 H ATOM 7348 HA VAL A 569 62.393 -31.380 -18.912 1.00104.22 H ATOM 7349 HB VAL A 569 63.302 -29.242 -17.278 1.00 88.68 H ATOM 7350 HG11 VAL A 569 64.954 -30.688 -16.530 1.00 86.20 H ATOM 7351 HG12 VAL A 569 63.517 -31.274 -16.190 1.00 86.20 H ATOM 7352 HG13 VAL A 569 64.340 -31.852 -17.420 1.00 86.20 H ATOM 7353 HG21 VAL A 569 65.289 -29.285 -18.492 1.00 90.28 H ATOM 7354 HG22 VAL A 569 64.673 -30.386 -19.456 1.00 90.28 H ATOM 7355 HG23 VAL A 569 64.068 -28.917 -19.439 1.00 90.28 H ATOM 7356 N ALA A 570 60.534 -29.835 -16.810 1.00 75.97 N ANISOU 7356 N ALA A 570 8882 9755 10226 2472 -1966 -2189 N ATOM 7357 CA ALA A 570 59.788 -29.944 -15.559 1.00 77.61 C ANISOU 7357 CA ALA A 570 9199 9824 10466 2396 -2040 -2072 C ATOM 7358 C ALA A 570 58.399 -30.525 -15.751 1.00 82.02 C ANISOU 7358 C ALA A 570 9794 10354 11015 2421 -2072 -2092 C ATOM 7359 O ALA A 570 57.917 -31.289 -14.907 1.00 77.08 O ANISOU 7359 O ALA A 570 9202 9596 10490 2391 -2179 -2058 O ATOM 7360 CB ALA A 570 59.692 -28.584 -14.883 1.00 75.31 C ANISOU 7360 CB ALA A 570 9018 9544 10055 2312 -1956 -1919 C ATOM 7361 H ALA A 570 60.493 -29.058 -17.176 1.00 91.16 H ATOM 7362 HA ALA A 570 60.273 -30.535 -14.961 1.00 93.14 H ATOM 7363 HB1 ALA A 570 59.194 -28.677 -14.056 1.00 90.38 H ATOM 7364 HB2 ALA A 570 60.587 -28.260 -14.697 1.00 90.38 H ATOM 7365 HB3 ALA A 570 59.234 -27.968 -15.477 1.00 90.38 H ATOM 7366 N LEU A 571 57.756 -30.152 -16.855 1.00 83.54 N ANISOU 7366 N LEU A 571 9981 10669 11093 2474 -1983 -2140 N ATOM 7367 CA LEU A 571 56.358 -30.515 -17.087 1.00 81.33 C ANISOU 7367 CA LEU A 571 9746 10365 10793 2495 -2001 -2146 C ATOM 7368 C LEU A 571 56.123 -32.024 -17.021 1.00 81.39 C ANISOU 7368 C LEU A 571 9714 10277 10935 2481 -2111 -2215 C ATOM 7369 O LEU A 571 55.145 -32.465 -16.413 1.00 79.01 O ANISOU 7369 O LEU A 571 9476 9873 10673 2437 -2162 -2156 O ATOM 7370 CB LEU A 571 55.854 -29.936 -18.418 1.00 79.88 C ANISOU 7370 CB LEU A 571 9552 10332 10467 2552 -1896 -2200 C ATOM 7371 CG LEU A 571 54.433 -30.291 -18.872 1.00 79.41 C ANISOU 7371 CG LEU A 571 9532 10257 10381 2572 -1908 -2217 C ATOM 7372 CD1 LEU A 571 53.410 -30.076 -17.767 1.00 76.82 C ANISOU 7372 CD1 LEU A 571 9312 9805 10072 2508 -1934 -2090 C ATOM 7373 CD2 LEU A 571 54.062 -29.474 -20.102 1.00 72.10 C ANISOU 7373 CD2 LEU A 571 8607 9484 9302 2623 -1802 -2251 C ATOM 7374 H LEU A 571 58.107 -29.687 -17.487 1.00100.25 H