>>4PJW:HELIX   50 AF5 ALA A  998  SER A 1004  1                                   7    
AFLDILSEFSSKLLRQDKRTVYVYLEKFTFQSLRREVWLPLSYRNSLKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 50 AF5 ALA A 998 SER A 1004 1 7 ATOM 13623 N ALA A 998 7.684 1.468 -36.587 1.00 68.82 N ANISOU13623 N ALA A 998 6749 11641 7759 2044 984 -3144 N ATOM 13624 CA ALA A 998 6.909 0.863 -35.506 1.00 67.22 C ANISOU13624 CA ALA A 998 6640 11318 7582 2149 917 -3056 C ATOM 13625 C ALA A 998 5.407 0.810 -35.803 1.00 59.25 C ANISOU13625 C ALA A 998 5791 10173 6550 2083 928 -2969 C ATOM 13626 O ALA A 998 4.651 0.165 -35.074 1.00 55.12 O ANISOU13626 O ALA A 998 5358 9527 6059 2163 902 -2893 O ATOM 13627 CB ALA A 998 7.162 1.611 -34.203 1.00 68.77 C ANISOU13627 CB ALA A 998 6770 11595 7763 2200 794 -3040 C ATOM 13628 H ALA A 998 8.061 2.211 -36.374 1.00 82.59 H ATOM 13629 HA ALA A 998 7.214 -0.049 -35.383 1.00 80.66 H ATOM 13630 HB1 ALA A 998 6.641 1.198 -33.496 1.00 82.52 H ATOM 13631 HB2 ALA A 998 8.107 1.562 -33.989 1.00 82.52 H ATOM 13632 HB3 ALA A 998 6.894 2.537 -34.313 1.00 82.52 H ATOM 13633 N PHE A 999 4.974 1.478 -36.869 1.00 56.76 N ANISOU13633 N PHE A 999 5507 9882 6178 1942 972 -2979 N ATOM 13634 CA PHE A 999 3.551 1.554 -37.184 1.00 55.29 C ANISOU13634 CA PHE A 999 5458 9589 5961 1873 973 -2903 C ATOM 13635 C PHE A 999 2.994 0.210 -37.654 1.00 55.71 C ANISOU13635 C PHE A 999 5601 9511 6056 1920 1038 -2912 C ATOM 13636 O PHE A 999 1.778 0.025 -37.716 1.00 54.93 O ANISOU13636 O PHE A 999 5612 9305 5953 1892 1033 -2855 O ATOM 13637 CB PHE A 999 3.284 2.631 -38.240 1.00 54.92 C ANISOU13637 CB PHE A 999 5413 9619 5833 1721 1007 -2910 C ATOM 13638 CG PHE A 999 1.835 3.017 -38.356 1.00 53.30 C ANISOU13638 CG PHE A 999 5330 9332 5588 1651 984 -2823 C ATOM 13639 CD1 PHE A 999 1.191 3.656 -37.309 1.00 56.53 C ANISOU13639 CD1 PHE A 999 5775 9702 6002 1660 901 -2738 C ATOM 13640 CD2 PHE A 999 1.118 2.742 -39.508 1.00 53.36 C ANISOU13640 CD2 PHE A 999 5414 9311 5550 1583 1041 -2832 C ATOM 13641 CE1 PHE A 999 -0.141 4.011 -37.408 1.00 53.98 C ANISOU13641 CE1 PHE A 999 5559 9302 5646 1601 885 -2656 C ATOM 13642 CE2 PHE A 999 -0.214 3.097 -39.614 1.00 52.00 C ANISOU13642 CE2 PHE A 999 5343 9075 5341 1524 1015 -2757 C ATOM 13643 CZ PHE A 999 -0.843 3.732 -38.562 1.00 53.09 C ANISOU13643 CZ PHE A 999 5515 9164 5492 1532 941 -2665 C ATOM 13644 H PHE A 999 5.483 1.895 -37.424 1.00 68.11 H ATOM 13645 HA PHE A 999 3.070 1.805 -36.380 1.00 66.35 H ATOM 13646 HB2 PHE A 999 3.786 3.428 -38.008 1.00 65.90 H ATOM 13647 HB3 PHE A 999 3.574 2.300 -39.105 1.00 65.90 H ATOM 13648 HD1 PHE A 999 1.660 3.846 -36.529 1.00 67.84 H ATOM 13649 HD2 PHE A 999 1.537 2.314 -40.220 1.00 64.03 H ATOM 13650 HE1 PHE A 999 -0.562 4.439 -36.698 1.00 64.77 H ATOM 13651 HE2 PHE A 999 -0.686 2.907 -40.393 1.00 62.40 H ATOM 13652 HZ PHE A 999 -1.740 3.971 -38.632 1.00 63.71 H ATOM 13653 N LEU A1000 3.881 -0.728 -37.972 1.00 59.93 N ANISOU13653 N LEU A1000 6082 10050 6638 1993 1103 -2989 N ATOM 13654 CA LEU A1000 3.460 -2.021 -38.501 1.00 61.04 C ANISOU13654 CA LEU A1000 6296 10067 6830 2037 1179 -3023 C ATOM 13655 C LEU A1000 2.897 -2.934 -37.416 1.00 58.09 C ANISOU13655 C LEU A1000 5985 9536 6549 2158 1166 -2951 C ATOM 13656 O LEU A1000 2.147 -3.862 -37.715 1.00 65.17 O ANISOU13656 O LEU A1000 6964 10298 7498 2178 1222 -2957 O ATOM 13657 CB LEU A1000 4.618 -2.711 -39.233 1.00 64.05 C ANISOU13657 CB LEU A1000 6598 10501 7236 2079 1266 -3133 C ATOM 13658 CG LEU A1000 5.171 -2.000 -40.475 1.00 64.30 C ANISOU13658 CG LEU A1000 6573 10680 7179 1967 1313 -3208 C ATOM 13659 CD1 LEU A1000 6.177 -2.892 -41.190 1.00 64.04 C ANISOU13659 CD1 LEU A1000 6479 10674 7179 2026 1412 -3316 C ATOM 13660 CD2 LEU A1000 4.061 -1.579 -41.436 1.00 68.85 C ANISOU13660 CD2 LEU A1000 7242 11250 7668 1844 1321 -3198 C ATOM 13661 H LEU A1000 4.733 -0.641 -37.890 1.00 71.91 H ATOM 13662 HA LEU A1000 2.754 -1.871 -39.150 1.00 73.25 H ATOM 13663 HB2 LEU A1000 5.354 -2.810 -38.609 1.00 76.86 H ATOM 13664 HB3 LEU A1000 4.317 -3.589 -39.515 1.00 76.86 H ATOM 13665 HG LEU A1000 5.637 -1.197 -40.193 1.00 77.16 H ATOM 13666 HD11 LEU A1000 6.513 -2.424 -41.970 1.00 76.85 H ATOM 13667 HD12 LEU A1000 6.907 -3.093 -40.584 1.00 76.85 H ATOM 13668 HD13 LEU A1000 5.735 -3.712 -41.460 1.00 76.85 H ATOM 13669 HD21 LEU A1000 4.458 -1.136 -42.202 1.00 82.62 H ATOM 13670 HD22 LEU A1000 3.577 -2.369 -41.725 1.00 82.62 H ATOM 13671 HD23 LEU A1000 3.460 -0.972 -40.977 1.00 82.62 H ATOM 13672 N ASP A1001 3.245 -2.675 -36.160 1.00 68.60 N ANISOU13672 N ASP A1001 7275 10888 7902 2243 1096 -2886 N ATOM 13673 CA ASP A1001 2.696 -3.461 -35.063 1.00 75.05 C ANISOU13673 CA ASP A1001 8152 11565 8799 2365 1089 -2798 C ATOM 13674 C ASP A1001 1.267 -3.001 -34.799 1.00 82.31 C ANISOU13674 C ASP A1001 9179 12403 9692 2300 1047 -2709 C ATOM 13675 O ASP A1001 0.437 -3.763 -34.301 1.00 87.61 O ANISOU13675 O ASP A1001 9929 12922 10437 2364 1078 -2643 O ATOM 13676 CB ASP A1001 3.549 -3.317 -33.802 1.00 78.16 C ANISOU13676 CB ASP A1001 8462 12032 9202 2488 1019 -2761 C ATOM 13677 CG ASP A1001 3.343 -4.461 -32.823 1.00 88.00 C ANISOU13677 CG ASP A1001 9746 13140 10549 2650 1052 -2683 C ATOM 13678 OD1 ASP A1001 3.197 -5.620 -33.273 1.00 87.72 O ANISOU13678 OD1 ASP A1001 9748 12970 10613 2695 1163 -2704 O ATOM 13679 OD2 ASP A1001 3.330 -4.203 -31.601 1.00 91.69 O ANISOU13679 OD2 ASP A1001 10204 13634 10998 2738 971 -2602 O ATOM 13680 H ASP A1001 3.791 -2.057 -35.918 1.00 82.32 H ATOM 13681 HA ASP A1001 2.676 -4.398 -35.314 1.00 90.06 H ATOM 13682 HB2 ASP A1001 4.485 -3.301 -34.054 1.00 93.79 H ATOM 13683 HB3 ASP A1001 3.311 -2.490 -33.353 1.00 93.79 H ATOM 13684 N ILE A1002 0.994 -1.746 -35.142 1.00 74.90 N ANISOU13684 N ILE A1002 8239 11563 8658 2175 988 -2703 N ATOM 13685 CA ILE A1002 -0.359 -1.206 -35.109 1.00 66.99 C ANISOU13685 CA ILE A1002 7333 10498 7623 2096 956 -2628 C ATOM 13686 C ILE A1002 -1.110 -1.704 -36.335 1.00 68.19 C ANISOU13686 C ILE A1002 7550 10584 7775 2017 1026 -2680 C ATOM 13687 O ILE A1002 -2.243 -2.176 -36.239 1.00 65.35 O ANISOU13687 O ILE A1002 7278 10098 7456 2021 1043 -2638 O ATOM 13688 CB ILE A1002 -0.345 0.338 -35.114 1.00 63.40 C ANISOU13688 CB ILE A1002 6847 10170 7074 1992 881 -2607 C ATOM 13689 CG1 ILE A1002 0.358 0.868 -33.863 1.00 63.16 C ANISOU13689 CG1 ILE A1002 6745 10217 7036 2073 797 -2577 C ATOM 13690 CG2 ILE A1002 -1.765 0.901 -35.187 1.00 60.14 C ANISOU13690 CG2 ILE A1002 6533 9691 6627 1910 858 -2528 C ATOM 13691 CD1 ILE A1002 0.664 2.348 -33.919 1.00 61.05 C ANISOU13691 CD1 ILE A1002 6416 10083 6697 1976 740 -2593 C ATOM 13692 H ILE A1002 1.586 -1.178 -35.401 1.00 89.89 H ATOM 13693 HA ILE A1002 -0.819 -1.515 -34.312 1.00 80.39 H ATOM 13694 HB ILE A1002 0.146 0.639 -35.894 1.00 76.09 H ATOM 13695 HG12 ILE A1002 -0.211 0.711 -33.094 1.00 75.79 H ATOM 13696 HG13 ILE A1002 1.198 0.395 -33.753 1.00 75.79 H ATOM 13697 HG21 ILE A1002 -1.720 1.870 -35.189 1.00 72.17 H ATOM 13698 HG22 ILE A1002 -2.186 0.587 -36.003 1.00 72.17 H ATOM 13699 HG23 ILE A1002 -2.266 0.593 -34.416 1.00 72.17 H ATOM 13700 HD11 ILE A1002 1.107 2.610 -33.097 1.00 73.26 H ATOM 13701 HD12 ILE A1002 1.243 2.523 -34.678 1.00 73.26 H ATOM 13702 HD13 ILE A1002 -0.168 2.838 -34.018 1.00 73.26 H ATOM 13703 N LEU A1003 -0.463 -1.594 -37.490 1.00 73.54 N ANISOU13703 N LEU A1003 8179 11358 8404 1949 1068 -2778 N ATOM 13704 CA LEU A1003 -1.051 -2.027 -38.749 1.00 70.09 C ANISOU13704 CA LEU A1003 7791 10897 7942 1877 1124 -2851 C ATOM 13705 C LEU A1003 -1.299 -3.534 -38.735 1.00 68.10 C ANISOU13705 C LEU A1003 7581 10494 7799 1970 1195 -2895 C ATOM 13706 O LEU A1003 -2.168 -4.038 -39.446 1.00 64.73 O ANISOU13706 O LEU A1003 7215 10002 7377 1930 1226 -2945 O ATOM 13707 CB LEU A1003 -0.122 -1.653 -39.904 1.00 67.51 C ANISOU13707 CB LEU A1003 7393 10718 7539 1808 1163 -2946 C ATOM 13708 CG LEU A1003 -0.682 -1.712 -41.326 1.00 64.49 C ANISOU13708 CG LEU A1003 7050 10371 7080 1712 1203 -3020 C ATOM 13709 CD1 LEU A1003 -1.946 -0.874 -41.469 1.00 63.40 C ANISOU13709 CD1 LEU A1003 6982 10234 6874 1617 1150 -2948 C ATOM 13710 CD2 LEU A1003 0.381 -1.240 -42.305 1.00 67.48 C ANISOU13710 CD2 LEU A1003 7350 10909 7380 1660 1250 -3094 C ATOM 13711 H LEU A1003 0.328 -1.268 -37.570 1.00 88.25 H ATOM 13712 HA LEU A1003 -1.901 -1.577 -38.881 1.00 84.11 H ATOM 13713 HB2 LEU A1003 0.182 -0.744 -39.759 1.00 81.01 H ATOM 13714 HB3 LEU A1003 0.642 -2.250 -39.877 1.00 81.01 H ATOM 13715 HG LEU A1003 -0.904 -2.632 -41.541 1.00 77.38 H ATOM 13716 HD11 LEU A1003 -2.266 -0.940 -42.382 1.00 76.08 H ATOM 13717 HD12 LEU A1003 -2.619 -1.211 -40.857 1.00 76.08 H ATOM 13718 HD13 LEU A1003 -1.738 0.049 -41.257 1.00 76.08 H ATOM 13719 HD21 LEU A1003 0.020 -1.280 -43.205 1.00 80.98 H ATOM 13720 HD22 LEU A1003 0.627 -0.328 -42.087 1.00 80.98 H ATOM 13721 HD23 LEU A1003 1.156 -1.819 -42.233 1.00 80.98 H ATOM 13722 N SER A1004 -0.532 -4.244 -37.911 1.00 68.97 N ANISOU13722 N SER A1004 7652 10553 8000 2099 1222 -2882 N ATOM 13723 CA SER A1004 -0.677 -5.689 -37.758 1.00 72.23 C ANISOU13723 CA SER A1004 8097 10803 8542 2207 1309 -2908 C ATOM 13724 C SER A1004 -2.031 -6.063 -37.156 1.00 72.80 C ANISOU13724 C SER A1004 8263 10713 8686 2229 1312 -2826 C ATOM 13725 O SER A1004 -2.465 -7.211 -37.257 1.00 71.19 O ANISOU13725 O SER A1004 8100 10357 8593 2289 1394 -2858 O ATOM 13726 CB SER A1004 0.451 -6.244 -36.883 1.00 74.51 C ANISOU13726 CB SER A1004 8316 11081 8912 2350 1336 -2884 C ATOM 13727 OG SER A1004 0.148 -7.547 -36.417 1.00 79.16 O ANISOU13727 OG SER A1004 8946 11484 9648 2471 1424 -2860 O ATOM 13728 H SER A1004 0.090 -3.906 -37.422 1.00 82.76 H ATOM 13729 HA SER A1004 -0.613 -6.107 -38.631 1.00 86.67 H ATOM 13730 HB2 SER A1004 1.267 -6.280 -37.407 1.00 89.41 H ATOM 13731 HB3 SER A1004 0.575 -5.658 -36.120 1.00 89.41 H ATOM 13732 HG SER A1004 0.040 -8.067 -37.068 1.00 95.00 H ATOM 13733 N GLU A1005 -2.695 -5.096 -36.531 1.00 96.23 N ANISOU13733 N GLU A1005 11259 13707 11598 2183 1229 -2724 N ATOM 13734 CA GLU A1005 -3.993 -5.340 -35.907 1.00 96.44 C ANISOU13734 CA GLU A1005 11366 13588 11690 2202 1233 -2636 C ATOM 13735 C GLU A1005 -5.109 -5.503 -36.943 1.00 96.61 C ANISOU13735 C GLU A1005 11447 13567 11695 2106 1250 -2708 C ATOM 13736 O GLU A1005 -6.204 -5.963 -36.612 1.00 97.61 O ANISOU13736 O GLU A1005 11633 13553 11900 2128 1275 -2667 O ATOM 13737 CB GLU A1005 -4.345 -4.200 -34.947 1.00 88.21 C ANISOU13737 CB GLU A1005 10334 12599 10582 2184 1137 -2513 C ATOM 13738 CG GLU A1005 -3.414 -4.078 -33.751 1.00 88.65 C ANISOU13738 CG GLU A1005 10334 12699 10652 2295 1100 -2445 C ATOM 13739 CD GLU A1005 -3.655 -5.149 -32.699 1.00 90.38 C ANISOU13739 CD GLU A1005 10575 12757 11007 2442 1161 -2362 C ATOM 13740 OE1 GLU A1005 -2.966 -5.121 -31.657 1.00 93.13 O ANISOU13740 OE1 GLU A1005 10878 13147 11361 2549 1123 -2301 O ATOM 13741 OE2 GLU A1005 -4.533 -6.013 -32.908 1.00 90.97 O ANISOU13741 OE2 GLU A1005 10708 12668 11188 2455 1247 -2360 O ATOM 13742 H GLU A1005 -2.416 -4.286 -36.454 1.00115.48 H ATOM 13743 HA GLU A1005 -3.943 -6.160 -35.391 1.00115.73 H ATOM 13744 HB2 GLU A1005 -4.311 -3.362 -35.434 1.00105.85 H ATOM 13745 HB3 GLU A1005 -5.242 -4.345 -34.609 1.00105.85 H ATOM 13746 HG2 GLU A1005 -2.497 -4.159 -34.056 1.00106.39 H ATOM 13747 HG3 GLU A1005 -3.550 -3.213 -33.333 1.00106.39 H ATOM 13748 N PHE A1006 -4.826 -5.126 -38.188 1.00 62.88 N ANISOU13748 N PHE A1006 7149 9422 7319 2004 1235 -2817 N ATOM 13749 CA PHE A1006 -5.822 -5.161 -39.258 1.00 62.71 C ANISOU13749 CA PHE A1006 7168 9406 7253 1906 1230 -2900 C ATOM 13750 C PHE A1006 -5.625 -6.343 -40.204 1.00 71.76 C ANISOU13750 C PHE A1006 8307 10508 8452 1925 1304 -3059 C ATOM 13751 O PHE A1006 -6.537 -6.700 -40.950 1.00 73.41 O ANISOU13751 O PHE A1006 8546 10687 8660 1871 1304 -3150 O ATOM 13752 CB PHE A1006 -5.784 -3.855 -40.056 1.00 64.08 C ANISOU13752 CB PHE A1006 7321 9763 7264 1774 1164 -2905 C ATOM 13753 CG PHE A1006 -6.226 -2.651 -39.272 1.00 64.71 C ANISOU13753 CG PHE A1006 7419 9876 7293 1740 1091 -2765 C ATOM 13754 CD1 PHE A1006 -5.353 -2.011 -38.405 1.00 68.51 C ANISOU13754 CD1 PHE A1006 7857 10410 7766 1778 1060 -2687 C ATOM 13755 CD2 PHE A1006 -7.513 -2.153 -39.406 1.00 55.57 C ANISOU13755 CD2 PHE A1006 6314 8702 6097 1671 1050 -2723 C ATOM 13756 CE1 PHE A1006 -5.757 -0.901 -37.684 1.00 58.77 C ANISOU13756 CE1 PHE A1006 6637 9204 6487 1748 992 -2573 C ATOM 13757 CE2 PHE A1006 -7.922 -1.042 -38.689 1.00 53.34 C ANISOU13757 CE2 PHE A1006 6051 8445 5772 1644 989 -2596 C ATOM 13758 CZ PHE A1006 -7.044 -0.417 -37.826 1.00 52.82 C ANISOU13758 CZ PHE A1006 5947 8424 5700 1682 961 -2523 C ATOM 13759 H PHE A1006 -4.055 -4.842 -38.442 1.00 75.45 H ATOM 13760 HA PHE A1006 -6.704 -5.241 -38.861 1.00 75.25 H ATOM 13761 HB2 PHE A1006 -4.874 -3.698 -40.353 1.00 76.90 H ATOM 13762 HB3 PHE A1006 -6.370 -3.941 -40.824 1.00 76.90 H ATOM 13763 HD1 PHE A1006 -4.486 -2.333 -38.305 1.00 82.22 H ATOM 13764 HD2 PHE A1006 -8.109 -2.571 -39.985 1.00 66.68 H ATOM 13765 HE1 PHE A1006 -5.163 -0.481 -37.105 1.00 70.52 H ATOM 13766 HE2 PHE A1006 -8.788 -0.719 -38.786 1.00 64.01 H ATOM 13767 HZ PHE A1006 -7.317 0.330 -37.343 1.00 63.39 H ATOM 13768 N SER A1007 -4.438 -6.944 -40.180 1.00 84.13 N ANISOU13768 N SER A1007 9825 12075 10064 2004 1364 -3103 N ATOM 13769 CA SER A1007 -4.132 -8.069 -41.064 1.00 86.18 C ANISOU13769 CA SER A1007 10075 12294 10377 2032 1441 -3260 C ATOM 13770 C SER A1007 -4.925 -9.310 -40.663 1.00 87.33 C ANISOU13770 C SER A1007 10269 12221 10690 2118 1507 -3277 C ATOM 13771 O SER A1007 -5.113 -10.224 -41.467 1.00 82.37 O ANISOU13771 O SER A1007 9646 11537 10113 2120 1555 -3427 O ATOM 13772 CB SER A1007 -2.629 -8.374 -41.056 1.00 82.85 C ANISOU13772 CB SER A1007 9585 11925 9970 2108 1495 -3291 C ATOM 13773 OG SER A1007 -2.141 -8.530 -39.735 1.00 80.09 O ANISOU13773 OG SER A1007 9219 11497 9713 2226 1512 -3164 O ATOM 13774 H SER A1007 -3.791 -6.720 -39.661 1.00100.95 H ATOM 13775 HA SER A1007 -4.383 -7.834 -41.971 1.00103.42 H ATOM 13776 HB2 SER A1007 -2.473 -9.196 -41.547 1.00 99.42 H ATOM 13777 HB3 SER A1007 -2.157 -7.641 -41.481 1.00 99.42 H ATOM 13778 HG SER A1007 -1.317 -8.696 -39.751 1.00 96.10 H ATOM 13779 N SER A1008 -5.387 -9.332 -39.416 1.00108.23 N ANISOU13779 N SER A1008 12950 14745 13429 2193 1513 -3125 N ATOM 13780 CA SER A1008 -6.227 -10.414 -38.914 1.00104.50 C ANISOU13780 CA SER A1008 12525 14049 13129 2281 1588 -3106 C ATOM 13781 C SER A1008 -7.484 -10.560 -39.761 1.00100.10 C ANISOU13781 C SER A1008 12000 13468 12567 2185 1555 -3225 C ATOM 13782 O SER A1008 -7.943 -11.669 -40.034 1.00101.22 O ANISOU13782 O SER A1008 12155 13463 12841 2228 1617 -3325 O ATOM 13783 CB SER A1008 -6.639 -10.138 -37.463 1.00 99.05 C ANISOU13783 CB SER A1008 11864 13263 12508 2356 1591 -2903 C ATOM 13784 OG SER A1008 -5.526 -9.790 -36.659 1.00 98.72 O ANISOU13784 OG SER A1008 11775 13286 12449 2423 1586 -2806 O ATOM 13785 H SER A1008 -5.225 -8.721 -38.832 1.00129.88 H ATOM 13786 HA SER A1008 -5.735 -11.250 -38.943 1.00125.39 H ATOM 13787 HB2 SER A1008 -7.275 -9.405 -37.453 1.00118.86 H ATOM 13788 HB3 SER A1008 -7.052 -10.936 -37.098 1.00118.86 H ATOM 13789 HG SER A1008 -5.776 -9.643 -35.871 1.00118.47 H ATOM 13790 N LYS A1009 -8.029 -9.426 -40.183 1.00100.99 N ANISOU13790 N LYS A1009 12115 13726 12531 2055 1454 -3220 N ATOM 13791 CA LYS A1009 -9.359 -9.384 -40.776 1.00100.26 C ANISOU13791 CA LYS A1009 12044 13620 12430 1965 1407 -3302 C ATOM 13792 C LYS A1009 -9.419 -9.898 -42.220 1.00102.73 C ANISOU13792 C LYS A1009 12326 14002 12706 1887 1400 -3533 C ATOM 13793 O LYS A1009 -10.330 -10.648 -42.561 1.00110.18 O ANISOU13793 O LYS A1009 13271 14840 13751 1872 1408 -3654 O ATOM 13794 CB LYS A1009 -9.909 -7.958 -40.692 1.00 93.39 C ANISOU13794 CB LYS