>>4PJU:HELIX    9 AA9 VAL A  212  GLU A  251  1                                  40    
VRAFRHTSTLAAKLTALVNVALNLSINDNTQRQYEAE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 9 AA9 VAL A 212 GLU A 251 1 40 ATOM 2056 N VAL A 212 26.365 36.522 -11.642 1.00 40.84 N ANISOU 2056 N VAL A 212 4523 5527 5467 -471 166 -176 N ATOM 2057 CA VAL A 212 26.987 36.303 -12.925 1.00 42.38 C ANISOU 2057 CA VAL A 212 4695 5830 5579 -531 147 -63 C ATOM 2058 C VAL A 212 28.052 35.251 -12.691 1.00 47.11 C ANISOU 2058 C VAL A 212 5406 6459 6033 -521 191 -156 C ATOM 2059 O VAL A 212 28.984 35.472 -11.924 1.00 44.93 O ANISOU 2059 O VAL A 212 5166 6103 5803 -470 187 -219 O ATOM 2060 CB VAL A 212 27.617 37.572 -13.484 1.00 41.37 C ANISOU 2060 CB VAL A 212 4454 5667 5598 -539 74 67 C ATOM 2061 CG1 VAL A 212 28.087 37.335 -14.910 1.00 56.58 C ANISOU 2061 CG1 VAL A 212 6342 7739 7417 -626 57 194 C ATOM 2062 CG2 VAL A 212 26.612 38.702 -13.463 1.00 50.08 C ANISOU 2062 CG2 VAL A 212 5442 6692 6893 -529 19 143 C ATOM 2063 H VAL A 212 26.461 37.316 -11.325 1.00 49.01 H ATOM 2064 HA VAL A 212 26.337 35.963 -13.559 1.00 50.86 H ATOM 2065 HB VAL A 212 28.381 37.825 -12.942 1.00 49.64 H ATOM 2066 HG11 VAL A 212 28.485 38.151 -15.252 1.00 67.90 H ATOM 2067 HG12 VAL A 212 28.744 36.621 -14.911 1.00 67.90 H ATOM 2068 HG13 VAL A 212 27.325 37.084 -15.456 1.00 67.90 H ATOM 2069 HG21 VAL A 212 27.028 39.502 -13.821 1.00 60.09 H ATOM 2070 HG22 VAL A 212 25.847 38.455 -14.006 1.00 60.09 H ATOM 2071 HG23 VAL A 212 26.331 38.858 -12.547 1.00 60.09 H ATOM 2072 N ARG A 213 27.901 34.094 -13.323 1.00 49.29 N ANISOU 2072 N ARG A 213 5737 6846 6144 -570 231 -171 N ATOM 2073 CA ARG A 213 28.808 32.995 -13.036 1.00 51.98 C ANISOU 2073 CA ARG A 213 6184 7200 6367 -554 270 -274 C ATOM 2074 C ARG A 213 30.233 33.329 -13.485 1.00 49.25 C ANISOU 2074 C ARG A 213 5806 6869 6037 -551 248 -241 C ATOM 2075 O ARG A 213 31.193 33.029 -12.776 1.00 47.95 O ANISOU 2075 O ARG A 213 5705 6644 5871 -502 256 -325 O ATOM 2076 CB ARG A 213 28.326 31.674 -13.652 1.00 47.98 C ANISOU 2076 CB ARG A 213 5734 6799 5696 -608 316 -308 C ATOM 2077 CG ARG A 213 29.252 30.507 -13.336 1.00 47.85 C ANISOU 2077 CG ARG A 213 5820 6774 5585 -586 348 -420 C ATOM 2078 CD ARG A 213 28.763 29.223 -13.937 1.00 45.48 C ANISOU 2078 CD ARG A 213 5571 6564 5144 -638 390 -463 C ATOM 2079 NE ARG A 213 27.401 28.923 -13.520 1.00 47.96 N ANISOU 2079 NE ARG A 213 5918 6869 5434 -654 405 -477 N ATOM 2080 CZ ARG A 213 26.624 28.026 -14.117 1.00 54.65 C ANISOU 2080 CZ ARG A 213 6790 7801 6173 -713 436 -489 C ATOM 2081 NH1 ARG A 213 27.075 27.336 -15.161 1.00 57.10 N ANISOU 2081 NH1 ARG A 213 7093 8213 6391 -763 457 -499 N ATOM 2082 NH2 ARG A 213 25.392 27.825 -13.675 1.00 56.18 N ANISOU 2082 NH2 ARG A 213 7009 7984 6351 -728 448 -500 N ATOM 2083 H ARG A 213 27.296 33.923 -13.909 1.00 59.14 H ATOM 2084 HA ARG A 213 28.834 32.869 -12.075 1.00 62.38 H ATOM 2085 HB2 ARG A 213 27.447 31.464 -13.301 1.00 57.57 H ATOM 2086 HB3 ARG A 213 28.285 31.772 -14.616 1.00 57.57 H ATOM 2087 HG2 ARG A 213 30.133 30.693 -13.696 1.00 57.41 H ATOM 2088 HG3 ARG A 213 29.302 30.392 -12.374 1.00 57.41 H ATOM 2089 HD2 ARG A 213 28.776 29.297 -14.904 1.00 54.57 H ATOM 2090 HD3 ARG A 213 29.336 28.496 -13.648 1.00 54.57 H ATOM 2091 HE ARG A 213 27.053 29.410 -12.903 1.00 57.55 H ATOM 2092 HH11 ARG A 213 27.874 27.468 -15.451 1.00 68.53 H ATOM 2093 HH12 ARG A 213 26.568 26.757 -15.545 1.00 68.53 H ATOM 2094 HH21 ARG A 213 25.100 28.270 -13.000 1.00 67.41 H ATOM 2095 HH22 ARG A 213 24.888 27.244 -14.058 1.00 67.41 H ATOM 2096 N ALA A 214 30.372 33.962 -14.646 1.00 52.61 N ANISOU 2096 N ALA A 214 6130 7381 6478 -611 217 -113 N ATOM 2097 CA ALA A 214 31.703 34.308 -15.148 1.00 51.12 C ANISOU 2097 CA ALA A 214 5899 7228 6296 -623 197 -75 C ATOM 2098 C ALA A 214 32.460 35.182 -14.145 1.00 59.02 C ANISOU 2098 C ALA A 214 6898 8088 7438 -550 163 -98 C ATOM 2099 O ALA A 214 33.680 35.064 -14.014 1.00 65.68 O ANISOU 2099 O ALA A 214 7761 8925 8270 -527 165 -139 O ATOM 2100 CB ALA A 214 31.614 35.003 -16.484 1.00 43.95 C ANISOU 2100 CB ALA A 214 4871 6438 5390 -714 158 86 C ATOM 2101 H ALA A 214 29.723 34.201 -15.157 1.00 63.13 H ATOM 2102 HA ALA A 214 32.211 33.491 -15.272 1.00 61.34 H ATOM 2103 HB1 ALA A 214 32.510 35.218 -16.787 1.00 52.74 H ATOM 2104 HB2 ALA A 214 31.182 34.412 -17.119 1.00 52.74 H ATOM 2105 HB3 ALA A 214 31.096 35.816 -16.382 1.00 52.74 H ATOM 2106 N PHE A 215 31.747 36.050 -13.431 1.00 41.87 N ANISOU 2106 N PHE A 215 4698 5806 5403 -513 133 -83 N ATOM 2107 CA PHE A 215 32.388 36.804 -12.368 1.00 40.40 C ANISOU 2107 CA PHE A 215 4519 5487 5346 -445 108 -132 C ATOM 2108 C PHE A 215 32.681 35.906 -11.169 1.00 40.67 C ANISOU 2108 C PHE A 215 4676 5464 5314 -388 151 -289 C ATOM 2109 O PHE A 215 33.819 35.840 -10.711 1.00 46.06 O ANISOU 2109 O PHE A 215 5393 6109 5998 -354 147 -338 O ATOM 2110 CB PHE A 215 31.555 38.013 -11.936 1.00 37.43 C ANISOU 2110 CB PHE A 215 4065 5005 5151 -422 65 -90 C ATOM 2111 CG PHE A 215 31.459 39.089 -12.975 1.00 41.74 C ANISOU 2111 CG PHE A 215 4481 5573 5806 -473 -2 82 C ATOM 2112 CD1 PHE A 215 32.438 39.246 -13.944 1.00 49.75 C ANISOU 2112 CD1 PHE A 215 5450 6673 6779 -528 -29 182 C ATOM 2113 CD2 PHE A 215 30.379 39.945 -12.983 1.00 46.94 C ANISOU 2113 CD2 PHE A 215 5054 6168 6612 -472 -44 146 C ATOM 2114 CE1 PHE A 215 32.333 40.240 -14.903 1.00 58.37 C ANISOU 2114 CE1 PHE A 215 6420 7793 7966 -591 -101 359 C ATOM 2115 CE2 PHE A 215 30.263 40.932 -13.936 1.00 48.90 C ANISOU 2115 CE2 PHE A 215 5177 6427 6974 -524 -121 322 C ATOM 2116 CZ PHE A 215 31.241 41.084 -14.897 1.00 56.30 C ANISOU 2116 CZ PHE A 215 6076 7455 7859 -589 -153 437 C ATOM 2117 H PHE A 215 30.910 36.215 -13.540 1.00 50.24 H ATOM 2118 HA PHE A 215 33.237 37.138 -12.698 1.00 48.49 H ATOM 2119 HB2 PHE A 215 30.654 37.715 -11.734 1.00 44.91 H ATOM 2120 HB3 PHE A 215 31.957 38.402 -11.143 1.00 44.91 H ATOM 2121 HD1 PHE A 215 33.173 38.676 -13.952 1.00 59.70 H ATOM 2122 HD2 PHE A 215 29.713 39.848 -12.341 1.00 56.32 H ATOM 2123 HE1 PHE A 215 32.994 40.337 -15.549 1.00 70.05 H ATOM 2124 HE2 PHE A 215 29.528 41.502 -13.927 1.00 58.68 H ATOM 2125 HZ PHE A 215 31.166 41.755 -15.536 1.00 67.56 H ATOM 2126 N ARG A 216 31.673 35.209 -10.664 1.00 46.37 N ANISOU 2126 N ARG A 216 5461 6182 5975 -383 188 -359 N ATOM 2127 CA ARG A 216 31.857 34.414 -9.457 1.00 46.52 C ANISOU 2127 CA ARG A 216 5593 6146 5935 -343 217 -491 C ATOM 2128 C ARG A 216 32.972 33.394 -9.629 1.00 41.98 C ANISOU 2128 C ARG A 216 5087 5609 5255 -339 231 -533 C ATOM 2129 O ARG A 216 33.823 33.235 -8.761 1.00 49.07 O ANISOU 2129 O ARG A 216 6040 6444 6162 -298 223 -601 O ATOM 2130 CB ARG A 216 30.555 33.725 -9.062 1.00 41.54 C ANISOU 2130 CB ARG A 216 5015 5531 5236 -359 254 -544 C ATOM 2131 CG