ATOM 7375 HA LEU A 571 55.824 -30.115 -16.383 1.00 97.60 H ATOM 7376 HB2 LEU A 571 55.896 -28.969 -18.355 1.00 95.85 H ATOM 7377 HB3 LEU A 571 56.456 -30.233 -19.118 1.00 95.85 H ATOM 7378 HG LEU A 571 54.410 -31.228 -19.120 1.00 95.29 H ATOM 7379 HD11 LEU A 571 52.531 -30.314 -18.101 1.00 92.19 H ATOM 7380 HD12 LEU A 571 53.639 -30.639 -17.010 1.00 92.19 H ATOM 7381 HD13 LEU A 571 53.422 -29.143 -17.502 1.00 92.19 H ATOM 7382 HD21 LEU A 571 53.162 -29.709 -20.377 1.00 86.51 H ATOM 7383 HD22 LEU A 571 54.105 -28.531 -19.878 1.00 86.51 H ATOM 7384 HD23 LEU A 571 54.689 -29.674 -20.814 1.00 86.51 H ATOM 7385 N PRO A 572 57.018 -32.824 -17.633 1.00 77.60 N ANISOU 7385 N PRO A 572 9132 9828 10526 2502 -2140 -2333 N ATOM 7386 CA PRO A 572 56.820 -34.276 -17.590 1.00 71.54 C ANISOU 7386 CA PRO A 572 8326 8969 9886 2472 -2240 -2396 C ATOM 7387 C PRO A 572 56.772 -34.833 -16.177 1.00 73.64 C ANISOU 7387 C PRO A 572 8637 9065 10277 2393 -2344 -2304 C ATOM 7388 O PRO A 572 56.023 -35.774 -15.917 1.00 76.11 O ANISOU 7388 O PRO A 572 8966 9289 10664 2355 -2412 -2300 O ATOM 7389 CB PRO A 572 58.048 -34.810 -18.318 1.00 71.91 C ANISOU 7389 CB PRO A 572 8255 9075 9991 2505 -2247 -2528 C ATOM 7390 CG PRO A 572 58.410 -33.734 -19.258 1.00 75.35 C ANISOU 7390 CG PRO A 572 8669 9676 10284 2571 -2125 -2560 C ATOM 7391 CD PRO A 572 58.142 -32.463 -18.515 1.00 74.71 C ANISOU 7391 CD PRO A 572 8677 9590 10121 2557 -2073 -2423 C ATOM 7392 HA PRO A 572 56.017 -34.529 -18.072 1.00 85.85 H ATOM 7393 HB2 PRO A 572 58.764 -34.969 -17.684 1.00 86.29 H ATOM 7394 HB3 PRO A 572 57.821 -35.623 -18.796 1.00 86.29 H ATOM 7395 HG2 PRO A 572 59.349 -33.804 -19.490 1.00 90.42 H ATOM 7396 HG3 PRO A 572 57.854 -33.792 -20.051 1.00 90.42 H ATOM 7397 HD2 PRO A 572 58.917 -32.207 -17.991 1.00 89.66 H ATOM 7398 HD3 PRO A 572 57.879 -31.761 -19.130 1.00 89.66 H ATOM 7399 N GLN A 573 57.555 -34.256 -15.275 1.00 75.34 N ANISOU 7399 N GLN A 573 8873 9237 10515 2365 -2358 -2227 N ATOM 7400 CA GLN A 573 57.583 -34.731 -13.898 1.00 83.27 C ANISOU 7400 CA GLN A 573 9926 10083 11629 2287 -2462 -2133 C ATOM 7401 C GLN A 573 56.361 -34.220 -13.167 1.00 75.20 C ANISOU 7401 C GLN A 573 9023 9011 10539 2255 -2449 -2007 C ATOM 7402 O GLN A 573 55.852 -34.872 -12.255 1.00 72.97 O ANISOU 7402 O GLN A 573 8788 8605 10334 2193 -2528 -1940 O ATOM 7403 CB GLN A 573 58.828 -34.240 -13.169 1.00 91.57 C ANISOU 7403 