A1009 11185 12885 11412 1865 1307 -3200 C ATOM 13795 CG LYS A1009 -11.425 -7.847 -40.825 1.00 92.16 C ANISOU13795 CG LYS A1009 11055 12683 11278 1805 1263 -3222 C ATOM 13796 CD LYS A1009 -12.140 -8.466 -39.624 1.00 90.02 C ANISOU13796 CD LYS A1009 10824 12191 11191 1911 1321 -3111 C ATOM 13797 CE LYS A1009 -13.641 -8.222 -39.666 1.00 92.00 C ANISOU13797 CE LYS A1009 11089 12401 11465 1852 1274 -3118 C ATOM 13798 NZ LYS A1009 -14.290 -8.490 -38.351 1.00 92.19 N ANISOU13798 NZ LYS A1009 11154 12234 11641 1958 1331 -2952 N ATOM 13799 H LYS A1009 -7.644 -8.658 -40.136 1.00121.19 H ATOM 13800 HA LYS A1009 -9.943 -9.950 -40.247 1.00120.31 H ATOM 13801 HB2 LYS A1009 -9.662 -7.582 -39.833 1.00112.06 H ATOM 13802 HB3 LYS A1009 -9.513 -7.432 -41.404 1.00112.06 H ATOM 13803 HG2 LYS A1009 -11.674 -6.911 -40.878 1.00110.59 H ATOM 13804 HG3 LYS A1009 -11.711 -8.316 -41.624 1.00110.59 H ATOM 13805 HD2 LYS A1009 -11.990 -9.425 -39.623 1.00108.03 H ATOM 13806 HD3 LYS A1009 -11.792 -8.073 -38.808 1.00108.03 H ATOM 13807 HE2 LYS A1009 -13.806 -7.295 -39.901 1.00110.40 H ATOM 13808 HE3 LYS A1009 -14.041 -8.810 -40.326 1.00110.40 H ATOM 13809 HZ1 LYS A1009 -15.165 -8.339 -38.408 1.00110.63 H ATOM 13810 HZ2 LYS A1009 -14.157 -9.338 -38.115 1.00110.63 H ATOM 13811 HZ3 LYS A1009 -13.943 -7.958 -37.727 1.00110.63 H ATOM 13812 N LEU A1010 -8.459 -9.506 -43.057 1.00122.28 N ANISOU13812 N LEU A1010 14764 16651 15045 1838 1387 -3601 N ATOM 13813 CA LEU A1010 -8.473 -9.872 -44.477 1.00131.10 C ANISOU13813 CA LEU A1010 15851 17866 16096 1762 1380 -3814 C ATOM 13814 C LEU A1010 -7.077 -9.722 -45.093 1.00129.85 C ANISOU13814 C LEU A1010 15653 17847 15836 1768 1414 -3857 C ATOM 13815 O LEU A1010 -6.325 -8.847 -44.659 1.00119.98 O ANISOU13815 O LEU A1010 14391 16687 14508 1773 1401 -3722 O ATOM 13816 CB LEU A1010 -9.438 -8.947 -45.222 1.00134.91 C ANISOU13816 CB LEU A1010 16334 18497 16429 1629 1283 -3841 C ATOM 13817 CG LEU A1010 -10.956 -9.126 -45.073 1.00137.70 C ANISOU13817 CG LEU A1010 16704 18756 16859 1591 1238 -3873 C ATOM 13818 CD1 LEU A1010 -11.660 -8.166 -46.021 1.00132.98 C ANISOU13818 CD1 LEU A1010 16094 18356 16077 1463 1146 -3910 C ATOM 13819 CD2 LEU A1010 -11.453 -10.550 -45.336 1.00144.46 C ANISOU13819 CD2 LEU A1010 17544 19445 17898 1621 1284 -4063 C ATOM 13820 H LEU A1010 -7.784 -9.025 -42.828 1.00146.73 H ATOM 13821 HA LEU A1010 -8.768 -10.790 -44.582 1.00157.32 H ATOM 13822 HB2 LEU A1010 -9.242 -8.039 -44.942 1.00161.90 H ATOM 13823 HB3 LEU A1010 -9.245 -9.028 -46.169 1.00161.90 H ATOM 13824 HG LEU A1010 -11.210 -8.886 -44.168 1.00165.24 H ATOM 13825 HD11 LEU A1010 -12.619 -8.278 -45.928 1.00159.58 H ATOM 13826 HD12 LEU A1010 -11.409 -7.257 -45.793 1.00159.58 H ATOM 13827 HD13 LEU A1010 -11.389 -8.366 -46.931 1.00159.58 H ATOM 13828 HD21 LEU A1010 -11.030 -11.153 -44.705 1.00173.35 H ATOM 13829 HD22 LEU A1010 -12.416 -10.574 -45.221 1.00173.35 H ATOM 13830 HD23 LEU A1010 -11.221 -10.804 -46.243 1.00173.35 H ATOM 13831 N LEU A1011 -6.694 -10.536 -46.087 1.00126.48 N ANISOU13831 N LEU A1011 15200 17443 15415 1767 1458 -4049 N ATOM 13832 CA LEU A1011 -7.427 -11.705 -46.595 1.00127.83 C ANISOU13832 CA LEU A1011 15370 17494 15704 1768 1480 -4242 C ATOM 13833 C LEU A1011 -6.458 -12.525 -47.453 1.00126.55 C ANISOU13833 C LEU A1011 15175 17362 15546 1803 1553 -4415 C ATOM 13834 O LEU A1011 -5.612 -11.955 -48.142 1.00120.89 O ANISOU13834 O LEU A1011 14432 16828 14673 1770 1554 -4429 O ATOM 13835 CB LEU A1011 -8.627 -11.302 -47.452 1.00124.62 C ANISOU13835 CB LEU A1011 14960 17189 15202 1640 1391 -4345 C ATOM 13836 CG LEU A1011 -9.271 -12.429 -48.269 1.00124.33 C ANISOU13836 CG LEU A1011 14898 17081 15262 1614 1399 -4599 C ATOM 13837 CD1 LEU A1011 -9.941 -13.428 -47.336 1.00121.55 C ANISOU13837 CD1 LEU A1011 14560 16454 15169 1687 1443 -4600 C ATOM 13838 CD2 LEU A1011 -10.261 -11.877 -49.266 1.00125.45 C ANISOU13838 CD2 LEU A1011 15019 17386 15258 1486 1301 -4706 C ATOM 13839 H LEU A1011 -5.956 -10.417 -46.512 1.00151.78 H ATOM 13840 HA LEU A1011 -7.735 -12.252 -45.856 1.00153.39 H ATOM 13841 HB2 LEU A1011 -9.311 -10.940 -46.868 1.00149.55 H ATOM 13842 HB3 LEU A1011 -8.340 -10.618 -48.077 1.00149.55 H ATOM 13843 HG LEU A1011 -8.579 -12.897 -48.762 1.00149.20 H ATOM 13844 HD11 LEU A1011 -10.344 -14.134 -47.866 1.00145.86 H ATOM 13845 HD12 LEU A1011 -9.273 -13.801 -46.740 1.00145.86 H ATOM 13846 HD13 LEU A1011 -10.624 -12.970 -46.822 1.00145.86 H ATOM 13847 HD21 LEU A1011 -10.649 -12.613 -49.765 1.00150.54 H ATOM 13848 HD22 LEU A1011 -10.956 -11.398 -48.788 1.00150.54 H ATOM 13849 HD23 LEU A1011 -9.799 -11.275 -49.870 1.00150.54 H ATOM 13850 N ARG A1012 -6.609 -13.848 -47.432 1.00113.22 N ANISOU13850 N ARG A1012 13485 15491 14042 1869 1619 -4549 N ATOM 13851 CA ARG A1012 -5.680 -14.769 -48.102 1.00115.70 C ANISOU13851 CA ARG A1012 13771 15796 14394 1925 1703 -4713 C ATOM 13852 C ARG A1012 -5.227 -14.344 -49.504 1.00115.13 C ANISOU13852 C ARG A1012 13666 15961 14115 1838 1679 -4855 C ATOM 13853 O ARG A1012 -4.030 -14.197 -49.749 1.00112.60 O ANISOU13853 O ARG A1012 13326 15738 13721 1880 1733 -4839 O ATOM 13854 CB ARG A1012 -6.290 -16.169 -48.167 1.00121.47 C ANISOU13854 CB ARG A1012 14500 16309 15343 1965 1753 -4886 C ATOM 13855 CG ARG A1012 -6.513 -16.796 -46.805 1.00125.73 C ANISOU13855 CG ARG A1012 15072 16592 16108 2088 1815 -4739 C ATOM 13856 CD ARG A1012 -6.791 -18.287 -46.918 1.00133.60 C ANISOU13856 CD ARG A1012 16058 17361 17344 2149 1894 -4912 C ATOM 13857 NE ARG A1012 -7.736 -18.753 -45.906 1.00135.91 N ANISOU13857 NE ARG A1012 16375 17417 17845 2202 1913 -4814 N ATOM 13858 CZ ARG A1012 -8.111 -20.020 -45.754 1.00134.72 C ANISOU13858 CZ ARG A1012 16215 17024 17948 2263 1987 -4919 C ATOM 13859 NH1 ARG A1012 -7.620 -20.966 -46.545 1.00140.08 N ANISOU13859 NH1 ARG A1012 16861 17661 18703 2278 2046 -5136 N ATOM 13860 NH2 ARG A1012 -8.977 -20.344 -44.805 1.00127.22 N ANISOU13860 NH2 ARG A1012 15286 15868 17183 2311 2007 -4803 N ATOM 13861 H ARG A1012 -7.254 -14.248 -47.029 1.00135.87 H ATOM 13862 HA ARG A1012 -4.881 -14.833 -47.556 1.00138.84 H ATOM 13863 HB2 ARG A1012 -7.149 -16.116 -48.615 1.00145.76 H ATOM 13864 HB3 ARG A1012 -5.693 -16.748 -48.667 1.00145.76 H ATOM 13865 HG2 ARG A1012 -5.718 -16.676 -46.263 1.00150.88 H ATOM 13866 HG3 ARG A1012 -7.277 -16.376 -46.380 1.00150.88 H ATOM 13867 HD2 ARG A1012 -7.169 -18.474 -47.792 1.00160.33 H ATOM 13868 HD3 ARG A1012 -5.961 -18.775 -46.802 1.00160.33 H ATOM 13869 HE ARG A1012 -8.072 -18.168 -45.372 1.00163.09 H ATOM 13870 HH11 ARG A1012 -7.057 -20.761 -47.162 1.00168.10 H ATOM 13871 HH12 ARG A1012 -7.865 -21.784 -46.441 1.00168.10 H ATOM 13872 HH21 ARG A1012 -9.298 -19.735 -44.289 1.00152.66 H ATOM 13873 HH22 ARG A1012 -9.219 -21.163 -44.705 1.00152.66 H ATOM 13874 N GLN A1013 -6.174 -14.164 -50.423 1.00124.12 N ANISOU13874 N GLN A1013 14798 17200 15163 1726 1605 -4994 N ATOM 13875 CA GLN A1013 -5.843 -13.714 -51.775 1.00123.47 C ANISOU13875 CA GLN A1013 14691 17359 14863 1652 1584 -5113 C ATOM 13876 C GLN A1013 -5.228 -12.315 -51.725 1.00119.95 C ANISOU13876 C GLN A1013 14248 17103 14225 1621 1559 -4916 C ATOM 13877 O GLN A1013 -4.175 -12.065 -52.317 1.00108.49 O ANISOU13877 O GLN A1013 12774 15788 12659 1635 1609 -4931 O ATOM 13878 CB GLN A1013 -7.087 -13.697 -52.674 1.00121.46 C ANISOU13878 CB GLN A1013 14425 17186 14537 1544 1496 -5276 C ATOM 13879 CG GLN A1013 -6.794 -13.289 -54.123 1.00121.75 C ANISOU13879 CG GLN A1013 14442 17483 14336 1483 1480 -5401 C ATOM 13880 CD GLN A1013 -8.044 -13.134 -54.973 1.00122.86 C ANISOU13880 CD GLN A1013 14567 17736 14377 1382 1381 -5538 C ATOM 13881 OE1 GLN A1013 -9.144 -13.506 -54.564 1.00122.78 O ANISOU13881 OE1 GLN A1013 14550 17595 14505 1352 1328 -5585 O ATOM 13882 NE2 GLN A1013 -7.876 -12.576 -56.169 1.00119.81 N ANISOU13882 NE2 GLN A1013 14172 17601 13751 1334 1359 -5599 N ATOM 13883 