ARG A 216 30.548 33.333 -7.613 1.00 44.32 C ANISOU 2131 CG ARG A 216 5458 5815 5568 -327 270 -662 C ATOM 2132 CD ARG A 216 29.154 33.059 -7.075 1.00 42.26 C ANISOU 2132 CD ARG A 216 5219 5561 5275 -347 301 -710 C ATOM 2133 NE ARG A 216 28.634 31.814 -7.621 1.00 41.69 N ANISOU 2133 NE ARG A 216 5209 5569 5064 -390 331 -707 N ATOM 2134 CZ ARG A 216 27.930 31.718 -8.742 1.00 43.49 C ANISOU 2134 CZ ARG A 216 5386 5874 5264 -431 339 -633 C ATOM 2135 NH1 ARG A 216 27.631 32.800 -9.453 1.00 40.20 N ANISOU 2135 NH1 ARG A 216 4854 5467 4953 -436 313 -541 N ATOM 2136 NH2 ARG A 216 27.520 30.525 -9.144 1.00 48.62 N ANISOU 2136 NH2 ARG A 216 6099 6590 5784 -471 367 -649 N ATOM 2137 H ARG A 216 30.880 35.178 -10.996 1.00 55.64 H ATOM 2138 HA ARG A 216 32.109 35.006 -8.731 1.00 55.82 H ATOM 2139 HB2 ARG A 216 29.813 34.331 -9.215 1.00 49.85 H ATOM 2140 HB3 ARG A 216 30.445 32.921 -9.594 1.00 49.85 H ATOM 2141 HG2 ARG A 216 31.075 32.525 -7.503 1.00 53.19 H ATOM 2142 HG3 ARG A 216 30.934 34.053 -7.090 1.00 53.19 H ATOM 2143 HD2 ARG A 216 29.189 32.980 -6.109 1.00 50.71 H ATOM 2144 HD3 ARG A 216 28.559 33.780 -7.335 1.00 50.71 H ATOM 2145 HE ARG A 216 28.796 31.089 -7.187 1.00 50.03 H ATOM 2146 HH11 ARG A 216 27.900 33.574 -9.192 1.00 48.24 H ATOM 2147 HH12 ARG A 216 27.172 32.725 -10.176 1.00 48.24 H ATOM 2148 HH21 ARG A 216 27.711 29.826 -8.681 1.00 58.34 H ATOM 2149 HH22 ARG A 216 27.058 30.450 -9.865 1.00 58.34 H ATOM 2150 N HIS A 217 32.984 32.725 -10.767 1.00 39.47 N ANISOU 2150 N HIS A 217 4759 5397 4843 -384 251 -496 N ATOM 2151 CA HIS A 217 33.978 31.705 -11.023 1.00 43.45 C ANISOU 2151 CA HIS A 217 5313 5937 5259 -380 268 -551 C ATOM 2152 C HIS A 217 35.392 32.333 -11.155 1.00 47.82 C ANISOU 2152 C HIS A 217 5816 6478 5876 -357 240 -529 C ATOM 2153 O HIS A 217 36.305 31.964 -10.410 1.00 38.59 O ANISOU 2153 O HIS A 217 4702 5248 4713 -310 232 -601 O ATOM 2154 CB HIS A 217 33.524 30.912 -12.251 1.00 43.19 C ANISOU 2154 CB HIS A 217 5266 6031 5116 -443 302 -530 C ATOM 2155 CG HIS A 217 34.467 29.840 -12.685 1.00 43.47 C ANISOU 2155 CG HIS A 217 5334 6113 5070 -444 326 -601 C ATOM 2156 ND1 HIS A 217 34.154 28.953 -13.694 1.00 47.17 N ANISOU 2156 ND1 HIS A 217 5798 6692 5433 -500 363 -619 N ATOM 2157 CD2 HIS A 217 35.712 29.511 -12.273 1.00 50.65 C ANISOU 2157 CD2 HIS A 217 6271 6975 5998 -396 317 -666 C ATOM 2158 CE1 HIS A 217 35.159 28.128 -13.880 1.00 52.39 C ANISOU 2158 CE1 HIS A 217 6480 7367 6060 -483 380 -702 C ATOM 2159 NE2 HIS A 217 36.124 28.442 -13.029 1.00 52.74 N ANISOU 2159 NE2 HIS A 217 6544 7315 6182 -418 350 -728 N ATOM 2160 H HIS A 217 32.424 32.843 -11.410 1.00 47.37 H ATOM 2161 HA HIS A 217 33.997 31.095 -10.269 1.00 52.14 H ATOM 2162 HB2 HIS A 217 32.673 30.491 -12.050 1.00 51.83 H ATOM 2163 HB3 HIS A 217 33.416 31.526 -12.994 1.00 51.83 H ATOM 2164 HD1 HIS A 217 33.415 28.943 -14.134 1.00 56.60 H ATOM 2165 HD2 HIS A 217 36.199 29.931 -11.602 1.00 60.78 H ATOM 2166 HE1 HIS A 217 35.187 27.437 -14.502 1.00 62.87 H ATOM 2167 HE2 HIS A 217 36.881 28.041 -12.959 1.00 63.29 H ATOM 2168 N THR A 218 35.569 33.297 -12.057 1.00 41.19 N ANISOU 2168 N THR A 218 4871 5693 5086 -394 217 -423 N ATOM 2169 CA THR A 218 36.879 33.920 -12.267 1.00 37.32 C ANISOU 2169 CA THR A 218 4325 5205 4650 -386 189 -392 C ATOM 2170 C THR A 218 37.458 34.587 -11.005 1.00 43.25 C ANISOU 2170 C THR A 218 5101 5821 5511 -320 156 -432 C ATOM 2171 O THR A 218 38.635 34.399 -10.677 1.00 48.35 O ANISOU 2171 O THR A 218 5766 6445 6160 -288 149 -479 O ATOM 2172 CB THR A 218 36.820 34.960 -13.410 1.00 34.98 C ANISOU 2172 CB THR A 218 3906 4990 4397 -453 159 -247 C ATOM 2173 OG1 THR A 218 36.546 34.303 -14.650 1.00 36.61 O ANISOU 2173 OG1 THR A 218 4083 5349 4480 -528 191 -216 O ATOM 2174 CG2 THR A 218 38.145 35.697 -13.548 1.00 43.91 C ANISOU 2174 CG2 THR A 218 4976 6117 5590 -451 126 -208 C ATOM 2175 H THR A 218 34.947 33.609 -12.562 1.00 49.43 H ATOM 2176 HA THR A 218 37.503 33.229 -12.538 1.00 44.78 H ATOM 2177 HB THR A 218 36.123 35.609 -13.225 1.00 41.98 H ATOM 2178 HG1 THR A 218 35.809 33.902 -14.606 1.00 43.94 H ATOM 2179 HG21 THR A 218 38.090 36.344 -14.269 1.00 52.69 H ATOM 2180 HG22 THR A 218 38.353 36.161 -12.722 1.00 52.69 H ATOM 2181 HG23 THR A 218 38.856 35.067 -13.744 1.00 52.69 H ATOM 2182 N SER A 219 36.646 35.370 -10.305 1.00 37.99 N ANISOU 2182 N SER A 219 4426 5070 4938 -303 137 -420 N ATOM 2183 CA SER A 219 37.113 36.022 -9.090 1.00 33.38 C ANISOU 2183 CA SER A 219 3861 4367 4454 -250 110 -473 C ATOM 2184 C SER A 219 37.475 35.005 -8.010 1.00 27.71 C ANISOU 2184 C SER A 219 3258 3609 3663 -210 129 -593 C ATOM 2185 O SER A 219 38.385 35.239 -7.227 1.00 32.70 O ANISOU 2185 O SER A 219 3909 4178 4336 -175 106 -636 O ATOM 2186 CB SER A 219 36.071 37.019 -8.570 1.00 38.29 C ANISOU 2186 CB SER A 219 4442 4912 5195 -243 93 -459 C ATOM 2187 OG SER A 219 34.867 36.368 -8.210 1.00 39.34 O ANISOU 2187 OG SER A 219 4629 5054 5265 -247 129 -512 O ATOM 2188 H SER A 219 35.828 35.539 -10.510 1.00 45.59 H ATOM 2189 HA SER A 219 37.916 36.523 -9.299 1.00 40.05 H ATOM 2190 HB2 SER A 219 36.429 37.470 -7.790 1.00 45.95 H ATOM 2191 HB3 SER A 219 35.881 37.666 -9.268 1.00 45.95 H ATOM 2192 HG SER A 219 34.543 35.973 -8.877 1.00 47.21 H ATOM 2193 N THR A 220 36.771 33.881 -7.965 1.00 32.22 N ANISOU 2193 N THR A 220 3902 4213 4127 -221 164 -640 N ATOM 2194 CA THR A 220 37.059 32.875 -6.952 1.00 33.76 C ANISOU 2194 CA THR A 220 4204 4365 4256 -195 169 -735 C ATOM 2195 C THR A 220 38.397 32.213 -7.248 1.00 35.50 C ANISOU 2195 C THR A 220 4440 4604 4446 -175 159 -755 C ATOM 2196 O THR A 220 39.200 32.011 -6.342 1.00 31.69 O ANISOU 2196 O THR A 220 4004 4060 3977 -140 133 -806 O ATOM 2197 CB THR A 220 35.946 31.821 -6.861 1.00 28.27 C ANISOU 2197 CB THR A 220 3581 3698 3462 -220 202 -771 C ATOM 2198 OG1 THR A 220 34.710 32.477 -6.585 1.00 39.68 O ANISOU 2198 OG1 THR A 220 5000 5133 4945 -237 213 -759 O ATOM 2199 CG2 THR A 220 36.234 30.828 -5.745 1.00 26.34 C ANISOU 2199 CG2 THR A 220 3446 3403 3159 -202 193 -852 C ATOM 2200 H THR A 220 36.131 33.678 -8.501 1.00 38.66 H ATOM 2201 HA THR A 220 37.127 33.311 -6.088 1.00 40.51 H ATOM 2202 HB THR A 220 35.882 31.338 -7.700 1.00 33.93 H ATOM 2203 HG1 THR A 220 34.530 33.022 -7.198 1.00 47.62 H ATOM 2204 HG21 THR A 220 35.525 30.168 -5.698 1.00 31.61 H ATOM 2205 HG22 THR A 220 37.075 30.375 -5.914 1.00 31.61 H ATOM 2206 HG23 THR A 220 36.290 31.291 -4.895 1.00 31.61 H ATOM 2207 N LEU A 221 38.643 31.879 -8.510 1.00 40.84 N ANISOU 2207 N LEU A 221 5068 5370 5080 -200 179 -720 N ATOM 2208 CA LEU A 221 39.950 31.363 -8.894 1.00 41.45 C ANISOU 2208 CA LEU A 221 5134 5474 5142 -182 175 -749 C ATOM 2209 C LEU A 221 41.026 32.381 -8.532 1.00 45.35 C ANISOU 2209 C LEU A 221 5577 5925 5730 -155 136 -725 C ATOM 2210 O LEU