CB GLN A 573 10970 11101 12722 2264 -2491 -2086 C ATOM 7404 CG GLN A 573 60.063 -34.141 -14.020 1.00 88.65 C ANISOU 7404 CG GLN A 573 10491 10822 12370 2313 -2451 -2195 C ATOM 7405 CD GLN A 573 61.217 -33.581 -13.243 1.00 84.30 C ANISOU 7405 CD GLN A 573 9939 10226 11866 2286 -2479 -2135 C ATOM 7406 OE1 GLN A 573 61.388 -33.878 -12.059 1.00 86.14 O ANISOU 7406 OE1 GLN A 573 10221 10324 12184 2214 -2579 -2049 O ATOM 7407 NE2 GLN A 573 62.009 -32.746 -13.894 1.00 80.15 N ANISOU 7407 NE2 GLN A 573 9359 9812 11280 2340 -2392 -2173 N ATOM 7408 H GLN A 573 58.077 -33.590 -15.433 1.00 90.41 H ATOM 7409 HA GLN A 573 57.574 -35.701 -13.885 1.00 99.92 H ATOM 7410 HB2 GLN A 573 58.647 -33.357 -12.811 1.00109.88 H ATOM 7411 HB3 GLN A 573 59.021 -34.852 -12.442 1.00109.88 H ATOM 7412 HG2 GLN A 573 60.308 -35.025 -14.335 1.00106.38 H ATOM 7413 HG3 GLN A 573 59.888 -33.553 -14.771 1.00106.38 H ATOM 7414 HE21 GLN A 573 61.847 -32.553 -14.716 1.00 96.17 H ATOM 7415 HE22 GLN A 573 62.686 -32.396 -13.496 1.00 96.17 H ATOM 7416 N LEU A 574 55.918 -33.029 -13.558 1.00 79.32 N ANISOU 7416 N LEU A 574 9591 9629 10919 2298 -2346 -1974 N ATOM 7417 CA LEU A 574 54.718 -32.419 -12.999 1.00 81.44 C ANISOU 7417 CA LEU A 574 9970 9861 11114 2275 -2315 -1865 C ATOM 7418 C LEU A 574 53.471 -33.240 -13.316 1.00 81.00 C ANISOU 7418 C LEU A 574 9925 9767 11084 2264 -2328 -1887 C ATOM 7419 O LEU A 574 52.650 -33.500 -12.438 1.00 77.17 O ANISOU 7419 O LEU A 574 9510 9176 10635 2211 -2367 -1799 O ATOM 7420 CB LEU A 574 54.554 -31.002 -13.543 1.00 78.76 C ANISOU 7420 CB LEU A 574 9676 9647 10602 2282 -2170 -1831 C ATOM 7421 CG LEU A 574 55.420 -29.939 -12.867 1.00 82.81 C ANISOU 7421 CG LEU A 574 10241 10178 11044 2207 -2112 -1735 C ATOM 7422 CD1 LEU A 574 55.539 -28.691 -13.733 1.00 76.29 C ANISOU 7422 CD1 LEU A 574 9417 9502 10068 2222 -1971 -1734 C ATOM 7423 CD2 LEU A 574 54.837 -29.593 -11.502 1.00 79.80 C ANISOU 7423 CD2 LEU A 574 9987 9691 10644 2105 -2122 -1591 C ATOM 7424 H LEU A 574 56.303 -32.547 -14.158 1.00 95.19 H ATOM 7425 HA LEU A 574 54.808 -32.365 -12.034 1.00 97.73 H ATOM 7426 HB2 LEU A 574 54.782 -31.006 -14.486 1.00 94.51 H ATOM 7427 HB3 LEU A 574 53.628 -30.736 -13.435 1.00 94.51 H ATOM 7428 HG LEU A 574 56.311 -30.296 -12.731 1.00 99.37 H ATOM 7429 HD11 LEU A 574 56.093 -28.040 -13.273 1.00 91.55 H ATOM 7430 HD12 LEU A 574 55.945 -28.933 -14.580 1.00 91.55 H ATOM 