H GLN A1013 -7.013 -14.295 -50.290 1.00148.94 H ATOM 13884 HA GLN A1013 -5.193 -14.319 -52.165 1.00148.16 H ATOM 13885 HB2 GLN A1013 -7.474 -14.587 -52.689 1.00145.75 H ATOM 13886 HB3 GLN A1013 -7.727 -13.066 -52.311 1.00145.75 H ATOM 13887 HG2 GLN A1013 -6.328 -12.438 -54.121 1.00146.10 H ATOM 13888 HG3 GLN A1013 -6.237 -13.969 -54.534 1.00146.10 H ATOM 13889 HE21 GLN A1013 -7.092 -12.326 -56.421 1.00143.78 H ATOM 13890 HE22 GLN A1013 -8.551 -12.464 -56.691 1.00143.78 H ATOM 13891 N ASP A1014 -5.895 -11.417 -51.002 1.00111.15 N ANISOU13891 N ASP A1014 13156 15986 13089 1581 1488 -4736 N ATOM 13892 CA ASP A1014 -5.467 -10.024 -50.881 1.00101.83 C ANISOU13892 CA ASP A1014 11976 14965 11748 1540 1458 -4547 C ATOM 13893 C ASP A1014 -4.209 -9.884 -50.018 1.00100.09 C ANISOU13893 C ASP A1014 11741 14699 11588 1626 1522 -4410 C ATOM 13894 O ASP A1014 -3.541 -8.851 -50.058 1.00 94.73 O ANISOU13894 O ASP A1014 11043 14159 10790 1600 1518 -4293 O ATOM 13895 CB ASP A1014 -6.592 -9.166 -50.281 1.00 95.60 C ANISOU13895 CB ASP A1014 11218 14166 10941 1480 1367 -4402 C ATOM 13896 CG ASP A1014 -7.734 -8.914 -51.254 1.00100.99 C ANISOU13896 CG ASP A1014 11902 14966 11505 1382 1292 -4507 C ATOM 13897 OD1 ASP A1014 -8.574 -9.818 -51.444 1.00103.59 O ANISOU13897 OD1 ASP A1014 12226 15198 11935 1374 1273 -4666 O ATOM 13898 OD2 ASP A1014 -7.805 -7.798 -51.810 1.00102.76 O ANISOU13898 OD2 ASP A1014 12127 15378 11541 1314 1252 -4428 O ATOM 13899 H ASP A1014 -6.613 -11.594 -50.564 1.00133.38 H ATOM 13900 HA ASP A1014 -5.265 -9.678 -51.764 1.00122.19 H ATOM 13901 HB2 ASP A1014 -6.955 -9.621 -49.505 1.00114.72 H ATOM 13902 HB3 ASP A1014 -6.226 -8.306 -50.020 1.00114.72 H ATOM 13903 N LYS A1015 -3.893 -10.915 -49.235 1.00100.57 N ANISOU13903 N LYS A1015 11805 14567 11840 1733 1583 -4423 N ATOM 13904 CA LYS A1015 -2.693 -10.899 -48.398 1.00 94.55 C ANISOU13904 CA LYS A1015 11019 13764 11142 1829 1643 -4305 C ATOM 13905 C LYS A1015 -1.454 -10.969 -49.280 1.00102.82 C ANISOU13905 C LYS A1015 12018 14947 12102 1844 1711 -4399 C ATOM 13906 O LYS A1015 -0.449 -10.310 -49.005 1.00102.54 O ANISOU13906 O LYS A1015 11943 15000 12019 1863 1731 -4297 O ATOM 13907 CB LYS A1015 -2.678 -12.062 -47.398 1.00 94.64 C ANISOU13907 CB LYS A1015 11048 13535 11376 1956 1705 -4292 C ATOM 13908 CG LYS A1015 -3.386 -11.779 -46.073 1.00 96.30 C ANISOU13908 CG LYS A1015 11297 13615 11678 1986 1664 -4109 C ATOM 13909 CD LYS A1015 -2.938 -12.730 -44.979 1.00101.06 C ANISOU13909 CD LYS A1015 11907 14018 12475 2142 1749 -4038 C ATOM 13910 CE LYS A1015 -4.034 -12.941 -43.948 1.00100.12 C ANISOU13910 CE LYS A1015 11840 13719 12482 2179 1734 -3925 C ATOM 13911 NZ LYS A1015 -3.513 -13.632 -42.741 1.00102.82 N ANISOU13911 NZ LYS A1015 12190 13892 12987 2343 1821 -3796 N ATOM 13912 H LYS A1015 -4.356 -11.637 -49.170 1.00120.68 H ATOM 13913 HA LYS A1015 -2.663 -10.068 -47.898 1.00113.46 H ATOM 13914 HB2 LYS A1015 -3.115 -12.825 -47.806 1.00113.57 H ATOM 13915 HB3 LYS A1015 -1.756 -12.284 -47.196 1.00113.57 H ATOM 13916 HG2 LYS A1015 -3.182 -10.874 -45.789 1.00115.56 H ATOM 13917 HG3 LYS A1015 -4.342 -11.884 -46.193 1.00115.56 H ATOM 13918 HD2 LYS A1015 -2.720 -13.590 -45.371 1.00121.27 H ATOM 13919 HD3 LYS A1015 -2.163 -12.359 -44.529 1.00121.27 H ATOM 13920 HE2 LYS A1015 -4.389 -12.080 -43.676 1.00120.14 H ATOM 13921 HE3 LYS A1015 -4.737 -13.488 -44.333 1.00120.14 H ATOM 13922 HZ1 LYS A1015 -4.168 -13.747 -42.149 1.00123.39 H ATOM 13923 HZ2 LYS A1015 -3.183 -14.428 -42.965 1.00123.39 H ATOM 13924 HZ3 LYS A1015 -2.867 -13.147 -42.368 1.00123.39 H ATOM 13925 N ARG A1016 -1.528 -11.774 -50.336 1.00112.33 N ANISOU13925 N ARG A1016 13220 16168 13291 1837 1749 -4605 N ATOM 13926 CA ARG A1016 -0.458 -11.837 -51.324 1.00114.24 C ANISOU13926 CA ARG A1016 13421 16554 13431 1847 1819 -4710 C ATOM 13927 C ARG A1016 -0.268 -10.447 -51.916 1.00110.44 C ANISOU13927 C ARG A1016 12923 16302 12737 1752 1780 -4625 C ATOM 13928 O ARG A1016 0.852 -9.947 -52.008 1.00108.99 O ANISOU13928 O ARG A1016 12693 16224 12494 1772 1831 -4570 O ATOM 13929 CB ARG A1016 -0.798 -12.832 -52.440 1.00122.76 C ANISOU13929 CB ARG A1016 14507 17632 14505 1838 1849 -4958 C ATOM 13930 CG ARG A1016 0.311 -13.000 -53.485 1.00125.49 C ANISOU13930 CG ARG A1016 14815 18120 14745 1862 1935 -5081 C ATOM 13931 CD ARG A1016 -0.204 -13.558 -54.806 1.00126.87 C ANISOU13931 CD ARG A1016 15000 18373 14833 1816 1934 -5319 C ATOM 13932 NE ARG A1016 0.000 -15.000 -54.927 1.00136.23 N ANISOU13932 NE ARG A1016 16181 19402 16179 1899 2009 -5509 N ATOM 13933 CZ ARG A1016 0.027 -15.661 -56.082 1.00137.48 C ANISOU13933 CZ ARG A1016 16333 19626 16278 1893 2044 -5744 C ATOM 13934 NH1 ARG A1016 -0.132 -15.015 -57.231 1.00138.63 N ANISOU13934 NH1 ARG A1016 16477 20004 16192 1814 2012 -5810 N ATOM 13935 NH2 ARG A1016 0.218 -16.972 -56.094 1.00130.68 N ANISOU13935 NH2 ARG A1016 15465 18598 15587 1973 2116 -5912 N ATOM 13936 H ARG A1016 -2.190 -12.296 -50.503 1.00134.79 H ATOM 13937 HA ARG A1016 0.369 -12.113 -50.898 1.00137.09 H ATOM 13938 HB2 ARG A1016 -0.964 -13.701 -52.042 1.00147.31 H ATOM 13939 HB3 ARG A1016 -1.594 -12.524 -52.900 1.00147.31 H ATOM 13940 HG2 ARG A1016 0.713 -12.135 -53.662 1.00150.59 H ATOM 13941 HG3 ARG A1016 0.979 -13.613 -53.141 1.00150.59 H ATOM 13942 HD2 ARG A1016 -1.156 -13.384 -54.873 1.00152.25 H ATOM 13943 HD3 ARG A1016 0.265 -13.126 -55.537 1.00152.25 H ATOM 13944 HE ARG A1016 0.111 -15.452 -54.203 1.00163.47 H ATOM 13945 HH11 ARG A1016 -0.256 -14.164 -57.232 1.00166.36 H ATOM 13946 HH12 ARG A1016 -0.113 -15.447 -57.974 1.00166.36 H ATOM 13947 HH21 ARG A1016 0.323 -17.398 -55.355 1.00156.81 H ATOM 13948 HH22 ARG A1016 0.237 -17.397 -56.842 1.00156.81 H ATOM 13949 N THR A1017 -1.381 -9.827 -52.301 1.00105.74 N ANISOU13949 N THR A1017 12360 15779 12038 1653 1695 -4612 N ATOM 13950 CA THR A1017 -1.371 -8.507 -52.926 1.00105.59 C ANISOU13950 CA THR A1017 12335 15970 11816 1565 1663 -4525 C ATOM 13951 C THR A1017 -0.746 -7.459 -52.001 1.00106.13 C ANISOU13951 C THR A1017 12379 16054 11892 1567 1656 -4315 C ATOM 13952 O THR A1017 -0.036 -6.561 -52.458 1.00101.38 O ANISOU13952 O THR A1017 11743 15611 11165 1535 1686 -4256 O ATOM 13953 CB THR A1017 -2.803 -8.054 -53.295 1.00101.09 C ANISOU13953 CB THR A1017 11805 15447 11157 1473 1566 -4524 C ATOM 13954 OG1 THR A1017 -3.516 -9.138 -53.904 1.00 98.06 O ANISOU13954 OG1 THR A1017 11434 15011 10812 1473 1555 -4731 O ATOM 13955 CG2 THR A1017 -2.768 -6.872 -54.253 1.00102.58 C ANISOU13955 CG2 THR A1017 11991 15868 11117 1395 1556 -4470 C ATOM 13956 H THR A1017 -2.170 -10.158 -52.209 1.00126.89 H ATOM 13957 HA THR A1017 -0.846 -8.545 -53.741 1.00126.71 H ATOM 13958 HB THR A1017 -3.268 -7.778 -52.490 1.00121.31 H ATOM 13959 HG1 THR A1017 -4.294 -8.893 -54.105 1.00117.67 H ATOM 13960 HG21 THR A1017 -3.672 -6.600 -54.475 1.00123.10 H ATOM 13961 HG22 THR A1017 -2.306 -6.126 -53.841 1.00123.10 H ATOM 13962 HG23 THR A1017 -2.304 -7.120 -55.068 1.00123.10 H ATOM 13963 N VAL A1018 -1.016 -7.580 -50.703 1.00 92.34 N ANISOU13963 N VAL A1018 10647 14145 10295 1609 1619 -4207 N ATOM 13964 CA VAL A1018 -0.452 -6.671 -49.704 1.00 86.23 C ANISOU13964 CA VAL A1018 9844 13375 9543 1619 1602 -4025 C ATOM 13965 C VAL A1018 1.049 -6.892 -49.577 1.00 83.95 C ANISOU13965 C VAL A1018 9486 13115 9296 1695 1685 -4039 C ATOM 13966 O VAL A1018 1.826 -5.938 -49.542 1.00 78.51 O ANISOU13966 O VAL A1018 8745 12545 8541 1670 1696 -3957 O ATOM 13967 CB VAL A1018 -1.139 -6.849 -48.316 1.00 81.72 C ANISOU13967 CB VAL A1018 9309 12622 9118 1660 1547 -3914 C ATOM 13968 CG1 VAL A1018 -0.167 -6.579 -47.148 1.00 80.15 C ANISOU13968 CG1 VAL A1018 9065 12384 9004 1734 1559 -3790 C ATOM 13969 CG2 VAL A1018 -2.358 -5.944 -48.210 1.00 73.91 C ANISOU13969 CG2 VAL A1018 8366 11659 8057 1569 1457 -3819 C ATOM 13970 H VAL A1018 -1.528 -8.186 -50.371 1.00110.81 H ATOM 13971 HA