A 221 41.980 32.055 -7.828 1.00 46.55 O ANISOU 2210 O LEU A 221 5765 6023 5899 -114 112 -778 O ATOM 2211 CB LEU A 221 40.017 31.059 -10.393 1.00 43.01 C ANISOU 2211 CB LEU A 221 5263 5798 5280 -229 209 -719 C ATOM 2212 CG LEU A 221 41.307 30.342 -10.817 1.00 39.83 C ANISOU 2212 CG LEU A 221 4843 5434 4856 -211 216 -780 C ATOM 2213 CD1 LEU A 221 41.293 28.944 -10.264 1.00 42.55 C ANISOU 2213 CD1 LEU A 221 5283 5723 5161 -176 222 -879 C ATOM 2214 CD2 LEU A 221 41.500 30.314 -12.330 1.00 39.21 C ANISOU 2214 CD2 LEU A 221 4671 5506 4721 -273 253 -751 C ATOM 2215 H LEU A 221 38.078 31.941 -9.156 1.00 49.01 H ATOM 2216 HA LEU A 221 40.128 30.543 -8.407 1.00 49.74 H ATOM 2217 HB2 LEU A 221 39.268 30.489 -10.631 1.00 51.61 H ATOM 2218 HB3 LEU A 221 39.965 31.893 -10.885 1.00 51.61 H ATOM 2219 HG LEU A 221 42.065 30.807 -10.430 1.00 47.79 H ATOM 2220 HD11 LEU A 221 42.108 28.491 -10.532 1.00 51.06 H ATOM 2221 HD12 LEU A 221 41.242 28.988 -9.297 1.00 51.06 H ATOM 2222 HD13 LEU A 221 40.522 28.473 -10.616 1.00 51.06 H ATOM 2223 HD21 LEU A 221 42.327 29.850 -12.534 1.00 47.05 H ATOM 2224 HD22 LEU A 221 40.751 29.849 -12.735 1.00 47.05 H ATOM 2225 HD23 LEU A 221 41.541 31.225 -12.660 1.00 47.05 H ATOM 2226 N ALA A 222 40.871 33.612 -9.018 1.00 45.87 N ANISOU 2226 N ALA A 222 5556 6011 5862 -183 123 -639 N ATOM 2227 CA ALA A 222 41.813 34.680 -8.687 1.00 35.07 C ANISOU 2227 CA ALA A 222 4134 4596 4594 -165 83 -609 C ATOM 2228 C ALA A 222 42.016 34.799 -7.181 1.00 30.56 C ANISOU 2228 C ALA A 222 3633 3911 4069 -117 57 -678 C ATOM 2229 O ALA A 222 43.144 34.850 -6.710 1.00 39.96 O ANISOU 2229 O ALA A 222 4826 5068 5287 -88 30 -707 O ATOM 2230 CB ALA A 222 41.344 36.005 -9.254 1.00 31.70 C ANISOU 2230 CB ALA A 222 3613 4178 4252 -204 62 -501 C ATOM 2231 H ALA A 222 40.231 33.853 -9.539 1.00 55.05 H ATOM 2232 HA ALA A 222 42.672 34.474 -9.087 1.00 42.08 H ATOM 2233 HB1 ALA A 222 41.986 36.693 -9.020 1.00 38.04 H ATOM 2234 HB2 ALA A 222 41.277 35.929 -10.219 1.00 38.04 H ATOM 2235 HB3 ALA A 222 40.476 36.220 -8.877 1.00 38.04 H ATOM 2236 N ALA A 223 40.925 34.834 -6.426 1.00 34.71 N ANISOU 2236 N ALA A 223 4207 4387 4595 -117 64 -708 N ATOM 2237 CA ALA A 223 41.010 35.005 -4.984 1.00 33.37 C ANISOU 2237 CA ALA A 223 4095 4129 4454 -90 43 -778 C ATOM 2238 C ALA A 223 41.706 33.827 -4.321 1.00 35.64 C ANISOU 2238 C ALA A 223 4471 4403 4666 -67 33 -843 C ATOM 2239 O ALA A 223 42.440 33.997 -3.357 1.00 42.95 O ANISOU 2239 O ALA A 223 5423 5277 5620 -47 -1 -881 O ATOM 2240 CB ALA A 223 39.635 35.177 -4.403 1.00 34.78 C ANISOU 2240 CB ALA A 223 4300 4283 4632 -105 64 -807 C ATOM 2241 H ALA A 223 40.123 34.762 -6.726 1.00 41.66 H ATOM 2242 HA ALA A 223 41.522 35.806 -4.788 1.00 40.04 H ATOM 2243 HB1 ALA A 223 39.711 35.289 -3.443 1.00 41.74 H ATOM 2244 HB2 ALA A 223 39.223 35.961 -4.797 1.00 41.74 H ATOM 2245 HB3 ALA A 223 39.108 34.388 -4.604 1.00 41.74 H HETATM 2246 N MSE A 224 41.458 32.626 -4.818 1.00 40.32 N ANISOU 2246 N MSE A 224 5108 5040 5172 -73 56 -856 N HETATM 2247 CA MSE A 224 42.110 31.451 -4.257 1.00 37.18 C ANISOU 2247 CA MSE A 224 4787 4615 4724 -50 35 -909 C HETATM 2248 C MSE A 224 43.616 31.485 -4.501 1.00 34.17 C ANISOU 2248 C MSE A 224 4362 4233 4388 -16 6 -910 C HETATM 2249 O MSE A 224 44.406 31.149 -3.621 1.00 40.87 O ANISOU 2249 O MSE A 224 5252 5028 5248 10 -36 -943 O HETATM 2250 CB MSE A 224 41.508 30.174 -4.848 1.00 31.93 C ANISOU 2250 CB MSE A 224 4168 3989 3976 -64 64 -927 C HETATM 2251 CG MSE A 224 40.169 29.770 -4.275 1.00 32.13 C ANISOU 2251 CG MSE A 224 4265 4004 3940 -95 81 -943 C HETATM 2252 SE MSE A 224 40.100 29.669 -2.341 1.00 76.72 SE ANISOU 2252 SE MSE A 224 10007 9571 9570 -102 36 -989 SE HETATM 2253 CE MSE A 224 39.377 31.448 -2.056 1.00 32.92 C ANISOU 2253 CE MSE A 224 4385 4026 4099 -116 58 -980 C HETATM 2254 H MSE A 224 40.924 32.463 -5.472 1.00 48.39 H HETATM 2255 HA MSE A 224 41.951 31.436 -3.300 1.00 44.61 H HETATM 2256 HB2 MSE A 224 41.391 30.301 -5.802 1.00 38.32 H HETATM 2257 HB3 MSE A 224 42.125 29.442 -4.691 1.00 38.32 H HETATM 2258 HG2 MSE A 224 39.505 30.418 -4.558 1.00 38.56 H HETATM 2259 HG3 MSE A 224 39.937 28.894 -4.622 1.00 38.56 H HETATM 2260 HE1 MSE A 224 39.265 31.594 -1.103 1.00 39.51 H HETATM 2261 HE2 MSE A 224 39.994 32.101 -2.421 1.00 39.51 H HETATM 2262 HE3 MSE A 224 38.520 31.515 -2.504 1.00 39.51 H ATOM 2263 N LYS A 225 44.013 31.895 -5.700 1.00 27.97 N ANISOU 2263 N LYS A 225 3488 3516 3625 -25 27 -869 N ATOM 2264 CA LYS A 225 45.421 31.979 -6.035 1.00 27.65 C ANISOU 2264 CA LYS A 225 3390 3492 3623 -1 8 -872 C ATOM 2265 C LYS A 225 46.088 33.073 -5.220 1.00 33.35 C ANISOU 2265 C LYS A 225 4089 4157 4427 13 -35 -856 C ATOM 2266 O LYS A 225 47.173 32.889 -4.681 1.00 37.38 O ANISOU 2266 O LYS A 225 4606 4633 4964 45 -72 -885 O ATOM 2267 CB LYS A 225 45.595 32.269 -7.524 1.00 27.85 C ANISOU 2267 CB LYS A 225 3317 3627 3639 -34 44 -827 C ATOM 2268 CG LYS A 225 45.183 31.126 -8.428 1.00 30.00 C ANISOU 2268 CG LYS A 225 3598 3972 3829 -51 89 -862 C ATOM 2269 CD LYS A 225 45.813 29.814 -8.013 1.00 32.74 C ANISOU 2269 CD LYS A 225 4001 4274 4163 -5 77 -952 C ATOM 2270 CE LYS A 225 45.263 28.648 -8.792 1.00 45.40 C ANISOU 2270 CE LYS A 225 5622 5930 5697 -22 120 -1001 C ATOM 2271 NZ LYS A 225 45.926 27.391 -8.348 1.00 52.65 N ANISOU 2271 NZ LYS A 225 6588 6781 6635 29 96 -1088 N ATOM 2272 H LYS A 225 43.483 32.129 -6.336 1.00 33.57 H ATOM 2273 HA LYS A 225 45.854 31.136 -5.832 1.00 33.18 H ATOM 2274 HB2 LYS A 225 45.055 33.040 -7.757 1.00 33.42 H ATOM 2275 HB3 LYS A 225 46.530 32.460 -7.697 1.00 33.42 H ATOM 2276 HG2 LYS A 225 44.220 31.023 -8.392 1.00 36.00 H ATOM 2277 HG3 LYS A 225 45.464 31.322 -9.336 1.00 36.00 H ATOM 2278 HD2 LYS A 225 46.769 29.857 -8.168 1.00 39.28 H ATOM 2279 HD3 LYS A 225 45.634 29.660 -7.072 1.00 39.28 H ATOM 2280 HE2 LYS A 225 44.310 28.569 -8.631 1.00 54.48 H ATOM 2281 HE3 LYS A 225 45.440 28.774 -9.737 1.00 54.48 H ATOM 2282 HZ1 LYS A 225 45.604 26.699 -8.806 1.00 63.18 H ATOM 2283 HZ2 LYS A 225 46.804 27.445 -8.485 1.00 63.18 H ATOM 2284 HZ3 LYS A 225 45.777 27.258 -7.481 1.00 63.18 H ATOM 2285 N LEU A 226 45.414 34.212 -5.136 1.00 37.05 N ANISOU 2285 N LEU A 226 4525 4610 4941 -12 -33 -812 N ATOM 2286 CA LEU A 226 45.870 35.333 -4.337 1.00 32.27 C ANISOU 2286 CA LEU A 226 3897 3942 4424 -5 -71 -807 C ATOM 2287 C LEU A 226 46.145 34.866 -2.929 1.00 27.71 C ANISOU 2287 C LEU A 226 3405 3298 3827 17 -103 -876 C ATOM 2288 O LEU A 226 47.162 35.203 -2.333 1.00 29.81 O ANISOU 2288 O LEU A 226 3660 3531 4135 34 -143 -890 O ATOM 2289 CB LEU A 226 44.802 36.433 -4.340 1.00 42.16 C ANISOU 2289 CB LEU A 226 5113 5169 5738 -32 -62 -771 C ATOM 2290 CG LEU A 226 45.019 37.703 -3.511 1.00 36.87 C ANISOU 2290 CG LEU A 226 4411 4422 5177 -30 -96 -780 C ATOM 2291 CD1 LEU A 