7431 HD13 LEU A 574 54.654 -28.325 -13.882 1.00 91.55 H ATOM 7432 HD21 LEU A 574 55.393 -28.919 -11.082 1.00 95.77 H ATOM 7433 HD22 LEU A 574 53.936 -29.253 -11.620 1.00 95.77 H ATOM 7434 HD23 LEU A 574 54.818 -30.395 -10.955 1.00 95.77 H ATOM 7435 N LEU A 575 53.331 -33.637 -14.578 1.00 75.85 N ANISOU 7435 N LEU A 575 9204 9203 10412 2313 -2296 -2001 N ATOM 7436 CA LEU A 575 52.234 -34.498 -14.994 1.00 72.18 C ANISOU 7436 CA LEU A 575 8737 8705 9982 2303 -2319 -2033 C ATOM 7437 C LEU A 575 52.313 -35.847 -14.299 1.00 75.59 C ANISOU 7437 C LEU A 575 9143 9008 10570 2245 -2433 -2033 C ATOM 7438 O LEU A 575 51.313 -36.346 -13.797 1.00 80.24 O ANISOU 7438 O LEU A 575 9775 9507 11205 2201 -2466 -1974 O ATOM 7439 CB LEU A 575 52.256 -34.694 -16.509 1.00 81.24 C ANISOU 7439 CB LEU A 575 9814 9976 11078 2368 -2278 -2164 C ATOM 7440 CG LEU A 575 51.799 -33.496 -17.344 1.00 87.66 C ANISOU 7440 CG LEU A 575 10660 10912 11733 2421 -2168 -2162 C ATOM 7441 CD1 LEU A 575 52.087 -33.713 -18.825 1.00 85.52 C ANISOU 7441 CD1 LEU A 575 10312 10773 11408 2487 -2138 -2297 C ATOM 7442 CD2 LEU A 575 50.322 -33.246 -17.128 1.00 83.55 C ANISOU 7442 CD2 LEU A 575 10223 10338 11182 2394 -2146 -2082 C ATOM 7443 H LEU A 575 53.864 -33.418 -15.216 1.00 91.02 H ATOM 7444 HA LEU A 575 51.391 -34.082 -14.753 1.00 86.61 H ATOM 7445 HB2 LEU A 575 53.165 -34.903 -16.776 1.00 97.49 H ATOM 7446 HB3 LEU A 575 51.676 -35.439 -16.729 1.00 97.49 H ATOM 7447 HG LEU A 575 52.284 -32.706 -17.057 1.00105.19 H ATOM 7448 HD11 LEU A 575 51.785 -32.937 -19.322 1.00102.62 H ATOM 7449 HD12 LEU A 575 53.041 -33.834 -18.947 1.00102.62 H ATOM 7450 HD13 LEU A 575 51.612 -34.504 -19.126 1.00102.62 H ATOM 7451 HD21 LEU A 575 50.050 -32.484 -17.664 1.00100.25 H ATOM 7452 HD22 LEU A 575 49.826 -34.035 -17.397 1.00100.25 H ATOM 7453 HD23 LEU A 575 50.168 -33.061 -16.188 1.00100.25 H ATOM 7454 N ALA A 576 53.504 -36.435 -14.281 1.00 79.42 N ANISOU 7454 N ALA A 576 9552 9482 11141 2242 -2491 -2098 N ATOM 7455 CA ALA A 576 53.720 -37.707 -13.601 1.00 78.95 C ANISOU 7455 CA ALA A 576 9462 9297 11238 2183 -2605 -2099 C ATOM 7456 C ALA A 576 53.145 -37.661 -12.190 1.00 73.43 C ANISOU 7456 C ALA A 576 8854 8473 10573 2111 -2650 -1952 C ATOM 7457 O ALA A 576 52.368 -38.528 -11.791 1.00 64.45 O ANISOU 7457 O ALA A 576 7729 7245 9513 2066 -2703 -1920 O ATOM 7458 CB ALA A 576 55.214 -38.034 -13.554 1.00 85.41 C ANISOU 