VAL A1018 -0.596 -5.756 -49.994 1.00103.47 H ATOM 13972 HB VAL A1018 -1.445 -7.766 -48.238 1.00 98.06 H ATOM 13973 HG11 VAL A1018 -0.640 -6.703 -46.310 1.00 96.18 H ATOM 13974 HG12 VAL A1018 0.575 -7.202 -47.204 1.00 96.18 H ATOM 13975 HG13 VAL A1018 0.160 -5.668 -47.213 1.00 96.18 H ATOM 13976 HG21 VAL A1018 -2.769 -6.070 -47.341 1.00 88.69 H ATOM 13977 HG22 VAL A1018 -2.076 -5.021 -48.312 1.00 88.69 H ATOM 13978 HG23 VAL A1018 -2.986 -6.177 -48.911 1.00 88.69 H ATOM 13979 N TYR A1019 1.444 -8.159 -49.507 1.00103.95 N ANISOU13979 N TYR A1019 12014 15536 11947 1790 1748 -4148 N ATOM 13980 CA TYR A1019 2.847 -8.523 -49.381 1.00107.88 C ANISOU13980 CA TYR A1019 12441 16048 12498 1878 1834 -4173 C ATOM 13981 C TYR A1019 3.612 -8.028 -50.606 1.00113.21 C ANISOU13981 C TYR A1019 13071 16923 13019 1831 1893 -4244 C ATOM 13982 O TYR A1019 4.711 -7.487 -50.482 1.00113.56 O ANISOU13982 O TYR A1019 13042 17059 13046 1848 1934 -4193 O ATOM 13983 CB TYR A1019 2.984 -10.042 -49.230 1.00106.57 C ANISOU13983 CB TYR A1019 12289 15717 12485 1991 1901 -4287 C ATOM 13984 CG TYR A1019 4.272 -10.499 -48.571 1.00108.45 C ANISOU13984 CG TYR A1019 12460 15910 12834 2114 1975 -4260 C ATOM 13985 CD1 TYR A1019 5.510 -10.080 -49.043 1.00111.06 C ANISOU13985 CD1 TYR A1019 12710 16392 13095 2120 2033 -4279 C ATOM 13986 CD2 TYR A1019 4.247 -11.349 -47.472 1.00106.37 C ANISOU13986 CD2 TYR A1019 12210 15456 12749 2231 1994 -4208 C ATOM 13987 CE1 TYR A1019 6.684 -10.498 -48.444 1.00113.99 C ANISOU13987 CE1 TYR A1019 13008 16733 13572 2236 2096 -4260 C ATOM 13988 CE2 TYR A1019 5.417 -11.772 -46.866 1.00107.14 C ANISOU13988 CE2 TYR A1019 12240 15521 12945 2353 2061 -4177 C ATOM 13989 CZ TYR A1019 6.631 -11.343 -47.355 1.00112.47 C ANISOU13989 CZ TYR A1019 12828 16356 13549 2353 2106 -4208 C ATOM 13990 OH TYR A1019 7.800 -11.758 -46.756 1.00114.77 O ANISOU13990 OH TYR A1019 13041 16625 13941 2478 2168 -4183 O ATOM 13991 H TYR A1019 0.910 -8.833 -49.532 1.00124.74 H ATOM 13992 HA TYR A1019 3.222 -8.101 -48.593 1.00129.45 H ATOM 13993 HB2 TYR A1019 2.247 -10.367 -48.690 1.00127.88 H ATOM 13994 HB3 TYR A1019 2.946 -10.445 -50.111 1.00127.88 H ATOM 13995 HD1 TYR A1019 5.550 -9.511 -49.777 1.00133.27 H ATOM 13996 HD2 TYR A1019 3.429 -11.641 -47.140 1.00127.64 H ATOM 13997 HE1 TYR A1019 7.505 -10.209 -48.772 1.00136.79 H ATOM 13998 HE2 TYR A1019 5.383 -12.341 -46.131 1.00128.56 H ATOM 13999 HH TYR A1019 8.460 -11.424 -47.153 1.00137.72 H ATOM 14000 N VAL A1020 3.017 -8.202 -51.783 1.00118.34 N ANISOU14000 N VAL A1020 13761 17647 13556 1773 1899 -4364 N ATOM 14001 CA VAL A1020 3.614 -7.714 -53.025 1.00119.07 C ANISOU14001 CA VAL A1020 13823 17939 13478 1731 1962 -4425 C ATOM 14002 C VAL A1020 3.833 -6.203 -52.961 1.00117.15 C ANISOU14002 C VAL A1020 13551 17836 13126 1654 1939 -4269 C ATOM 14003 O VAL A1020 4.810 -5.690 -53.502 1.00119.82 O ANISOU14003 O VAL A1020 13831 18314 13383 1650 2016 -4265 O ATOM 14004 CB VAL A1020 2.740 -8.071 -54.259 1.00117.67 C ANISOU14004 CB VAL A1020 13701 17830 13177 1679 1951 -4573 C ATOM 14005 CG1 VAL A1020 3.179 -7.292 -55.504 1.00115.53 C ANISOU14005 CG1 VAL A1020 13412 17790 12694 1627 2007 -4592 C ATOM 14006 CG2 VAL A1020 2.802 -9.568 -54.537 1.00115.83 C ANISOU14006 CG2 VAL A1020 13479 17484 13047 1758 2003 -4766 C ATOM 14007 H VAL A1020 2.264 -8.601 -51.891 1.00142.01 H ATOM 14008 HA VAL A1020 4.480 -8.134 -53.143 1.00142.88 H ATOM 14009 HB VAL A1020 1.818 -7.840 -54.070 1.00141.20 H ATOM 14010 HG11 VAL A1020 2.611 -7.543 -56.250 1.00138.63 H ATOM 14011 HG12 VAL A1020 3.094 -6.342 -55.328 1.00138.63 H ATOM 14012 HG13 VAL A1020 4.103 -7.510 -55.704 1.00138.63 H ATOM 14013 HG21 VAL A1020 2.251 -9.768 -55.310 1.00139.00 H ATOM 14014 HG22 VAL A1020 3.723 -9.818 -54.714 1.00139.00 H ATOM 14015 HG23 VAL A1020 2.472 -10.047 -53.761 1.00139.00 H ATOM 14016 N TYR A1021 2.923 -5.497 -52.297 1.00120.35 N ANISOU14016 N TYR A1021 13993 18199 13537 1596 1842 -4142 N ATOM 14017 CA TYR A1021 3.035 -4.050 -52.167 1.00113.39 C ANISOU14017 CA TYR A1021 13087 17429 12568 1523 1820 -3994 C ATOM 14018 C TYR A1021 4.050 -3.692 -51.084 1.00109.85 C ANISOU14018 C TYR A1021 12560 16947 12230 1568 1830 -3902 C ATOM 14019 O TYR A1021 4.666 -2.627 -51.126 1.00108.71 O ANISOU14019 O TYR A1021 12359 16917 12029 1526 1856 -3824 O ATOM 14020 CB TYR A1021 1.672 -3.429 -51.849 1.00108.53 C ANISOU14020 CB TYR A1021 12538 16777 11920 1450 1716 -3897 C ATOM 14021 CG TYR A1021 1.651 -1.928 -52.008 1.00110.86 C ANISOU14021 CG TYR A1021 12821 17202 12099 1366 1708 -3762 C ATOM 14022 CD1 TYR A1021 1.995 -1.095 -50.953 1.00106.77 C ANISOU14022 CD1 TYR A1021 12264 16652 11652 1359 1678 -3629 C ATOM 14023 CD2 TYR A1021 1.296 -1.343 -53.217 1.00115.38 C ANISOU14023 CD2 TYR A1021 13419 17931 12490 1301 1735 -3770 C ATOM 14024 CE1 TYR A1021 1.983 0.278 -51.094 1.00103.54 C ANISOU14024 CE1 TYR A1021 11840 16350 11151 1283 1682 -3514 C ATOM 14025 CE2 TYR A1021 1.280 0.031 -53.368 1.00114.61 C ANISOU14025 CE2 TYR A1021 13312 17942 12292 1232 1745 -3637 C ATOM 14026 CZ TYR A1021 1.626 0.836 -52.301 1.00110.77 C ANISOU14026 CZ TYR A1021 12785 17407 11894 1220 1722 -3512 C ATOM 14027 OH TYR A1021 1.615 2.206 -52.434 1.00112.03 O ANISOU14027 OH TYR A1021 12934 17664 11970 1151 1743 -3387 O ATOM 14028 H TYR A1021 2.231 -5.833 -51.913 1.00144.42 H ATOM 14029 HA TYR A1021 3.346 -3.679 -53.007 1.00136.07 H ATOM 14030 HB2 TYR A1021 1.008 -3.803 -52.450 1.00130.23 H ATOM 14031 HB3 TYR A1021 1.439 -3.635 -50.930 1.00130.23 H ATOM 14032 HD1 TYR A1021 2.238 -1.468 -50.137 1.00128.12 H ATOM 14033 HD2 TYR A1021 1.063 -1.885 -53.937 1.00138.46 H ATOM 14034 HE1 TYR A1021 2.215 0.823 -50.377 1.00124.25 H ATOM 14035 HE2 TYR A1021 1.039 0.410 -54.182 1.00137.53 H ATOM 14036 HH TYR A1021 1.381 2.417 -53.213 1.00134.44 H ATOM 14037 N LEU A1022 4.225 -4.593 -50.122 1.00 89.14 N ANISOU14037 N LEU A1022 9931 14171 9768 1658 1814 -3917 N ATOM 14038 CA LEU A1022 5.169 -4.385 -49.031 1.00 90.09 C ANISOU14038 CA LEU A1022 9972 14262 9995 1718 1812 -3843 C ATOM 14039 C LEU A1022 6.607 -4.505 -49.533 1.00101.64 C ANISOU14039 C LEU A1022 11338 15831 11451 1763 1917 -3914 C ATOM 14040 O LEU A1022 7.474 -3.716 -49.151 1.00100.16 O ANISOU14040 O LEU A1022 11060 15725 11271 1756 1928 -3854 O ATOM 14041 CB LEU A1022 4.911 -5.398 -47.911 1.00 86.54 C ANISOU14041 CB LEU A1022 9550 13621 9710 1819 1777 -3833 C ATOM 14042 CG LEU A1022 5.924 -5.458 -46.763 1.00 86.05 C ANISOU14042 CG LEU A1022 9405 13527 9765 1912 1777 -3777 C ATOM 14043 CD1 LEU A1022 5.878 -4.201 -45.904 1.00 86.15 C ANISOU14043 CD1 LEU A1022 9385 13589 9759 1861 1692 -3644 C ATOM 14044 CD2 LEU A1022 5.679 -6.695 -45.919 1.00 84.55 C ANISOU14044 CD2 LEU A1022 9253 13148 9725 2031 1779 -3782 C ATOM 14045 H LEU A1022 3.803 -5.341 -50.079 1.00106.97 H ATOM 14046 HA LEU A1022 5.047 -3.494 -48.668 1.00108.10 H ATOM 14047 HB2 LEU A1022 4.048 -5.196 -47.517 1.00103.85 H ATOM 14048 HB3 LEU A1022 4.880 -6.282 -48.308 1.00103.85 H ATOM 14049 HG LEU A1022 6.816 -5.527 -47.138 1.00103.27 H ATOM 14050 HD11 LEU A1022 6.532 -4.282 -45.192 1.00103.38 H ATOM 14051 HD12 LEU A1022 6.083 -3.432 -46.458 1.00103.38 H ATOM 14052 HD13 LEU A1022 4.988 -4.110 -45.527 1.00103.38 H ATOM 14053 HD21 LEU A1022 6.327 -6.718 -45.198 1.00101.46 H ATOM 14054 HD22 LEU A1022 4.781 -6.656 -45.556 1.00101.46 H ATOM 14055 HD23 LEU A1022 5.777 -7.482 -46.478 1.00101.46 H ATOM 14056 N GLU A1023 6.854 -5.491 -50.392 1.00136.13 N ANISOU14056 N GLU A1023 15718 20197 15807 1809 1997 -4050 N ATOM 14057 CA GLU A1023 8.199 -5.755 -50.905 1.00136.25 C ANISOU14057 CA GLU A1023 15644 20302 15821 1865 2110 -4128 C ATOM 14058 C GLU A1023 8.690 -4.658 -51.853 1.00136.31 C ANISOU14058 C GLU A1023 15606 20509 15677 1783 2172 -4110 C ATOM 14059 O GLU A1023 9.872 -4.618 -52.201 1.00141.05 O ANISOU14059 O GLU A1023 16116 21203 16275 1819 2270 -4149 