226 46.437 38.127 -3.611 1.00 31.86 C ANISOU 2291 CD1 LEU A 226 3727 3785 4592 -20 -132 -759 C ATOM 2292 CD2 LEU A 226 44.155 38.818 -4.044 1.00 33.63 C ANISOU 2292 CD2 LEU A 226 3923 3995 4859 -55 -92 -720 C ATOM 2293 H LEU A 226 44.672 34.361 -5.544 1.00 44.46 H ATOM 2294 HA LEU A 226 46.690 35.692 -4.713 1.00 38.73 H ATOM 2295 HB2 LEU A 226 44.682 36.721 -5.258 1.00 50.60 H ATOM 2296 HB3 LEU A 226 43.974 36.037 -4.026 1.00 50.60 H ATOM 2297 HG LEU A 226 44.797 37.541 -2.581 1.00 44.25 H ATOM 2298 HD11 LEU A 226 46.563 38.931 -3.084 1.00 38.23 H ATOM 2299 HD12 LEU A 226 47.003 37.416 -3.273 1.00 38.23 H ATOM 2300 HD13 LEU A 226 46.648 38.304 -4.541 1.00 38.23 H ATOM 2301 HD21 LEU A 226 44.303 39.614 -3.509 1.00 40.35 H ATOM 2302 HD22 LEU A 226 44.395 38.990 -4.967 1.00 40.35 H ATOM 2303 HD23 LEU A 226 43.224 38.550 -3.988 1.00 40.35 H HETATM 2304 N MSE A 227 45.265 34.052 -2.383 1.00 27.50 N ANISOU 2304 N MSE A 227 3462 3260 3728 10 -90 -914 N HETATM 2305 CA MSE A 227 45.491 33.690 -1.011 1.00 33.27 C ANISOU 2305 CA MSE A 227 4269 3941 4433 12 -128 -966 C HETATM 2306 C MSE A 227 46.638 32.731 -0.852 1.00 27.78 C ANISOU 2306 C MSE A 227 3600 3234 3720 43 -169 -977 C HETATM 2307 O MSE A 227 47.377 32.789 0.126 1.00 36.18 O ANISOU 2307 O MSE A 227 4688 4260 4797 48 -219 -997 O HETATM 2308 CB MSE A 227 44.273 33.116 -0.312 1.00 36.06 C ANISOU 2308 CB MSE A 227 4703 4288 4708 -18 -111 -1000 C HETATM 2309 CG MSE A 227 44.560 33.239 1.148 1.00 35.38 C ANISOU 2309 CG MSE A 227 4668 4165 4609 -35 -152 -1045 C HETATM 2310 SE MSE A 227 43.201 32.697 2.293 1.00 84.24 SE ANISOU 2310 SE MSE A 227 10951 10365 10692 -93 -138 -1095 SE HETATM 2311 CE MSE A 227 44.317 32.313 3.826 1.00 39.12 C ANISOU 2311 CE MSE A 227 5300 4625 4939 -115 -221 -1118 C HETATM 2312 H MSE A 227 44.569 33.715 -2.761 1.00 33.00 H HETATM 2313 HA MSE A 227 45.723 34.501 -0.533 1.00 39.93 H HETATM 2314 HB2 MSE A 227 43.483 33.634 -0.531 1.00 43.27 H HETATM 2315 HB3 MSE A 227 44.161 32.181 -0.541 1.00 43.27 H HETATM 2316 HG2 MSE A 227 45.341 32.702 1.352 1.00 42.46 H HETATM 2317 HG3 MSE A 227 44.749 34.170 1.344 1.00 42.46 H HETATM 2318 HE1 MSE A 227 43.757 32.004 4.555 1.00 46.95 H HETATM 2319 HE2 MSE A 227 44.958 31.626 3.586 1.00 46.95 H HETATM 2320 HE3 MSE A 227 44.783 33.123 4.087 1.00 46.95 H ATOM 2321 N THR A 228 46.778 31.824 -1.795 1.00 38.28 N ANISOU 2321 N THR A 228 4923 4598 5024 60 -150 -971 N ATOM 2322 CA THR A 228 47.897 30.915 -1.738 1.00 43.69 C ANISOU 2322 CA THR A 228 5615 5264 5719 97 -190 -991 C ATOM 2323 C THR A 228 49.198 31.728 -1.706 1.00 33.42 C ANISOU 2323 C THR A 228 4242 3962 4494 119 -221 -980 C ATOM 2324 O THR A 228 50.101 31.430 -0.938 1.00 28.65 O ANISOU 2324 O THR A 228 3657 3316 3913 141 -278 -994 O ATOM 2325 CB THR A 228 47.852 29.972 -2.909 1.00 40.31 C ANISOU 2325 CB THR A 228 5167 4881 5269 111 -153 -1004 C ATOM 2326 OG1 THR A 228 46.569 29.327 -2.947 1.00 48.09 O ANISOU 2326 OG1 THR A 228 6218 5870 6185 84 -123 -1010 O ATOM 2327 CG2 THR A 228 48.907 28.952 -2.774 1.00 28.58 C ANISOU 2327 CG2 THR A 228 3687 3359 3812 155 -197 -1039 C ATOM 2328 H THR A 228 46.251 31.714 -2.466 1.00 45.94 H ATOM 2329 HA THR A 228 47.844 30.392 -0.923 1.00 52.42 H ATOM 2330 HB THR A 228 47.997 30.464 -3.733 1.00 48.37 H ATOM 2331 HG1 THR A 228 46.533 28.797 -3.598 1.00 57.71 H ATOM 2332 HG21 THR A 228 48.878 28.344 -3.529 1.00 34.30 H ATOM 2333 HG22 THR A 228 49.778 29.378 -2.745 1.00 34.30 H ATOM 2334 HG23 THR A 228 48.776 28.446 -1.957 1.00 34.30 H ATOM 2335 N ALA A 229 49.242 32.794 -2.502 1.00 33.21 N ANISOU 2335 N ALA A 229 4131 3979 4507 105 -189 -945 N ATOM 2336 CA ALA A 229 50.384 33.697 -2.552 1.00 31.74 C ANISOU 2336 CA ALA A 229 3868 3797 4393 114 -215 -925 C ATOM 2337 C ALA A 229 50.632 34.371 -1.214 1.00 37.97 C ANISOU 2337 C ALA A 229 4690 4522 5215 108 -264 -939 C ATOM 2338 O ALA A 229 51.784 34.611 -0.836 1.00 49.98 O ANISOU 2338 O ALA A 229 6183 6028 6781 124 -307 -942 O ATOM 2339 CB ALA A 229 50.169 34.751 -3.610 1.00 33.70 C ANISOU 2339 CB ALA A 229 4027 4101 4676 83 -179 -868 C ATOM 2340 H ALA A 229 48.605 33.018 -3.035 1.00 39.85 H ATOM 2341 HA ALA A 229 51.178 33.192 -2.787 1.00 38.09 H ATOM 2342 HB1 ALA A 229 50.939 35.341 -3.628 1.00 40.44 H ATOM 2343 HB2 ALA A 229 50.065 34.316 -4.471 1.00 40.44 H ATOM 2344 HB3 ALA A 229 49.369 35.255 -3.396 1.00 40.44 H ATOM 2345 N LEU A 230 49.556 34.700 -0.507 1.00 35.65 N ANISOU 2345 N LEU A 230 4449 4199 4898 79 -254 -953 N ATOM 2346 CA LEU A 230 49.685 35.287 0.821 1.00 35.39 C ANISOU 2346 CA LEU A 230 4448 4118 4882 62 -292 -986 C ATOM 2347 C LEU A 230 50.215 34.281 1.838 1.00 35.24 C ANISOU 2347 C LEU A 230 4504 4076 4809 67 -347 -1012 C ATOM 2348 O LEU A 230 50.957 34.649 2.747 1.00 31.29 O ANISOU 2348 O LEU A 230 4006 3553 4328 59 -397 -1027 O ATOM 2349 CB LEU A 230 48.344 35.836 1.296 1.00 40.13 C ANISOU 2349 CB LEU A 230 5075 4705 5468 25 -260 -1013 C ATOM 2350 CG LEU A 230 47.829 37.067 0.557 1.00 42.57 C ANISOU 2350 CG LEU A 230 5302 5012 5863 16 -226 -984 C ATOM 2351 CD1 LEU A 230 46.444 37.428 1.084 1.00 38.27 C ANISOU 2351 CD1 LEU A 230 4782 4450 5310 -13 -194 -1027 C ATOM 2352 CD2 LEU A 230 48.805 38.238 0.683 1.00 36.52 C ANISOU 2352 CD2 LEU A 230 4463 4214 5199 17 -260 -973 C ATOM 2353 H LEU A 230 48.744 34.594 -0.772 1.00 42.78 H ATOM 2354 HA LEU A 230 50.311 36.026 0.778 1.00 42.47 H ATOM 2355 HB2 LEU A 230 47.677 35.139 1.197 1.00 48.16 H ATOM 2356 HB3 LEU A 230 48.426 36.073 2.233 1.00 48.16 H ATOM 2357 HG LEU A 230 47.742 36.853 -0.385 1.00 51.09 H ATOM 2358 HD11 LEU A 230 46.121 38.211 0.612 1.00 45.93 H ATOM 2359 HD12 LEU A 230 45.845 36.680 0.934 1.00 45.93 H ATOM 2360 HD13 LEU A 230 46.507 37.616 2.034 1.00 45.93 H ATOM 2361 HD21 LEU A 230 48.446 39.001 0.203 1.00 43.82 H ATOM 2362 HD22 LEU A 230 48.914 38.459 1.621 1.00 43.82 H ATOM 2363 HD23 LEU A 230 49.659 37.980 0.302 1.00 43.82 H ATOM 2364 N VAL A 231 49.837 33.016 1.699 1.00 33.40 N ANISOU 2364 N VAL A 231 4330 3848 4514 76 -346 -1012 N ATOM 2365 CA VAL A 231 50.355 32.003 2.600 1.00 33.55 C ANISOU 2365 CA VAL A 231 4415 3836 4497 79 -412 -1018 C ATOM 2366 C VAL A 231 51.874 31.921 2.474 1.00 39.04 C ANISOU 2366 C VAL A 231 5055 4518 5259 122 -463 -1007 C ATOM 2367 O VAL A 231 52.575 31.696 3.458 1.00 41.80 O ANISOU 2367 O VAL A 231 5432 4839 5609 116 -535 -1004 O ATOM 2368 CB VAL A 231 49.726 30.637 2.334 1.00 30.63 C ANISOU 2368 CB VAL A 231 4108 3460 4071 83 -407 -1015 C ATOM 2369 CG1 VAL A 231 50.298 29.592 3.278 1.00 31.51 C ANISOU 2369 CG1 VAL A 231 4282 3525 4164 82 -493 -1004 C ATOM 2370 CG2 VAL A 231 48.234 30.724 2.522 1.00 35.69 C ANISOU 2370 CG2 VAL A 231 4800 4120 4640 35 -358 -1026 C ATOM 2371 H VAL A 231 49.291 32.725 1.102 1.00 40.09 H ATOM 2372 HA VAL A 231 50.144 32.256 3.512 1.00 40.26 