7458 CB ALA A 576 10202 10110 12140 2182 -2655 -2164 C ATOM 7459 H ALA A 576 54.208 -36.116 -14.657 1.00 95.30 H ATOM 7460 HA ALA A 576 53.269 -38.413 -14.091 1.00 94.74 H ATOM 7461 HB1 ALA A 576 55.337 -38.882 -13.099 1.00102.49 H ATOM 7462 HB2 ALA A 576 55.553 -38.093 -14.461 1.00102.49 H ATOM 7463 HB3 ALA A 576 55.676 -37.330 -13.072 1.00102.49 H ATOM 7464 N LYS A 577 53.510 -36.618 -11.454 1.00 79.48 N ANISOU 7464 N LYS A 577 9686 9239 11275 2101 -2625 -1860 N ATOM 7465 CA LYS A 577 53.143 -36.491 -10.051 1.00 74.39 C ANISOU 7465 CA LYS A 577 9134 8479 10651 2032 -2674 -1719 C ATOM 7466 C LYS A 577 51.640 -36.309 -9.862 1.00 83.32 C ANISOU 7466 C LYS A 577 10342 9583 11732 2020 -2630 -1646 C ATOM 7467 O LYS A 577 51.047 -36.900 -8.957 1.00 85.59 O ANISOU 7467 O LYS A 577 10672 9760 12087 1959 -2690 -1565 O ATOM 7468 CB LYS A 577 53.900 -35.316 -9.421 1.00 65.54 C ANISOU 7468 CB LYS A 577 8071 7376 9456 2030 -2655 -1646 C ATOM 7469 CG LYS A 577 53.563 -35.073 -7.959 1.00 69.50 C ANISOU 7469 CG LYS A 577 8685 7764 9956 1959 -2707 -1496 C ATOM 7470 CD LYS A 577 54.668 -34.320 -7.221 1.00 75.41 C ANISOU 7470 CD LYS A 577 9474 8501 10675 1932 -2735 -1434 C ATOM 7471 CE LYS A 577 54.196 -33.843 -5.843 1.00 86.28 C ANISOU 7471 CE LYS A 577 11002 9802 11979 1815 -2719 -1275 C ATOM 7472 NZ LYS A 577 53.249 -34.788 -5.169 1.00 90.35 N ANISOU 7472 NZ LYS A 577 11548 10202 12578 1783 -2804 -1218 N ATOM 7473 H LYS A 577 53.978 -35.960 -11.750 1.00 95.38 H ATOM 7474 HA LYS A 577 53.405 -37.300 -9.584 1.00 89.27 H ATOM 7475 HB2 LYS A 577 54.853 -35.492 -9.480 1.00 78.65 H ATOM 7476 HB3 LYS A 577 53.686 -34.508 -9.912 1.00 78.65 H ATOM 7477 HG2 LYS A 577 52.752 -34.545 -7.904 1.00 83.39 H ATOM 7478 HG3 LYS A 577 53.435 -35.927 -7.517 1.00 83.39 H ATOM 7479 HD2 LYS A 577 55.428 -34.909 -7.094 1.00 90.49 H ATOM 7480 HD3 LYS A 577 54.928 -33.543 -7.739 1.00 90.49 H ATOM 7481 HE2 LYS A 577 54.969 -33.736 -5.267 1.00103.53 H ATOM 7482 HE3 LYS A 577 53.743 -32.991 -5.946 1.00103.53 H ATOM 7483 HZ1 LYS A 577 53.008 -34.463 -4.376 1.00108.42 H ATOM 7484 HZ2 LYS A 577 52.522 -34.898 -5.669 1.00108.42 H ATOM 7485 HZ3 LYS A 577 53.642 -35.578 -5.050 1.00108.42 H ATOM 7486 N TYR A 578 51.030 -35.508 -10.732 1.00 88.40 N ANISOU 7486 N TYR A 578 10999 10325 12263 2076 -2526 -1676 N ATOM 7487 CA TYR A 578 49.663 -35.037 -10.521 1.00 78.22 C ANISOU 7487 CA TYR A 578 9793 