O ATOM 14060 CB GLU A1023 8.265 -7.128 -51.591 1.00139.36 C ANISOU14060 CB GLU A1023 16073 20634 16243 1940 2185 -4287 C ATOM 14061 CG GLU A1023 7.233 -7.336 -52.694 1.00146.09 C ANISOU14061 CG GLU A1023 17018 21518 16971 1875 2176 -4379 C ATOM 14062 CD GLU A1023 7.261 -8.737 -53.284 1.00148.68 C ANISOU14062 CD GLU A1023 17377 21772 17344 1951 2243 -4556 C ATOM 14063 OE1 GLU A1023 7.646 -9.684 -52.565 1.00147.22 O ANISOU14063 OE1 GLU A1023 17174 21440 17323 2055 2269 -4582 O ATOM 14064 OE2 GLU A1023 6.889 -8.893 -54.468 1.00148.73 O ANISOU14064 OE2 GLU A1023 17423 21867 17221 1910 2271 -4672 O ATOM 14065 H GLU A1023 6.254 -6.028 -50.696 1.00163.35 H ATOM 14066 HA GLU A1023 8.811 -5.779 -50.152 1.00163.50 H ATOM 14067 HB2 GLU A1023 9.144 -7.235 -51.986 1.00167.23 H ATOM 14068 HB3 GLU A1023 8.122 -7.815 -50.922 1.00167.23 H ATOM 14069 HG2 GLU A1023 6.347 -7.183 -52.330 1.00175.31 H ATOM 14070 HG3 GLU A1023 7.408 -6.706 -53.411 1.00175.31 H ATOM 14071 N LYS A1024 7.789 -3.769 -52.266 1.00103.96 N ANISOU14071 N LYS A1024 11568 16475 11457 1679 2126 -4045 N ATOM 14072 CA LYS A1024 8.181 -2.587 -53.031 1.00105.56 C ANISOU14072 CA LYS A1024 11731 16857 11521 1602 2190 -3993 C ATOM 14073 C LYS A1024 8.953 -1.619 -52.136 1.00107.36 C ANISOU14073 C LYS A1024 11856 17115 11822 1587 2182 -3887 C ATOM 14074 O LYS A1024 9.608 -0.697 -52.623 1.00105.72 O ANISOU14074 O LYS A1024 11580 17045 11543 1540 2262 -3849 O ATOM 14075 CB LYS A1024 6.957 -1.858 -53.594 1.00 97.00 C ANISOU14075 CB LYS A1024 10737 15823 10295 1504 2138 -3932 C ATOM 14076 CG LYS A1024 6.029 -2.696 -54.455 1.00100.49 C ANISOU14076 CG LYS A1024 11276 16251 10656 1506 2122 -4042 C ATOM 14077 CD LYS A1024 4.799 -1.881 -54.842 1.00104.67 C ANISOU14077 CD LYS A1024 11882 16833 11055 1414 2055 -3964 C ATOM 14078 CE LYS A1024 3.918 -2.576 -55.873 1.00101.52 C ANISOU14078 CE LYS A1024 11561 16468 10544 1407 2040 -4087 C ATOM 14079 NZ LYS A1024 4.247 -4.013 -56.077 1.00 96.90 N ANISOU14079 NZ LYS A1024 10975 15808 10036 1489 2076 -4263 N ATOM 14080 H LYS A1024 6.944 -3.828 -52.116 1.00124.75 H ATOM 14081 HA LYS A1024 8.752 -2.850 -53.769 1.00126.67 H ATOM 14082 HB2 LYS A1024 6.434 -1.518 -52.850 1.00116.40 H ATOM 14083 HB3 LYS A1024 7.265 -1.116 -54.137 1.00116.40 H ATOM 14084 HG2 LYS A1024 6.491 -2.963 -55.265 1.00120.59 H ATOM 14085 HG3 LYS A1024 5.738 -3.476 -53.956 1.00120.59 H ATOM 14086 HD2 LYS A1024 4.263 -1.723 -54.049 1.00125.61 H ATOM 14087 HD3 LYS A1024 5.088 -1.035 -55.219 1.00125.61 H ATOM 14088 HE2 LYS A1024 2.994 -2.522 -55.582 1.00121.82 H ATOM 14089 HE3 LYS A1024 4.020 -2.125 -56.726 1.00121.82 H ATOM 14090 HZ1 LYS A1024 3.703 -4.365 -56.686 1.00116.28 H ATOM 14091 HZ2 LYS A1024 5.087 -4.095 -56.356 1.00116.28 H ATOM 14092 HZ3 LYS A1024 4.151 -4.457 -55.312 1.00116.28 H ATOM 14093 N PHE A1025 8.862 -1.837 -50.826 1.00 91.27 N ANISOU14093 N PHE A1025 9803 14949 9925 1629 2088 -3843 N ATOM 14094 CA PHE A1025 9.434 -0.930 -49.837 1.00 86.92 C ANISOU14094 CA PHE A1025 9158 14421 9446 1615 2050 -3755 C ATOM 14095 C PHE A1025 10.580 -1.576 -49.069 1.00 84.93 C ANISOU14095 C PHE A1025 8799 14137 9334 1723 2066 -3802 C ATOM 14096 O PHE A1025 11.591 -0.929 -48.794 1.00 81.25 O ANISOU14096 O PHE A1025 8206 13762 8901 1719 2098 -3789 O ATOM 14097 CB PHE A1025 8.349 -0.483 -48.855 1.00 78.78 C ANISOU14097 CB PHE A1025 8194 13291 8448 1578 1917 -3652 C ATOM 14098 CG PHE A1025 7.301 0.393 -49.474 1.00 70.52 C ANISOU14098 CG PHE A1025 7231 12290 7273 1470 1898 -3583 C ATOM 14099 CD1 PHE A1025 6.288 -0.155 -50.241 1.00 70.64 C ANISOU14099 CD1 PHE A1025 7358 12275 7208 1453 1889 -3621 C ATOM 14100 CD2 PHE A1025 7.330 1.764 -49.289 1.00 69.58 C ANISOU14100 CD2 PHE A1025 7072 12247 7117 1388 1893 -3487 C ATOM 14101 CE1 PHE A1025 5.321 0.649 -50.814 1.00 73.39 C ANISOU14101 CE1 PHE A1025 7776 12677 7432 1362 1868 -3555 C ATOM 14102 CE2 PHE A1025 6.368 2.575 -49.860 1.00 68.84 C ANISOU14102 CE2 PHE A1025 7057 12195 6906 1298 1885 -3413 C ATOM 14103 CZ PHE A1025 5.361 2.016 -50.623 1.00 71.31 C ANISOU14103 CZ PHE A1025 7479 12484 7129 1288 1869 -3442 C ATOM 14104 H PHE A1025 8.466 -2.518 -50.480 1.00109.52 H ATOM 14105 HA PHE A1025 9.778 -0.143 -50.288 1.00104.30 H ATOM 14106 HB2 PHE A1025 7.907 -1.269 -48.499 1.00 94.54 H ATOM 14107 HB3 PHE A1025 8.766 0.016 -48.135 1.00 94.54 H ATOM 14108 HD1 PHE A1025 6.258 -1.075 -50.372 1.00 84.77 H ATOM 14109 HD2 PHE A1025 8.007 2.145 -48.777 1.00 83.49 H ATOM 14110 HE1 PHE A1025 4.645 0.270 -51.327 1.00 88.07 H ATOM 14111 HE2 PHE A1025 6.397 3.495 -49.729 1.00 82.61 H ATOM 14112 HZ PHE A1025 4.711 2.560 -51.008 1.00 85.57 H HETATM14113 N MSE A1026 10.420 -2.848 -48.716 1.00127.46 N ANISOU14113 N MSE A1026 14230 19394 14806 1821 2047 -3857 N HETATM14114 CA MSE A1026 11.446 -3.551 -47.959 1.00127.75 C ANISOU14114 CA MSE A1026 14173 19391 14976 1940 2063 -3892 C HETATM14115 C MSE A1026 12.418 -4.268 -48.892 1.00137.02 C ANISOU14115 C MSE A1026 15293 20625 16144 2000 2199 -4006 C HETATM14116 O MSE A1026 12.042 -4.687 -49.988 1.00135.65 O ANISOU14116 O MSE A1026 15193 20465 15883 1978 2263 -4078 O HETATM14117 CB MSE A1026 10.813 -4.543 -46.983 1.00120.44 C ANISOU14117 CB MSE A1026 13319 18283 14161 2031 1990 -3872 C HETATM14118 CG MSE A1026 10.093 -5.712 -47.633 1.00121.64 C ANISOU14118 CG MSE A1026 13583 18324 14312 2063 2031 -3952 C HETATM14119 SE MSE A1026 9.614 -7.086 -46.334 1.00139.18 SE ANISOU14119 SE MSE A1026 15864 20304 16715 2209 1988 -3925 SE HETATM14120 CE MSE A1026 11.337 -7.295 -45.444 1.00115.15 C ANISOU14120 CE MSE A1026 12653 17307 13790 2348 2024 -3918 C HETATM14121 H MSE A1026 9.728 -3.323 -48.903 1.00152.95 H HETATM14122 HA MSE A1026 11.943 -2.903 -47.436 1.00153.30 H HETATM14123 HB2 MSE A1026 11.512 -4.908 -46.417 1.00144.53 H HETATM14124 HB3 MSE A1026 10.167 -4.069 -46.437 1.00144.53 H HETATM14125 HG2 MSE A1026 9.278 -5.392 -48.049 1.00145.97 H HETATM14126 HG3 MSE A1026 10.674 -6.114 -48.298 1.00145.97 H HETATM14127 HE1 MSE A1026 11.254 -7.967 -44.750 1.00138.18 H HETATM14128 HE2 MSE A1026 11.997 -7.573 -46.097 1.00138.18 H HETATM14129 HE3 MSE A1026 11.595 -6.445 -45.053 1.00138.18 H ATOM 14130 N THR A1027 13.662 -4.411 -48.441 1.00 97.72 N ANISOU14130 N THR A1027 10183 15690 11258 2080 2239 -4028 N ATOM 14131 CA THR A1027 14.721 -5.013 -49.246 1.00 93.09 C ANISOU14131 CA THR A1027 9525 15169 10678 2144 2377 -4130 C ATOM 14132 C THR A1027 15.164 -6.351 -48.660 1.00 93.42 C ANISOU14132 C THR A1027 9550 15087 10860 2298 2395 -4180 C ATOM 14133 O THR A1027 14.625 -6.804 -47.651 1.00 91.44 O ANISOU14133 O THR A1027 9347 14700 10695 2354 2306 -4129 O ATOM 14134 CB THR A1027 15.931 -4.069 -49.357 1.00 92.56 C ANISOU14134 CB THR A1027 9296 15268 10606 2114 2439 -4120 C ATOM 14135 OG1 THR A1027 16.460 -3.799 -48.052 1.00 83.79 O ANISOU14135 OG1 THR A1027 8078 14148 9612 2161 2352 -4073 O ATOM 14136 CG2 THR A1027 15.518 -2.763 -50.011 1.00 92.11 C ANISOU14136 CG2 THR A1027 9257 15325 10417 1969 2451 -4063 C ATOM 14137 H THR A1027 13.922 -4.162 -47.659 1.00117.27 H ATOM 14138 HA THR A1027 14.383 -5.174 -50.140 1.00111.71 H ATOM 14139 HB THR A1027 16.616 -4.484 -49.904 1.00111.08 H ATOM 14140 HG1 THR A1027 17.120 -3.284 -48.111 1.00100.55 H ATOM 14141 HG21 THR A1027 16.283 -2.170 -50.079 1.00110.53 H ATOM 14142 HG22 THR A1027 15.171 -2.933 -50.900 1.00110.53 H ATOM 14143 HG23 THR A1027 14.830 -2.330 -49.481 1.00110.53 H ATOM 14144 N PHE A1028 16.152 -6.977 -49.291 1.00 98.92 N ANISOU14144 N PHE A1028 10177 15828 11579 2373 2521 -4272 N ATOM 14145 CA PHE A1028 16.584 -8.317 -48.901 1.00100.26 C ANISOU14145 CA PHE A1028 10337 15877 11882 2527 2565 -4325 C ATOM 14146 C PHE A1028 17.295 -8.328 -47.547 1.00 97.70 C ANISOU14146 C PHE A1028 9897 15530 11693 2624 2504 -4258 C ATOM 14147 O PHE A1028 16.931 -9.097 -46.658 1.00 97.04 O ANISOU14147 O PHE A1028 9861 15299 11712 2720 2455 -4220 O ATOM 14148 CB PHE A1028 17.497 -8.915 -49.973 1.00100.88 C ANISOU14148 CB PHE A1028 10365 16020 11945 2584 2725 -4443 C ATOM 14149 CG PHE A1028 17.823 -10.365 -49.752 1.00 96.02 C ANISOU14149 CG PHE A1028 9759 15265 11461 2743 2791 -4508 C ATOM 14150 CD1 PHE A1028 16.926 -11.353 -50.121 1.00 94.41 C ANISOU14150 CD1 PHE A1028 9694 14915 11261 2769 2808 -4574 C ATOM 14151 CD2 PHE A1028 19.027 -10.740 -49.178 1.00 98.03 C ANISOU14151 CD2 PHE A1028 9876 15532 11841 2870 2840 -4505 C ATOM 14152 CE1 PHE A1028 17.222 -12.689 -49.920 1.00 95.44 C ANISOU14152 CE1 PHE A1028 9833 14903 11526 2919 2884 -4633 C ATOM 14153 CE2 PHE A1028 19.329 -12.074 -48.976 1.00 99.08 C ANISOU14153 CE2 PHE A1028 10018 15528 12102 3026 2914 -4553 C ATOM 14154 CZ PHE A1028 18.426 -13.049 -49.348 1.00 99.79 C ANISOU14154 CZ PHE A1028 10253 15461 12201 3051 2942 -4615 C ATOM 14155 H PHE A1028 16.591 -6.647 -49.953 1.00118.70 H ATOM 14156 HA PHE A1028 15.802 -8.887 -48.828 1.00120.32 H ATOM 14157 HB2 PHE A1028 17.060 -8.837 -50.835 1.00121.06 H ATOM 14158 HB3 PHE A1028 18.332 -8.422 -49.982 1.00121.06 H ATOM 14159 HD1 PHE A1028 16.114 -11.116 -50.507 1.00113.29 H ATOM 14160 HD2 PHE A1028 19.639 -10.086 -48.926 1.00117.64 H ATOM 14161 HE1 PHE A1028 16.611 -13.344 -50.172 1.00114.53 H ATOM 14162 HE2 PHE A1028 20.141 -12.314 -48.589 1.00118.90 H ATOM 14163 HZ PHE A1028 18.627 -13.947 -49.212 1.00119.74 H ATOM 14164 N GLN A1029 18.308 -7.479 -47.392 1.00106.24 N ANISOU14164 N GLN A1029 10825 16764 12776 2604 2510 -4244 N ATOM 14165 CA GLN A1029 19.040 -7.391 -46.129 1.00107.11 C ANISOU14165 CA GLN A1029 10807 16889 13002 2692 2438 -4195 C ATOM 14166 C GLN A1029 18.136 -6.803 -45.046 1.00109.93 C ANISOU14166 C GLN A1029 11221 17194 13353 2647 2276 -4095 C ATOM 14167 O GLN A1029 18.463 -6.830 -43.860 1.00111.11 O ANISOU14167 O GLN A1029 11299 17332 13585 2731 2190 -4047 O ATOM 14168 CB GLN A1029 20.326 -6.566 -46.308 1.00111.55 C ANISOU14168 CB GLN A1029 11177 17639 13568 2668 2486 -4224 C ATOM 14169 CG GLN A1029 21.248 -6.466 -45.081 1.00118.10 C ANISOU14169 CG GLN A1029 11842 18517 14514 2765 2411 -4200 C ATOM 14170 CD GLN A1029 21.958 -7.766 -44.742 1.00119.68 C ANISOU14170 CD GLN A1029 11993 18641 14838 2952 2471 -4230 C ATOM 14171 OE1 GLN A1029 21.544 -8.847 -45.160 1.00118.44 O ANISOU14171 OE1 GLN A1029 11951 18348 14701 3018 2545 -4254 O ATOM 14172 NE2 GLN A1029 23.043 -7.662 -43.983 1.00120.32 N ANISOU14172 NE2 GLN A1029 11894 18812 15010 3040 2440 -4232 N ATOM 14173 H GLN A1029 18.592 -6.943 -48.002 1.00127.48 H ATOM 14174 HA GLN A1029 19.296 -8.284 -45.851 1.00128.54 H ATOM 14175 HB2 GLN A1029 20.845 -6.963 -47.026 1.00133.86 H ATOM 14176 HB3 GLN A1029 20.076 -5.662 -46.555 1.00133.86 H ATOM 14177 HG2 GLN A1029 21.925 -5.794 -45.252 1.00141.72 H ATOM 14178 HG3 GLN A1029 20.716 -6.209 -44.311 1.00141.72 H ATOM 14179 HE21 GLN A1029 23.306 -6.889 -43.712 1.00144.39 H ATOM 14180 HE22 GLN A1029 23.482 -8.368 -43.762 1.00144.39 H HETATM14181 N MSE A1030 16.987 -6.280 -45.465 1.00150.70 N ANISOU14181 N MSE A1030 16514 22331 18413 2522 2236 -4063 N HETATM14182 CA MSE A1030 15.949 -5.870 -44.531 1.00146.49 C ANISOU14182 CA MSE A1030 16065 21722 17874 2484 2096 -3967 C HETATM14183 C MSE A1030 15.173 -7.108 -44.089 1.00143.80 C ANISOU14183 C MSE A1030 15848 21184 17606 2585 2087 -3946 C HETATM14184 O MSE A1030 14.995 -7.356 -42.895 1.00137.90 O ANISOU14184 O MSE A1030 15103 20357 16935 2669 2006 -3873 O HETATM14185 CB MSE A1030 15.011 -4.862 -45.198 1.00145.82 C ANISOU14185 CB MSE A1030 16066 21682 17658 2318 2069 -3937 C HETATM14186 CG MSE A1030 14.318 -3.925 -44.232 1.00147.68 C ANISOU14186 CG MSE A1030 16323 21910 17877 2256 1930 -3840 C HETATM14187 SE MSE A1030 13.715 -2.276 -45.076 1.00160.09 SE ANISOU14187 SE MSE A1030 17922 23605 19299 2049 1926 -3801 SE HETATM14188 CE MSE A1030 15.318 -1.194 -44.821 1.00130.75 C ANISOU14188 CE MSE A1030 13970 20085 15623 2029 1955 -3833 C HETATM14189 H MSE A1030 16.785 -6.153 -46.291 1.00180.83 H HETATM14190 HA MSE A1030 16.356 -5.448 -43.758 1.00175.79 H HETATM14191 HB2 MSE A1030 15.525 -4.320 -45.817 1.00174.99 H HETATM14192 HB3 MSE A1030 14.324 -5.348 -45.681 1.00174.99 H HETATM14193 HG2 MSE A1030 13.542 -4.373 -43.860 1.00177.21 H HETATM14194 HG3 MSE A1030 14.936 -3.690 -43.522 1.00177.21 H HETATM14195 HE1 MSE A1030 15.169 -0.314 -45.202 1.00156.90 H HETATM14196 HE2 MSE A1030 15.500 -1.118 -43.872 1.00156.90 H HETATM14197 HE3 MSE A1030 16.064 -1.626 -45.267 1.00156.90 H ATOM 14198 N SER A1031 14.733 -7.888 -45.072 1.00102.18 N ANISOU14198 N SER A1031 10675 15838 12312 2580 2178 -4014 N ATOM 14199 CA SER A1031 13.992 -9.128 -44.843 1.00 97.56 C ANISOU14199 CA SER A1031 10205 15056 11807 2668 2198 -4016 C ATOM 14200 C SER A1031 14.767 -10.125 -43.996 1.00 99.31 C ANISOU14200 C SER A1031 10360 15192 12182 2850 2238 -4002 C ATOM 14201 O SER A1031 14.200 -10.831 -43.162 1.00100.17 O ANISOU14201 O SER A1031 10534 15141 12384 2938 2215 -3937 O ATOM 14202 CB SER A1031 13.656 -9.772 -46.197 1.00 97.45 C ANISOU14202 CB SER A1031 10273 15013 11739 2636 2301 -4132 C ATOM 14203 OG SER A1031 13.345 -11.148 -46.066 1.00100.93 O ANISOU14203 OG SER A1031 10785 15272 12292 2751 2361 -4170 O ATOM 14204 H SER A1031 14.854 -7.716 -45.906 1.00122.62 H ATOM 14205 HA SER A1031 13.160 -8.924 -44.388 1.00117.07 H ATOM 14206 HB2 SER A1031 12.891 -9.314 -46.580 1.00116.93 H ATOM 14207 HB3 SER A1031 14.422 -9.679 -46.785 1.00116.93 H ATOM 14208 HG SER A1031 12.681 -11.246 -45.561 1.00121.12 H ATOM 14209 N LEU A1032 16.075 -10.162 -44.202 1.00127.70 N ANISOU14209 N LEU A1032 13818 18896 15807 2910 2306 -4055 N ATOM 14210 CA LEU A1032 16.883 -11.278 -43.745 1.00131.38 C ANISOU14210 CA LEU A1032 14220 19283 16415 3091 2384 -4066 C ATOM 14211 C LEU A1032 17.321 -11.158 -42.289 1.00131.01 C ANISOU14211 C LEU A1032 14082 19241 16454 3196 2293 -3965 C ATOM 14212 O LEU A1032 17.308 -12.145 -41.553 1.00133.62 O ANISOU14212 O LEU A1032 14430 19431 16909 3346 2321 -3914 O ATOM 14213 CB LEU A1032 18.096 -11.411 -44.657 1.00130.89 C ANISOU14213 CB LEU A1032 14045 19338 16348 3117 2505 -4171 C ATOM 14214 CG LEU A1032 19.113 -12.492 -44.316 1.00138.28 C ANISOU14214 CG LEU A1032 14891 20217 17431 3307 2601 -4191 C ATOM 14215 CD1 LEU A1032 18.500 -13.886 -44.341 1.00139.81 C ANISOU14215 CD1 LEU A1032 15208 20187 17725 3414 2685 -4203 C ATOM 14216 CD2 LEU A1032 20.239 -12.384 -45.307 1.00145.32 C ANISOU14216 CD2 LEU A1032 15670 21252 18293 3303 2715 -4294 C ATOM 14217 H LEU A1032 16.520 -9.548 -44.606 1.00153.24 H ATOM 14218 HA LEU A1032 16.362 -12.092 -43.828 1.00157.66 H ATOM 14219 HB2 LEU A1032 17.777 -11.594 -45.555 1.00157.07 H ATOM 14220 HB3 LEU A1032 18.569 -10.565 -44.654 1.00157.07 H ATOM 14221 HG LEU A1032 19.470 -12.330 -43.429 1.00165.93 H ATOM 14222 HD11 LEU A1032 19.185 -14.536 -44.119 1.00167.77 H ATOM 14223 HD12 LEU A1032 17.782 -13.926 -43.691 1.00167.77 H ATOM 14224 HD13 LEU A1032 18.153 -14.062 -45.230 1.00167.77 H ATOM 14225 HD21 LEU A1032 20.900 -13.065 -45.108 1.00174.39 H ATOM 14226 HD22 LEU A1032 19.886 -12.516 -46.201 1.00174.39 H ATOM 14227 HD23 LEU A1032 20.638 -11.503 -45.236 1.00174.39 H ATOM 14228 N ARG A1033 17.705 -9.959 -41.867 1.00123.54 N ANISOU14228 N ARG A1033 13037 18460 15444 3125 2188 -3937 N ATOM 14229 CA ARG A1033 18.162 -9.773 -40.495 1.00130.68 C ANISOU14229 CA ARG A1033 13843 19402 16409 3225 2084 -3860 C ATOM 14230 C ARG A1033 16.968 -9.662 -39.549 1.00133.21 C ANISOU14230 C ARG A1033 14283 19612 16718 3218 1973 -3750 C ATOM 14231 O ARG A1033 15.974 -9.002 -39.858 1.00131.09 O ANISOU14231 O ARG A1033 14119 19332 16358 3077 1922 -3733 O ATOM 14232 CB ARG A1033 19.076 -8.550 -40.377 1.00134.43 C ANISOU14232 CB ARG A1033 14151 20099 16828 3158 2014 -3893 C ATOM 14233 CG ARG A1033 18.352 -7.219 -40.264 1.00132.54 C ANISOU14233 CG ARG A1033 13950 19935 