H ATOM 2373 HB VAL A 231 49.908 30.364 1.421 1.00 36.76 H ATOM 2374 HG11 VAL A 231 49.883 28.736 3.090 1.00 37.81 H ATOM 2375 HG12 VAL A 231 51.256 29.533 3.140 1.00 37.81 H ATOM 2376 HG13 VAL A 231 50.110 29.857 4.193 1.00 37.81 H ATOM 2377 HG21 VAL A 231 47.843 29.852 2.352 1.00 42.82 H ATOM 2378 HG22 VAL A 231 48.046 30.998 3.434 1.00 42.82 H ATOM 2379 HG23 VAL A 231 47.875 31.375 1.900 1.00 42.82 H ATOM 2380 N ASN A 232 52.387 32.112 1.266 1.00 46.24 N ANISOU 2380 N ASN A 232 5884 5461 6225 158 -428 -999 N ATOM 2381 CA ASN A 232 53.823 32.065 1.056 1.00 40.41 C ANISOU 2381 CA ASN A 232 5078 4722 5553 198 -468 -997 C ATOM 2382 C ASN A 232 54.496 33.271 1.704 1.00 36.35 C ANISOU 2382 C ASN A 232 4528 4202 5082 178 -499 -989 C ATOM 2383 O ASN A 232 55.518 33.126 2.373 1.00 42.97 O ANISOU 2383 O ASN A 232 5361 5018 5949 192 -565 -989 O ATOM 2384 CB ASN A 232 54.144 31.984 -0.434 1.00 44.54 C ANISOU 2384 CB ASN A 232 5513 5302 6106 226 -413 -1000 C ATOM 2385 CG ASN A 232 55.516 31.416 -0.700 1.00 54.87 C ANISOU 2385 CG ASN A 232 6760 6613 7476 275 -449 -1020 C ATOM 2386 OD1 ASN A 232 55.659 30.394 -1.362 1.00 64.42 O ANISOU 2386 OD1 ASN A 232 7953 7831 8692 309 -434 -1054 O ATOM 2387 ND2 ASN A 232 56.537 32.084 -0.191 1.00 60.50 N ANISOU 2387 ND2 ASN A 232 7431 7317 8239 279 -495 -1008 N ATOM 2388 H ASN A 232 51.928 32.270 0.557 1.00 55.49 H ATOM 2389 HA ASN A 232 54.175 31.266 1.479 1.00 48.49 H ATOM 2390 HB2 ASN A 232 53.492 31.412 -0.868 1.00 53.44 H ATOM 2391 HB3 ASN A 232 54.110 32.876 -0.815 1.00 53.44 H ATOM 2392 HD21 ASN A 232 57.340 31.801 -0.314 1.00 72.60 H ATOM 2393 HD22 ASN A 232 56.399 32.801 0.263 1.00 72.60 H ATOM 2394 N VAL A 233 53.918 34.456 1.522 1.00 29.82 N ANISOU 2394 N VAL A 233 3673 3389 4267 146 -457 -981 N ATOM 2395 CA VAL A 233 54.424 35.665 2.179 1.00 31.74 C ANISOU 2395 CA VAL A 233 3883 3615 4560 121 -485 -984 C ATOM 2396 C VAL A 233 54.392 35.511 3.700 1.00 36.83 C ANISOU 2396 C VAL A 233 4605 4228 5161 91 -540 -1014 C ATOM 2397 O VAL A 233 55.367 35.828 4.392 1.00 42.01 O ANISOU 2397 O VAL A 233 5244 4873 5844 84 -596 -1018 O ATOM 2398 CB VAL A 233 53.608 36.901 1.791 1.00 29.83 C ANISOU 2398 CB VAL A 233 3603 3375 4356 91 -436 -976 C ATOM 2399 CG1 VAL A 233 54.133 38.122 2.484 1.00 30.19 C ANISOU 2399 CG1 VAL A 233 3612 3390 4468 65 -467 -990 C ATOM 2400 CG2 VAL A 233 53.655 37.107 0.298 1.00 36.67 C ANISOU 2400 CG2 VAL A 233 4389 4288 5255 102 -391 -927 C ATOM 2401 H VAL A 233 53.230 34.590 1.023 1.00 35.78 H ATOM 2402 HA VAL A 233 55.344 35.812 1.909 1.00 38.08 H ATOM 2403 HB VAL A 233 52.683 36.773 2.054 1.00 35.79 H ATOM 2404 HG11 VAL A 233 53.599 38.888 2.220 1.00 36.23 H ATOM 2405 HG12 VAL A 233 54.074 37.991 3.443 1.00 36.23 H ATOM 2406 HG13 VAL A 233 55.058 38.258 2.224 1.00 36.23 H ATOM 2407 HG21 VAL A 233 53.134 37.893 0.072 1.00 44.00 H ATOM 2408 HG22 VAL A 233 54.578 37.232 0.026 1.00 44.00 H ATOM 2409 HG23 VAL A 233 53.284 36.325 -0.140 1.00 44.00 H ATOM 2410 N ALA A 234 53.261 35.030 4.204 1.00 32.72 N ANISOU 2410 N ALA A 234 4164 3703 4565 62 -523 -1034 N ATOM 2411 CA ALA A 234 53.115 34.683 5.607 1.00 30.51 C ANISOU 2411 CA ALA A 234 3962 3416 4216 16 -574 -1058 C ATOM 2412 C ALA A 234 54.262 33.800 6.082 1.00 31.71 C ANISOU 2412 C ALA A 234 4130 3553 4366 34 -659 -1028 C ATOM 2413 O ALA A 234 54.789 33.993 7.174 1.00 44.05 O ANISOU 2413 O ALA A 234 5711 5116 5910 -4 -721 -1034 O ATOM 2414 CB ALA A 234 51.802 33.972 5.810 1.00 30.28 C ANISOU 2414 CB ALA A 234 4011 3395 4098 -14 -543 -1069 C ATOM 2415 H ALA A 234 52.549 34.894 3.741 1.00 39.26 H ATOM 2416 HA ALA A 234 53.111 35.493 6.140 1.00 36.62 H ATOM 2417 HB1 ALA A 234 51.709 33.743 6.748 1.00 36.33 H ATOM 2418 HB2 ALA A 234 51.080 34.561 5.540 1.00 36.33 H ATOM 2419 HB3 ALA A 234 51.792 33.167 5.269 1.00 36.33 H ATOM 2420 N LEU A 235 54.636 32.822 5.262 1.00 36.28 N ANISOU 2420 N LEU A 235 4694 4119 4970 90 -666 -1001 N ATOM 2421 CA LEU A 235 55.655 31.843 5.637 1.00 35.34 C ANISOU 2421 CA LEU A 235 4584 3971 4874 119 -752 -973 C ATOM 2422 C LEU A 235 57.038 32.454 5.731 1.00 39.08 C ANISOU 2422 C LEU A 235 4980 4447 5423 140 -797 -967 C ATOM 2423 O LEU A 235 57.717 32.312 6.744 1.00 37.35 O ANISOU 2423 O LEU A 235 4779 4214 5197 118 -881 -950 O ATOM 2424 CB LEU A 235 55.682 30.711 4.622 1.00 31.50 C ANISOU 2424 CB LEU A 235 4084 3466 4419 179 -737 -968 C ATOM 2425 CG LEU A 235 56.524 29.483 4.967 1.00 32.23 C ANISOU 2425 CG LEU A 235 4186 3506 4553 215 -830 -944 C ATOM 2426 CD1 LEU A 235 56.476 29.146 6.442 1.00 33.18 C ANISOU 2426 CD1 LEU A 235 4388 3602 4616 155 -924 -904 C ATOM 2427 CD2 LEU A 235 55.998 28.309 4.177 1.00 32.17 C ANISOU 2427 CD2 LEU A 235 4198 3471 4553 251 -804 -956 C ATOM 2428 H LEU A 235 54.311 32.702 4.474 1.00 43.53 H ATOM 2429 HA LEU A 235 55.431 31.467 6.503 1.00 42.41 H ATOM 2430 HB2 LEU A 235 54.772 30.404 4.490 1.00 37.80 H ATOM 2431 HB3 LEU A 235 56.024 31.065 3.786 1.00 37.80 H ATOM 2432 HG LEU A 235 57.448 29.638 4.714 1.00 38.67 H ATOM 2433 HD11 LEU A 235 57.024 28.363 6.604 1.00 39.81 H ATOM 2434 HD12 LEU A 235 56.816 29.900 6.949 1.00 39.81 H ATOM 2435 HD13 LEU A 235 55.557 28.965 6.694 1.00 39.81 H ATOM 2436 HD21 LEU A 235 56.526 27.524 4.389 1.00 38.60 H ATOM 2437 HD22 LEU A 235 55.070 28.159 4.416 1.00 38.60 H ATOM 2438 HD23 LEU A 235 56.068 28.509 3.231 1.00 38.60 H ATOM 2439 N ASN A 236 57.457 33.120 4.661 1.00 38.53 N ANISOU 2439 N ASN A 236 4821 4401 5418 176 -743 -976 N ATOM 2440 CA ASN A 236 58.698 33.867 4.671 1.00 33.30 C ANISOU 2440 CA ASN A 236 4077 3750 4825 187 -775 -971 C ATOM 2441 C ASN A 236 58.770 34.782 5.879 1.00 43.06 C ANISOU 2441 C ASN A 236 5339 4983 6039 126 -813 -981 C ATOM 2442 O ASN A 236 59.813 34.918 6.513 1.00 47.99 O ANISOU 2442 O ASN A 236 5939 5603 6690 121 -882 -971 O ATOM 2443 CB ASN A 236 58.789 34.726 3.423 1.00 36.75 C ANISOU 2443 CB ASN A 236 4424 4226 5313 202 -701 -972 C ATOM 2444 CG ASN A 236 58.880 33.913 2.165 1.00 34.54 C ANISOU 2444 CG ASN A 236 4099 3974 5050 252 -659 -976 C ATOM 2445 OD1 ASN A 236 59.507 32.851 2.127 1.00 34.60 O ANISOU 2445 OD1 ASN A 236 4099 3965 5081 297 -697 -986 O ATOM 2446 ND2 ASN A 236 58.246 34.407 1.115 1.00 47.00 N ANISOU 2446 ND2 ASN A 236 5640 5595 6622 240 -581 -970 N ATOM 2447 H ASN A 236 57.033 33.153 3.914 1.00 46.24 H ATOM 2448 HA ASN A 236 59.452 33.257 4.691 1.00 39.96 H ATOM 2449 HB2 ASN A 236 57.996 35.283 3.364 1.00 44.10 H ATOM 2450 HB3 ASN A 236 59.582 35.282 3.479 1.00 44.10 H ATOM 2451 HD21 ASN A 236 58.262 33.986 0.366 1.00 56.40 H ATOM 2452 HD22 ASN A 236 57.818 35.150 1.182 1.00 56.40 H ATOM 2453 N LEU A 237 57.651 35.433 6.175 1.00 39.81 N ANISOU 2453 N LEU A 237 4969 4576 5582 77 -764 -1008 N ATOM 2454 CA LEU A 237 57.584 36.348 7.305 1.00 35.33 C ANISOU 2454 CA LEU A 237 4420 4012 4993 