9012 10916 2065 -2468 -1599 C ATOM 7488 C TYR A 578 48.640 -35.624 -11.491 1.00 82.63 C ANISOU 7488 C TYR A 578 10312 9595 11487 2084 -2440 -1663 C ATOM 7489 O TYR A 578 47.472 -35.248 -11.439 1.00 90.57 O ANISOU 7489 O TYR A 578 11377 10582 12453 2076 -2387 -1608 O ATOM 7490 CB TYR A 578 49.625 -33.503 -10.611 1.00 70.33 C ANISOU 7490 CB TYR A 578 8861 8087 9776 2101 -2368 -1557 C ATOM 7491 CG TYR A 578 50.448 -32.807 -9.543 1.00 67.88 C ANISOU 7491 CG TYR A 578 8616 7748 9429 2053 -2379 -1467 C ATOM 7492 CD1 TYR A 578 50.026 -32.780 -8.218 1.00 66.46 C ANISOU 7492 CD1 TYR A 578 8538 7463 9250 1955 -2394 -1339 C ATOM 7493 CD2 TYR A 578 51.650 -32.185 -9.858 1.00 62.04 C ANISOU 7493 CD2 TYR A 578 7844 7097 8631 2059 -2342 -1500 C ATOM 7494 CE1 TYR A 578 50.778 -32.154 -7.237 1.00 64.10 C ANISOU 7494 CE1 TYR A 578 8314 7150 8892 1867 -2381 -1251 C ATOM 7495 CE2 TYR A 578 52.408 -31.556 -8.885 1.00 66.13 C ANISOU 7495 CE2 TYR A 578 8429 7594 9103 1974 -2330 -1409 C ATOM 7496 CZ TYR A 578 51.967 -31.542 -7.575 1.00 69.52 C ANISOU 7496 CZ TYR A 578 8965 7919 9529 1879 -2353 -1287 C ATOM 7497 OH TYR A 578 52.719 -30.914 -6.605 1.00 72.82 O ANISOU 7497 OH TYR A 578 9456 8315 9896 1796 -2347 -1200 O ATOM 7498 H TYR A 578 51.389 -35.220 -11.459 1.00106.08 H ATOM 7499 HA TYR A 578 49.389 -35.284 -9.624 1.00 93.87 H ATOM 7500 HB2 TYR A 578 49.971 -33.232 -11.476 1.00 84.40 H ATOM 7501 HB3 TYR A 578 48.706 -33.207 -10.517 1.00 84.40 H ATOM 7502 HD1 TYR A 578 49.226 -33.193 -7.986 1.00 79.75 H ATOM 7503 HD2 TYR A 578 51.952 -32.193 -10.738 1.00 74.45 H ATOM 7504 HE1 TYR A 578 50.481 -32.144 -6.356 1.00 76.92 H ATOM 7505 HE2 TYR A 578 53.209 -31.143 -9.112 1.00 79.36 H ATOM 7506 HH TYR A 578 53.413 -30.586 -6.947 1.00 87.38 H ATOM 7507 N SER A 579 49.061 -36.546 -12.355 1.00 87.54 N ATOM 7508 CA SER A 579 48.188 -37.073 -13.415 1.00 85.55 C ATOM 7509 C SER A 579 46.825 -37.565 -12.919 1.00 87.78 C ATOM 7510 O SER A 579 45.851 -37.567 -13.669 1.00 85.15 O ATOM 7511 CB SER A 579 48.877 -38.216 -14.165 1.00 90.72 C ATOM 7512 OG SER A 579 49.303 -39.232 -13.270 1.00 90.57 O ATOM 7513 H SER A 579 49.851 -36.886 -12.352 1.00105.05 H ATOM 7514 HA SER A 579 48.023 -36.364 -14.055 1.00102.65 H ATOM 7515 HB2 SER A 579 48.252 -38.598 -14.801 1.00108.86 H ATOM 7516 HB3 SER A 579 49.651 -37.864 -14.633 1.00108.86 H ATOM 7517 HG SER A 579 49.679 -39.851 -13.696 1.00108.68 H