12 -786 -1042 C ATOM 2455 C LEU A 237 57.954 35.676 8.603 1.00 33.28 C ANISOU 2455 C LEU A 237 4223 3757 4665 -29 -874 -1034 C ATOM 2456 O LEU A 237 58.684 36.244 9.402 1.00 47.87 O ANISOU 2456 O LEU A 237 6054 5616 6521 -65 -924 -1046 O ATOM 2457 CB LEU A 237 56.183 36.943 7.439 1.00 41.75 C ANISOU 2457 CB LEU A 237 5267 4827 5769 -30 -718 -1089 C ATOM 2458 CG LEU A 237 56.067 38.435 7.147 1.00 37.49 C ANISOU 2458 CG LEU A 237 4659 4275 5312 -43 -674 -1121 C ATOM 2459 CD1 LEU A 237 54.613 38.878 7.166 1.00 36.40 C ANISOU 2459 CD1 LEU A 237 4545 4130 5156 -72 -607 -1168 C ATOM 2460 CD2 LEU A 237 56.888 39.223 8.147 1.00 39.59 C ANISOU 2460 CD2 LEU A 237 4904 4539 5599 -86 -726 -1157 C ATOM 2461 H LEU A 237 56.916 35.362 5.735 1.00 47.78 H ATOM 2462 HA LEU A 237 58.206 37.077 7.157 1.00 42.40 H ATOM 2463 HB2 LEU A 237 55.594 36.480 6.824 1.00 50.10 H ATOM 2464 HB3 LEU A 237 55.877 36.801 8.349 1.00 50.10 H ATOM 2465 HG LEU A 237 56.423 38.612 6.262 1.00 44.99 H ATOM 2466 HD11 LEU A 237 54.570 39.828 6.978 1.00 43.68 H ATOM 2467 HD12 LEU A 237 54.124 38.383 6.490 1.00 43.68 H ATOM 2468 HD13 LEU A 237 54.240 38.697 8.043 1.00 43.68 H ATOM 2469 HD21 LEU A 237 56.804 40.169 7.949 1.00 47.51 H ATOM 2470 HD22 LEU A 237 56.555 39.041 9.040 1.00 47.51 H ATOM 2471 HD23 LEU A 237 57.816 38.950 8.078 1.00 47.51 H ATOM 2472 N SER A 238 57.445 34.471 8.830 1.00 32.95 N ANISOU 2472 N SER A 238 4253 3709 4558 -31 -897 -1008 N ATOM 2473 CA SER A 238 57.656 33.833 10.114 1.00 38.38 C ANISOU 2473 CA SER A 238 5005 4408 5170 -90 -988 -983 C ATOM 2474 C SER A 238 59.106 33.404 10.210 1.00 41.70 C ANISOU 2474 C SER A 238 5380 4807 5656 -51 -1082 -933 C ATOM 2475 O SER A 238 59.706 33.437 11.284 1.00 44.79 O ANISOU 2475 O SER A 238 5786 5218 6016 -105 -1165 -913 O ATOM 2476 CB SER A 238 56.734 32.637 10.292 1.00 33.63 C ANISOU 2476 CB SER A 238 4489 3800 4490 -108 -998 -955 C ATOM 2477 OG SER A 238 57.129 31.579 9.448 1.00 45.43 O ANISOU 2477 OG SER A 238 5968 5246 6049 -29 -1019 -910 O ATOM 2478 H SER A 238 56.983 34.013 8.267 1.00 39.54 H ATOM 2479 HA SER A 238 57.476 34.468 10.824 1.00 46.06 H ATOM 2480 HB2 SER A 238 56.775 32.339 11.214 1.00 40.36 H ATOM 2481 HB3 SER A 238 55.827 32.900 10.068 1.00 40.36 H ATOM 2482 HG SER A 238 57.099 31.825 8.645 1.00 54.52 H ATOM 2483 N ILE A 239 59.669 33.017 9.073 1.00 41.53 N ANISOU 2483 N ILE A 239 5296 4755 5727 38 -1065 -917 N ATOM 2484 CA ILE A 239 61.063 32.622 9.012 1.00 35.80 C ANISOU 2484 CA ILE A 239 4508 4009 5086 88 -1144 -882 C ATOM 2485 C ILE A 239 61.966 33.823 9.340 1.00 37.29 C ANISOU 2485 C ILE A 239 4631 4227 5309 64 -1159 -899 C ATOM 2486 O ILE A 239 62.892 33.706 10.138 1.00 35.69 O ANISOU 2486 O ILE A 239 4417 4026 5117 45 -1254 -868 O ATOM 2487 CB ILE A 239 61.390 32.003 7.637 1.00 36.06 C ANISOU 2487 CB ILE A 239 4476 4018 5209 183 -1104 -887 C ATOM 2488 CG1 ILE A 239 60.748 30.619 7.534 1.00 34.50 C ANISOU 2488 CG1 ILE A 239 4341 3775 4992 205 -1123 -867 C ATOM 2489 CG2 ILE A 239 62.884 31.868 7.433 1.00 46.30 C ANISOU 2489 CG2 ILE A 239 5678 5305 6608 239 -1165 -874 C ATOM 2490 CD1 ILE A 239 60.788 30.018 6.155 1.00 34.26 C ANISOU 2490 CD1 ILE A 239 4254 3731 5032 286 -1063 -897 C ATOM 2491 H ILE A 239 59.259 32.976 8.318 1.00 49.83 H ATOM 2492 HA ILE A 239 61.223 31.942 9.686 1.00 42.96 H ATOM 2493 HB ILE A 239 61.027 32.572 6.941 1.00 43.28 H ATOM 2494 HG12 ILE A 239 61.215 30.014 8.132 1.00 41.40 H ATOM 2495 HG13 ILE A 239 59.818 30.687 7.798 1.00 41.40 H ATOM 2496 HG21 ILE A 239 63.050 31.477 6.561 1.00 55.56 H ATOM 2497 HG22 ILE A 239 63.290 32.748 7.484 1.00 55.56 H ATOM 2498 HG23 ILE A 239 63.247 31.296 8.127 1.00 55.56 H ATOM 2499 HD11 ILE A 239 60.363 29.147 6.179 1.00 41.11 H ATOM 2500 HD12 ILE A 239 60.313 30.602 5.543 1.00 41.11 H ATOM 2501 HD13 ILE A 239 61.713 29.928 5.877 1.00 41.11 H ATOM 2502 N ASN A 240 61.675 34.976 8.740 1.00 41.13 N ANISOU 2502 N ASN A 240 5076 4733 5817 61 -1073 -941 N ATOM 2503 CA ASN A 240 62.427 36.199 8.994 1.00 34.64 C ANISOU 2503 CA ASN A 240 4193 3932 5037 33 -1082 -961 C ATOM 2504 C ASN A 240 62.318 36.598 10.456 1.00 43.56 C ANISOU 2504 C ASN A 240 5378 5083 6092 -58 -1135 -981 C ATOM 2505 O ASN A 240 63.273 37.097 11.037 1.00 54.53 O ANISOU 2505 O ASN A 240 6729 6487 7502 -85 -1193 -979 O ATOM 2506 CB ASN A 240 61.908 37.337 8.112 1.00 42.10 C ANISOU 2506 CB ASN A 240 5092 4881 6024 35 -985 -994 C ATOM 2507 CG ASN A 240 62.948 38.432 7.883 1.00 52.93 C ANISOU 2507 CG ASN A 240 6369 6262 7478 32 -994 -995 C ATOM 2508 OD1 ASN A 240 64.152 38.175 7.861 1.00 50.64 O ANISOU 2508 OD1 ASN A 240 6025 5983 7232 59 -1051 -968 O ATOM 2509 ND2 ASN A 240 62.479 39.662 7.692 1.00 64.70 N ANISOU 2509 ND2 ASN A 240 7835 7745 9002 -2 -941 -1025 N ATOM 2510 H ASN A 240 61.036 35.075 8.173 1.00 49.35 H ATOM 2511 HA ASN A 240 63.363 36.051 8.785 1.00 41.57 H ATOM 2512 HB2 ASN A 240 61.657 36.977 7.247 1.00 50.52 H ATOM 2513 HB3 ASN A 240 61.137 37.741 8.539 1.00 50.52 H ATOM 2514 HD21 ASN A 240 63.023 40.314 7.559 1.00 77.64 H ATOM 2515 HD22 ASN A 240 61.631 39.805 7.703 1.00 77.64 H HETATM 2516 N MSE A 241 61.142 36.380 11.038 1.00 56.67 N ANISOU 2516 N MSE A 241 7122 6753 7655 -112 -1112 -1005 N HETATM 2517 CA MSE A 241 60.906 36.601 12.468 1.00 51.48 C ANISOU 2517 CA MSE A 241 6523 6139 6900 -214 -1157 -1033 C HETATM 2518 C MSE A 241 61.790 35.716 13.347 1.00 60.23 C ANISOU 2518 C MSE A 241 7652 7261 7971 -241 -1282 -963 C HETATM 2519 O MSE A 241 62.464 36.208 14.255 1.00 59.97 O ANISOU 2519 O MSE A 241 7605 7266 7914 -305 -1343 -971 O HETATM 2520 CB MSE A 241 59.459 36.275 12.799 1.00 60.45 C ANISOU 2520 CB MSE A 241 7740 7293 7934 -263 -1107 -1065 C HETATM 2521 CG MSE A 241 58.567 37.454 13.127 1.00 78.88 C ANISOU 2521 CG MSE A 241 10074 9653 10245 -322 -1028 -1166 C HETATM 2522 SE MSE A 241 56.697 37.046 12.704 1.00116.89 SE ANISOU 2522 SE MSE A 241 14952 14467 14995 -324 -927 -1200 SE HETATM 2523 CE MSE A 241 56.179 38.856 12.372 1.00 77.48 C ANISOU 2523 CE MSE A 241 9885 9454 10100 -328 -830 -1313 C HETATM 2524 H MSE A 241 60.447 36.096 10.618 1.00 68.00 H HETATM 2525 HA MSE A 241 61.068 37.534 12.682 1.00 61.78 H HETATM 2526 HB2 MSE A 241 59.068 35.821 12.036 1.00 72.54 H HETATM 2527 HB3 MSE A 241 59.448 35.682 13.566 1.00 72.54 H HETATM 2528 HG2 MSE A 241 58.630 37.653 14.075 1.00 94.66 H HETATM 2529 HG3 MSE A 241 58.840 38.222 12.601 1.00 94.66 H HETATM 2530 HE1 MSE A 241 55.239 38.876 12.134 1.00 92.98 H HETATM 2531 HE2 MSE A 241 56.329 39.379 13.175 1.00 92.98 H HETATM 2532 HE3 MSE A 241 56.714 39.208 11.643 1.00 92.98 H ATOM 2533 N ASP A 242 61.761 34.410 13.093 1.00 46.94 N ANISOU 2533 N ASP A 242 6001 5545 6289 -198 -1326 -894 N ATOM 2534 CA ASP A 242 62.589 33.473 13.836 1.00 47.61 C ANISOU 2534 CA ASP A 242 6099 5625 6365 -215 -1459 -811 C ATOM 2535 C ASP A 242 64.056 33.847 13.797 1.00 51.53 C ANISOU 2535 C ASP A 242 6506 6116 6956 -179 -1521 -791 C ATOM 2536 O ASP A 242 64.749 33.769 14.801 1.00 58.71 O ANISOU 2536 O ASP A 242 7419 7056 7834 -240 -1625 -748 O ATOM 2537 CB ASP A 242 62.423 32.073 13.270 1.00 59.15 C ANISOU 2537 CB ASP A 242 7583 7023 7866 -146 -1489 -748 C ATOM 2538 CG ASP A 242 61.093 31.469 13.624 1.00 76.13 C ANISOU 2538 CG ASP A 242 9834 9186 9908 -204 -1468 -741 C ATOM 2539 OD1 ASP A 242 60.163 32.249 13.931 1.00 71.93 O ANISOU 2539 OD1 ASP A 242 9337 8708 9286 -271 -1390 -808 O ATOM 2540 OD2 ASP A 242 60.980 30.224 13.599 1.00 95.31 O ANISOU 2540 OD2 ASP A 242 12300 11566 12347 -185 -1530 -673 O ATOM 2541 H ASP A 242 61.267 34.043 12.493 1.00 56.33 H ATOM 2542 HA ASP A 242 62.304 33.461 14.763 1.00 57.13 H ATOM 2543 HB2 ASP A 242 62.489 32.111 12.303 1.00 70.98 H ATOM 2544 HB3 ASP A 242 63.119 31.501 13.629 1.00 70.98 H ATOM 2545 N ASN A 243 64.543 34.214 12.624 1.00 52.07 N ANISOU 2545 N ASN A 243 6492 6156 7136 -88 -1461 -816 N ATOM 2546 CA ASN A 243 65.938 34.576 12.491 1.00 39.82 C ANISOU 2546 CA ASN A 243 4847 4606 5678 -53 -1511 -801 C ATOM 2547 C ASN A 243 66.236 35.846 13.256 1.00 49.50 C ANISOU 2547 C ASN A 243 6058 5883 6868 -135 -1515 -842 C ATOM 2548 O ASN A 243 67.220 35.927 13.984 1.00 62.64 O ANISOU 2548 O ASN A 243 7693 7570 8538 -169 -1608 -811 O ATOM 2549 CB ASN A 243 66.303 34.738 11.023 1.00 39.23 C ANISOU 2549 CB ASN A 243 4683 4508 5714 47 -1434 -825 C ATOM 2550 CG ASN A 243 66.367 33.413 10.303 1.00 38.54 C ANISOU 2550 CG ASN A 243 4585 4373 5687 134 -1449 -796 C ATOM 2551 OD1 ASN A 243 66.614 32.384 10.920 1.00 38.17 O ANISOU 2551 OD1 ASN A 243 4568 4292 5642 136 -1549 -741 O ATOM 2552 ND2 ASN A 243 66.134 33.428 8.998 1.00 45.66 N ANISOU 2552 ND2 ASN A 243 5439 5271 6638 200 -1353 -832 N ATOM 2553 H ASN A 243 64.089 34.261 11.896 1.00 62.48 H ATOM 2554 HA ASN A 243 66.486 33.867 12.860 1.00 47.79 H ATOM 2555 HB2 ASN A 243 65.633 35.287 10.586 1.00 47.07 H ATOM 2556 HB3 ASN A 243 67.174 35.160 10.956 1.00 47.07 H ATOM 2557 HD21 ASN A 243 66.160 32.695 8.548 1.00 54.79 H ATOM 2558 HD22 ASN A 243 65.956 34.170 8.601 1.00 54.79 H ATOM 2559 N THR A 244 65.371 36.835 13.103 1.00 41.94 N ANISOU 2559 N THR A 244 5117 4939 5878 -170 -1417 -915 N ATOM 2560 CA THR A 244 65.509 38.068 13.844 1.00 44.54 C ANISOU 2560 CA THR A 244 5433 5307 6181 -252 -1412 -975 C ATOM 2561 C THR A 244 65.411 37.813 15.346 1.00 49.31 C ANISOU 2561 C THR A 244 6105 5969 6662 -363 -1493 -970 C ATOM 2562 O THR A 244 66.155 38.393 16.127 1.00 52.88 O ANISOU 2562 O THR A 244 6530 6462 7099 -427 -1550 -984 O ATOM 2563 CB THR A 244 64.430 39.061 13.405 1.00 41.33 C ANISOU 2563 CB THR A 244 5033 4890 5780 -265 -1295 -1058 C ATOM 2564 OG1 THR A 244 64.444 39.154 11.980 1.00 45.55 O ANISOU 2564 OG1 THR A 244 5511 5384 6413 -174 -1228 -1042 O ATOM 2565 CG2 THR A 244 64.666 40.438 13.996 1.00 39.11 C ANISOU 2565 CG2 THR A 244 4717 4628 5513 -336 -1285 -1134 C ATOM 2566 H THR A 244 64.694 36.814 12.573 1.00 50.32 H ATOM 2567 HA THR A 244 66.377 38.459 13.658 1.00 53.44 H ATOM 2568 HB THR A 244 63.561 38.745 13.699 1.00 49.59 H ATOM 2569 HG1 THR A 244 64.289 38.401 11.642 1.00 54.66 H ATOM 2570 HG21 THR A 244 63.971 41.048 13.704 1.00 46.93 H ATOM 2571 HG22 THR A 244 64.655 40.388 14.965 1.00 46.93 H ATOM 2572 HG23 THR A 244 65.527 40.779 13.708 1.00 46.93 H ATOM 2573 N GLN A 245 64.496 36.943 15.753 1.00 56.76 N ANISOU 2573 N GLN A 245 7133 6924 7508 -397 -1501 -949 N ATOM 2574 CA GLN A 245 64.323 36.646 17.166 1.00 57.92 C ANISOU 2574 CA GLN A 245 7344 7145 7518 -520 -1578 -935 C ATOM 2575 C GLN A 245 65.598 36.014 17.741 1.00 64.70 C ANISOU 2575 C GLN A 245 8177 8014 8391 -531 -1723 -834 C ATOM 2576 O GLN A 245 66.072 36.417 18.798 1.00 76.28 O ANISOU 2576 O GLN A 245 9642 9551 9788 -632 -1789 -839 O ATOM 2577 CB GLN A 245 63.110 35.737 17.359 1.00 60.74 C ANISOU 2577 CB GLN A 245 7793 7512 7776 -551 -1562 -914 C ATOM 2578 CG GLN A 245 62.854 35.315 18.787 1.00 71.86 C ANISOU 2578 CG GLN A 245 9269 9011 9025 -694 -1644 -886 C ATOM 2579 CD GLN A 245 62.522 36.480 19.701 1.00 88.23 C ANISOU 2579 CD GLN A 245 11343 11179 11002 -814 -1599 -1005 C ATOM 2580 OE1 GLN A 245 62.149 37.566 19.248 1.00 84.41 O ANISOU 2580 OE1 GLN A 245 10822 10676 10573 -788 -1492 -1119 O ATOM 2581 NE2 GLN A 245 62.654 36.255 21.003 1.00 96.73 N ANISOU 2581 NE2 GLN A 245 12457 12359 11939 -953 -1686 -980 N ATOM 2582 H GLN A 245 63.964 36.512 15.232 1.00 68.11 H ATOM 2583 HA GLN A 245 64.157 37.473 17.645 1.00 69.51 H ATOM 2584 HB2 GLN A 245 62.320 36.204 17.045 1.00 72.89 H ATOM 2585 HB3 GLN A 245 63.241 34.931 16.834 1.00 72.89 H ATOM 2586 HG2 GLN A 245 62.105 34.699 18.804 1.00 86.24 H ATOM 2587 HG3 GLN A 245 63.649 34.880 19.134 1.00 86.24 H ATOM 2588 HE21 GLN A 245 62.914 35.484 21.282 1.00116.08 H ATOM 2589 HE22 GLN A 245 62.479 36.880 21.567 1.00116.08 H ATOM 2590 N ARG A 246 66.160 35.040 17.033 1.00 60.00 N ANISOU 2590 N ARG A 246 7554 7349 7894 -429 -1773 -748 N ATOM 2591 CA ARG A 246 67.401 34.405 17.458 1.00 57.83 C ANISOU 2591 CA ARG A 246 7238 7066 7667 -420 -1914 -650 C ATOM 2592 C ARG A 246 68.537 35.425 17.538 1.00 74.20 C ANISOU 2592 C ARG A 246 9225 9167 9800 -424 -1930 -682 C ATOM 2593 O ARG A 246 69.392 35.352 18.419 1.00 80.77 O ANISOU 2593 O ARG A 246 10038 10040 10609 -485 -2046 -627 O ATOM 2594 CB ARG A 246 67.776 33.274 16.499 1.00 48.96 C ANISOU 2594 CB ARG A 246 6080 5850 6673 -291 -1944 -584 C ATOM 2595 CG ARG A 246 67.266 31.908 16.939 1.00 56.19 C ANISOU 2595 CG ARG A 246 7070 6734 7546 -312 -2029 -492 C ATOM 2596 CD ARG A 246 67.616 30.821 15.944 1.00 49.06 C ANISOU 2596 CD ARG A 246 6124 5726 6791 -179 -2050 -450 C ATOM 2597 NE ARG A 246 67.188 31.183 14.599 1.00 51.07 N ANISOU 2597 NE ARG A 246 6345 5952 7107 -84 -1903 -540 N ATOM 2598 CZ ARG A 246 66.011 30.874 14.061 1.00 57.61 C ANISOU 2598 CZ ARG A 246 7234 6760 7895 -69 -1815 -572 C ATOM 2599 NH1 ARG A 246 65.098 30.171 14.734 1.00 63.62 N ANISOU 2599 NH1 ARG A 246 8094 7523 8557 -139 -1851 -527 N ATOM 2600 NH2 ARG A 246 65.748 31.273 12.828 1.00 54.53 N ANISOU 2600 NH2 ARG A 246 6801 6356 7562 10 -1690 -645 N ATOM 2601 H ARG A 246 65.840 34.727 16.299 1.00 72.00 H ATOM 2602 HA ARG A 246 67.277 34.023 18.341 1.00 69.39 H ATOM 2603 HB2 ARG A 246 67.398 33.466 15.626 1.00 58.75 H ATOM 2604 HB3 ARG A 246 68.742 33.225 16.436 1.00 58.75 H ATOM 2605 HG2 ARG A 246 67.667 31.678 17.792 1.00 67.43 H ATOM 2606 HG3 ARG A 246 66.300 31.941 17.023 1.00 67.43 H ATOM 2607 HD2 ARG A 246 68.577 30.692 15.934 1.00 58.87 H ATOM 2608 HD3 ARG A 246 67.168 29.999 16.195 1.00 58.87 H ATOM 2609 HE ARG A 246 67.740 31.631 14.115 1.00 61.28 H ATOM 2610 HH11 ARG A 246 65.262 29.910 15.537 1.00 76.35 H ATOM 2611 HH12 ARG A 246 64.344 29.982 14.366 1.00 76.35 H ATOM 2612 HH21 ARG A 246 66.333 31.724 12.388 1.00 65.44 H ATOM 2613 HH22 ARG A 246 64.993 31.078 12.464 1.00 65.44 H ATOM 2614 N GLN A 247 68.537 36.379 16.615 1.00 68.37 N ANISOU 2614 N GLN A 247 8432 8408 9138 -366 -1820 -762 N ATOM 2615 CA GLN A 247 69.523 37.452 16.623 1.00 55.53 C ANISOU 2615 CA GLN A 247 6724 6805 7571 -376 -1823 -798 C ATOM 2616 C GLN A 247 69.352 38.284 17.888 1.00 57.95 C ANISOU 2616 C GLN A 247 7067 7191 7762 -516 -1843 -853 C ATOM 2617 O GLN A 247 70.311 38.534 18.608 1.00 71.80 O ANISOU 2617 O GLN A 247 8784 8990 9506 -571 -1932 -830 O ATOM 2618 CB GLN A 247 69.371 38.324 15.367 1.00 54.94 C ANISOU 2618 CB GLN A 247 6591 6693 7592 -302 -1699 -865 C ATOM 2619 CG GLN A 247 70.668 38.879 14.794 1.00 68.75 C ANISOU 2619 CG GLN A 247 8227 8436 9458 -252 -1715 -856 C ATOM 2620 CD GLN A 247 71.773 37.844 14.718 1.00 78.38 C ANISOU 2620 CD GLN A 247 9393 9643 10744 -189 -1819 -771 C ATOM 2621 OE1 GLN A 247 71.656 36.843 14.010 1.00 90.87 O ANISOU 2621 OE1 GLN A 247 10969 11180 12376 -102 -1814 -737 O ATOM 2622 NE2 GLN A 247 72.839 38.060 15.483 1.00 77.66 N ANISOU 2622 NE2 GLN A 247 9258 9589 10660 -235 -1918 -740 N ATOM 2623 H GLN A 247 67.972 36.428 15.969 1.00 82.05 H ATOM 2624 HA GLN A 247 70.415 37.071 16.625 1.00 66.64 H ATOM 2625 HB2 GLN A 247 68.950 37.793 14.673 1.00 65.93 H ATOM 2626 HB3 GLN A 247 68.803 39.080 15.586 1.00 65.93 H ATOM 2627 HG2 GLN A 247 70.502 39.206 13.896 1.00 82.50 H ATOM 2628 HG3 GLN A 247 70.977 39.606 15.359 1.00 82.50 H ATOM 2629 HE21 GLN A 247 72.874 38.758 15.984 1.00 93.19 H ATOM 2630 HE22 GLN A 247 73.493 37.502 15.476 1.00 93.19 H ATOM 2631 N TYR A 248 68.119 38.688 18.164 1.00 75.18 N ANISOU 2631 N TYR A 248 9315 9397 9854 -577 -1760 -934 N ATOM 2632 CA TYR A 248 67.799 39.468 19.355 1.00 75.48 C ANISOU 2632 CA TYR A 248 9384 9519 9775 -717 -1761 -1016 C ATOM 2633 C TYR A 248 68.295 38.831 20.649 1.00 82.89 C ANISOU 2633 C TYR A 248 10355 10543 10597 -826 -1897 -943 C ATOM 2634 O TYR A 248 68.922 39.493 21.474 1.00 88.43 O ANISOU 2634 O TYR A 248 11029 11313 11256 -918 -1945 -976 O ATOM 2635 CB TYR A 248 66.293 39.649 19.451 1.00 73.96 C ANISOU 2635 CB TYR A 248 9259 9340 9501 -758 -1659 -1104 C ATOM 2636 CG TYR A 248 65.849 40.329 20.716 1.00 83.73 C ANISOU 2636 CG TYR A 248 10527 10678 10607 -910 -1653 -1207 C ATOM 2637 CD1 TYR A 248 65.823 41.715 20.803 1.00 84.85 C ANISOU 2637 CD1 TYR A 248 10622 10823 10795 -943 -1583 -1342 C ATOM 2638 CD2 TYR A 248 65.447 39.592 21.822 1.00 84.58 C ANISOU 2638 CD2 TYR A 248 10706 10883 10547 -1027 -1716 -1175 C ATOM 2639 CE1 TYR A 248 65.412 42.351 21.952 1.00 80.63 C ANISOU 2639 CE1 TYR A 248 10105 10383 10146 -1084 -1569 -1462 C ATOM 2640 CE2 TYR A 248 65.037 40.221 22.979 1.00 94.98 C ANISOU 2640 CE2 TYR A 248 12042 12314 11730 -1178 -1702 -1285 C ATOM 2641 CZ TYR A 248 65.020 41.603 23.038 1.00 89.38 C ANISOU 2641 CZ TYR A 248 11281 11606 11074 -1203 -1624 -1439 C ATOM 2642 OH TYR A 248 64.610 42.233 24.189 1.00 92.36 O ANISOU 2642 OH TYR A 248 11670 12101 11324 -1356 -1603 -1572 O ATOM 2643 H TYR A 248 67.437 38.520 17.669 1.00 90.22 H ATOM 2644 HA TYR A 248 68.204 40.346 19.277 1.00 90.57 H ATOM 2645 HB2 TYR A 248 65.994 40.188 18.703 1.00 88.75 H ATOM 2646 HB3 TYR A 248 65.870 38.776 19.419 1.00 88.75 H ATOM 2647 HD1 TYR A 248 66.086 42.223 20.069 1.00101.82 H ATOM 2648 HD2 TYR A 248 65.457 38.663 21.783 1.00101.50 H ATOM 2649 HE1 TYR A 248 65.401 43.280 21.994 1.00 96.75 H ATOM 2650 HE2 TYR A 248 64.770 39.719 23.715 1.00113.97 H ATOM 2651 HH TYR A 248 64.400 41.664 24.769 1.00110.84 H ATOM 2652 N GLU A 249 68.000 37.548 20.826 1.00 89.28 N ANISOU 2652 N GLU A 249 11220 11348 11353 -824 -1963 -839 N ATOM 2653 CA GLU A 249 68.392 36.829 22.032 1.00 88.83 C ANISOU 2653 CA GLU A 249 11198 11371 11184 -936 -2107 -742 C ATOM 2654 C GLU A 249 69.904 36.700 22.148 1.00 88.53 C ANISOU 2654 C GLU A 249 11082 11322 11232 -909 -2230 -653 C ATOM 2655 O GLU A 249 70.447 36.734 23.250 1.00 95.91 O ANISOU 2655 O GLU A 249 12017 12347 12076 -1028 -2336 -613 O ATOM 2656 CB GLU A 249 67.752 35.441 22.051 1.00 92.84 C ANISOU 2656 CB GLU A 249 11776 11852 11647 -927 -2158 -635 C ATOM 2657 CG GLU A 249 66.261 35.468 22.331 1.00105.55 C ANISOU 2657 CG GLU A 249 13470 13511 13122 -1003 -2065 -708 C ATOM 2658 CD GLU A 249 65.589 34.127 22.087 1.00115.85 C ANISOU 2658 CD GLU A 249 14840 14767 14411 -972 -2098 -607 C ATOM 2659 OE1 GLU A 249 66.255 33.207 21.562 1.00119.05 O ANISOU 2659 OE1 GLU A 249 15220 15080 14935 -873 -2181 -494 O ATOM 2660 OE2 GLU A 249 64.390 33.995 22.421 1.00112.02 O ANISOU 2660 OE2 GLU A 249 14427 14334 13802 -1048 -2041 -647 O ATOM 2661 H GLU A 249 67.570 37.068 20.257 1.00107.13 H ATOM 2662 HA GLU A 249 68.073 37.316 22.807 1.00106.60 H ATOM 2663 HB2 GLU A 249 67.885 35.022 21.187 1.00111.41 H ATOM 2664 HB3 GLU A 249 68.175 34.910 22.744 1.00111.41 H ATOM 2665 HG2 GLU A 249 66.118 35.710 23.259 1.00126.66 H ATOM 2666 HG3 GLU A 249 65.843 36.122 21.750 1.00126.66 H ATOM 2667 N ALA A 250 70.579 36.539 21.015 1.00 77.99 N ANISOU 2667 N ALA A 250 9677 9888 10069 -759 -2216 -625 N ATOM 2668 CA ALA A 250 72.033 36.442 21.011 1.00 84.51 C ANISOU 2668 CA ALA A 250 10415 10701 10996 -719 -2323 -553 C ATOM 2669 C ALA A 250 72.634 37.703 21.610 1.00 90.98 C ANISOU 2669 C ALA A 250 11190 11597 11780 -808 -2321 -628 C ATOM 2670 O ALA A 250 73.557 37.643 22.421 1.00101.52 O ANISOU 2670 O ALA A 250 12494 12989 13089 -877 -2443 -565 O ATOM 2671 CB ALA A 250 72.555 36.218 19.603 1.00 88.00 C ANISOU 2671 CB ALA A 250 10778 11040 11620 -549 -2278 -546 C ATOM 2672 H ALA A 250 70.219 36.484 20.236 1.00 93.59 H ATOM 2673 HA ALA A 250 72.304 35.688 21.558 1.00101.42 H ATOM 2674 HB1 ALA A 250 73.523 36.158 19.632 1.00105.61 H ATOM 2675 HB2 ALA A 250 72.182 35.393 19.256 1.00105.61 H ATOM 2676 HB3 ALA A 250 72.286 36.964 19.045 1.00105.61 H ATOM 2677 N GLU A 251 72.093 38.848 21.218 1.00 90.27 N ATOM 2678 CA GLU A 251 72.491 40.106 21.813 1.00 89.84 C ATOM 2679 C GLU A 251 71.804 40.292 23.159 1.00100.00 C ATOM 2680 O GLU A 251 70.946 41.154 23.324 1.00104.99 O ATOM 2681 CB GLU A 251 72.142 41.257 20.884 1.00 87.92 C ATOM 2682 CG GLU A 251 72.969 41.273 19.612 1.00 95.60 C ATOM 2683 CD GLU A 251 73.879 42.485 19.518 1.00107.34 C ATOM 2684 OE1 GLU A 251 73.483 43.576 19.983 1.00114.38 O ATOM 2685 OE2 GLU A 251 74.996 42.348 18.977 1.00119.82 O ATOM 2686 H GLU A 251 71.493 38.920 20.606 1.00108.32 H ATOM 2687 HA GLU A 251 73.451 40.107 21.956 1.00107.81 H ATOM 2688 HB2 GLU A 251 71.208 41.185 20.631 1.00105.50 H ATOM 2689 HB3 GLU A 251 72.294 42.095 21.349 1.00105.50 H ATOM 2690 HG2 GLU A 251 73.524 40.478 19.586 1.00114.72 H ATOM 2691 HG3 GLU A 251 72.372 41.287 18.847 1.00114.72 H