16475 2993 1898 -3860 C ATOM 14234 CD ARG A1033 19.335 -6.065 -40.213 1.00132.27 C ANISOU14234 CD ARG A1033 13737 20110 16410 2929 1855 -3909 C ATOM 14235 NE ARG A1033 19.582 -5.499 -41.536 1.00136.17 N ANISOU14235 NE ARG A1033 14208 20691 16840 2795 1958 -3978 N ATOM 14236 CZ ARG A1033 20.498 -4.572 -41.794 1.00139.77 C ANISOU14236 CZ ARG A1033 14504 21317 17284 2727 1975 -4030 C ATOM 14237 NH1 ARG A1033 21.267 -4.099 -40.821 1.00139.37 N ANISOU14237 NH1 ARG A1033 14295 21375 17284 2775 1881 -4040 N ATOM 14238 NH2 ARG A1033 20.647 -4.116 -43.029 1.00141.67 N ANISOU14238 NH2 ARG A1033 14739 21626 17464 2613 2089 -4075 N ATOM 14239 H ARG A1033 17.711 -9.246 -42.347 1.00148.25 H ATOM 14240 HA ARG A1033 18.677 -10.552 -40.231 1.00156.82 H ATOM 14241 HB2 ARG A1033 19.627 -8.651 -39.585 1.00161.32 H ATOM 14242 HB3 ARG A1033 19.642 -8.509 -41.164 1.00161.32 H ATOM 14243 HG2 ARG A1033 17.780 -7.098 -41.038 1.00159.05 H ATOM 14244 HG3 ARG A1033 17.826 -7.208 -39.450 1.00159.05 H ATOM 14245 HD2 ARG A1033 18.974 -5.365 -39.647 1.00158.73 H ATOM 14246 HD3 ARG A1033 20.180 -6.382 -39.857 1.00158.73 H ATOM 14247 HE ARG A1033 19.103 -5.785 -42.191 1.00163.41 H ATOM 14248 HH11 ARG A1033 21.173 -4.392 -40.018 1.00167.24 H ATOM 14249 HH12 ARG A1033 21.858 -3.499 -40.994 1.00167.24 H ATOM 14250 HH21 ARG A1033 20.152 -4.421 -43.662 1.00170.01 H ATOM 14251 HH22 ARG A1033 21.241 -3.517 -43.197 1.00170.01 H ATOM 14252 N ARG A1034 17.077 -10.326 -38.401 1.00130.96 N ANISOU14252 N ARG A1034 13981 19248 16531 3377 1943 -3671 N ATOM 14253 CA ARG A1034 16.000 -10.380 -37.417 1.00127.90 C ANISOU14253 CA ARG A1034 13702 18743 16150 3401 1858 -3555 C ATOM 14254 C ARG A1034 16.530 -10.166 -36.003 1.00125.41 C ANISOU14254 C ARG A1034 13285 18510 15857 3526 1741 -3481 C ATOM 14255 O ARG A1034 17.010 -11.103 -35.365 1.00126.07 O ANISOU14255 O ARG A1034 13323 18528 16052 3704 1784 -3436 O ATOM 14256 CB ARG A1034 15.302 -11.739 -37.487 1.00127.80 C ANISOU14256 CB ARG A1034 13815 18490 16254 3492 1976 -3517 C ATOM 14257 CG ARG A1034 14.646 -12.044 -38.826 1.00127.55 C ANISOU14257 CG ARG A1034 13898 18373 16191 3381 2076 -3602 C ATOM 14258 CD ARG A1034 14.378 -13.532 -38.975 1.00128.91 C ANISOU14258 CD ARG A1034 14146 18326 16508 3505 2222 -3603 C ATOM 14259 NE ARG A1034 13.017 -13.818 -39.419 1.00132.89 N ANISOU14259 NE ARG A1034 14815 18679 17000 3423 2245 -3605 N ATOM 14260 CZ ARG A1034 12.501 -15.041 -39.491 1.00135.48 C ANISOU14260 CZ ARG A1034 15229 18793 17453 3513 2361 -3602 C ATOM 14261 NH1 ARG A1034 13.233 -16.093 -39.146 1.00142.82 N ANISOU14261 NH1 ARG A1034 16104 19626 18536 3691 2475 -3584 N ATOM 14262 NH2 ARG A1034 11.252 -15.217 -39.903 1.00123.70 N ANISOU14262 NH2 ARG A1034 13875 17184 15943 3430 2366 -3617 N ATOM 14263 H ARG A1034 17.780 -10.762 -38.165 1.00157.16 H ATOM 14264 HA ARG A1034 15.349 -9.688 -37.610 1.00153.48 H ATOM 14265 HB2 ARG A1034 15.957 -12.433 -37.315 1.00153.36 H ATOM 14266 HB3 ARG A1034 14.610 -11.767 -36.807 1.00153.36 H ATOM 14267 HG2 ARG A1034 13.800 -11.574 -38.885 1.00153.06 H ATOM 14268 HG3 ARG A1034 15.237 -11.767 -39.544 1.00153.06 H ATOM 14269 HD2 ARG A1034 14.991 -13.900 -39.631 1.00154.69 H ATOM 14270 HD3 ARG A1034 14.511 -13.965 -38.117 1.00154.69 H ATOM 14271 HE ARG A1034 12.545 -13.164 -39.715 1.00159.47 H ATOM 14272 HH11 ARG A1034 14.043 -15.984 -38.878 1.00171.39 H ATOM 14273 HH12 ARG A1034 12.898 -16.884 -39.193 1.00171.39 H ATOM 14274 HH21 ARG A1034 10.774 -14.538 -40.127 1.00148.44 H ATOM 14275 HH22 ARG A1034 10.922 -16.009 -39.949 1.00148.44 H ATOM 14276 N GLU A1035 16.434 -8.933 -35.513 1.00147.20 N ANISOU14276 N GLU A1035 16006 21414 18508 3439 1595 -3471 N ATOM 14277 CA GLU A1035 16.851 -8.619 -34.151 1.00148.79 C ANISOU14277 CA GLU A1035 16117 21718 18698 3552 1460 -3415 C ATOM 14278 C GLU A1035 16.214 -7.318 -33.670 1.00142.27 C ANISOU14278 C GLU A1035 15320 20987 17748 3432 1308 -3394 C ATOM 14279 O GLU A1035 15.526 -7.291 -32.650 1.00140.28 O ANISOU14279 O GLU A1035 15138 20689 17473 3490 1219 -3297 O ATOM 14280 CB GLU A1035 18.381 -8.544 -34.049 1.00155.60 C ANISOU14280 CB GLU A1035 16774 22757 19590 3638 1452 -3494 C ATOM 14281 CG GLU A1035 19.031 -7.268 -34.601 1.00155.27 C ANISOU14281 CG GLU A1035 16609 22920 19467 3489 1404 -3605 C ATOM 14282 CD GLU A1035 18.999 -7.178 -36.118 1.00158.70 C ANISOU14282 CD GLU A1035 17076 23330 19891 3344 1538 -3681 C ATOM 14283 OE1 GLU A1035 18.686 -8.193 -36.776 1.00158.24 O ANISOU14283 OE1 GLU A1035 17115 23118 19892 3378 1668 -3675 O ATOM 14284 OE2 GLU A1035 19.295 -6.089 -36.653 1.00161.67 O ANISOU14284 OE2 GLU A1035 17380 23845 20202 3201 1518 -3751 O ATOM 14285 H GLU A1035 16.130 -8.259 -35.952 1.00176.64 H ATOM 14286 HA GLU A1035 16.550 -9.329 -33.562 1.00178.55 H ATOM 14287 HB2 GLU A1035 18.629 -8.612 -33.114 1.00186.72 H ATOM 14288 HB3 GLU A1035 18.757 -9.293 -34.537 1.00186.72 H ATOM 14289 HG2 GLU A1035 18.560 -6.497 -34.248 1.00186.33 H ATOM 14290 HG3 GLU A1035 19.960 -7.242 -34.322 1.00186.33 H ATOM 14291 N VAL A1037 13.544 -5.098 -32.440 1.00 95.53 N ANISOU14291 N VAL A1037 9641 15056 11599 3199 1031 -3242 N ATOM 14292 CA VAL A1037 14.046 -3.809 -32.902 1.00 95.25 C ANISOU14292 CA VAL A1037 9502 15195 11494 3057 981 -3340 C ATOM 14293 C VAL A1037 13.649 -3.595 -34.363 1.00 93.30 C ANISOU14293 C VAL A1037 9317 14897 11237 2886 1091 -3383 C ATOM 14294 O VAL A1037 13.223 -2.506 -34.746 1.00 83.60 O ANISOU14294 O VAL A1037 8104 13721 9939 2733 1058 -3397 O ATOM 14295 CB VAL A1037 15.574 -3.712 -32.725 1.00 98.74 C ANISOU14295 CB VAL A1037 9740 15815 11961 3133 961 -3440 C ATOM 14296 CG1 VAL A1037 16.105 -2.380 -33.250 1.00 96.18 C ANISOU14296 CG1 VAL A1037 9296 15657 11590 2975 933 -3547 C ATOM 14297 CG2 VAL A1037 15.942 -3.893 -31.254 1.00 96.57 C ANISOU14297 CG2 VAL A1037 9404 15614 11673 3312 836 -3400 C ATOM 14298 HA VAL A1037 13.638 -3.104 -32.375 1.00114.30 H ATOM 14299 HB VAL A1037 15.997 -4.424 -33.230 1.00118.49 H ATOM 14300 HG11 VAL A1037 17.066 -2.352 -33.125 1.00115.41 H ATOM 14301 HG12 VAL A1037 15.892 -2.306 -34.194 1.00115.41 H ATOM 14302 HG13 VAL A1037 15.685 -1.657 -32.758 1.00115.41 H ATOM 14303 HG21 VAL A1037 16.905 -3.829 -31.160 1.00115.88 H ATOM 14304 HG22 VAL A1037 15.512 -3.196 -30.734 1.00115.88 H ATOM 14305 HG23 VAL A1037 15.636 -4.764 -30.957 1.00115.88 H ATOM 14306 N TRP A1038 13.801 -4.640 -35.171 1.00 95.56 N ANISOU14306 N TRP A1038 9636 15084 11589 2921 1225 -3404 N ATOM 14307 CA TRP A1038 13.174 -4.703 -36.486 1.00 93.63 C ANISOU14307 CA TRP A1038 9490 14762 11322 2789 1327 -3430 C ATOM 14308 C TRP A1038 11.959 -5.617 -36.363 1.00 89.78 C ANISOU14308 C TRP A1038 9173 14066 10874 2827 1363 -3348 C ATOM 14309 O TRP A1038 11.376 -6.038 -37.362 1.00 89.03 O ANISOU14309 O TRP A1038 9171 13877 10778 2760 1453 -3374 O ATOM 14310 CB TRP A1038 14.144 -5.247 -37.542 1.00 97.68 C ANISOU14310 CB TRP A1038 9925 15314 11875 2801 1458 -3529 C ATOM 14311 CG TRP A1038 15.245 -4.299 -37.898 1.00 98.61 C ANISOU14311 CG TRP A1038 9878 15629 11959 2734 1452 -3614 C ATOM 14312 CD1 TRP A1038 16.354 -4.022 -37.157 1.00101.14 C ANISOU14312 CD1 TRP A1038 10031 16085 12311 2814 1392 -3651 C ATOM 14313 CD2 TRP A1038 15.347 -3.506 -39.088 1.00 95.98 C ANISOU14313 CD2 TRP A1038 9524 15382 11560 2576 1517 -3674 C ATOM 14314 NE1 TRP A1038 17.139 -3.101 -37.807 1.00102.92 N ANISOU14314 NE1 TRP A1038 10128 16468 12510 2707 1421 -3735 N ATOM 14315 CE2 TRP A1038 16.544 -2.769 -38.995 1.00 98.89 C ANISOU14315 CE2 TRP A1038 9707 15927 11940 2563 1506 -3742 C ATOM 14316 CE3 TRP A1038 14.542 -3.346 -40.221 1.00 91.22 C ANISOU14316 CE3 TRP A1038 9038 14733 10890 2450 1587 -3675 C ATOM 14317 CZ2 TRP A1038 16.955 -1.885 -39.991 1.00 98.77 C ANISOU14317 CZ2 TRP A1038 9621 16026 11880 2426 1578 -3800 C ATOM 14318 CZ3 TRP A1038 14.953 -2.467 -41.207 1.00 92.08 C ANISOU14318 CZ3 TRP A1038 9082 14968 10937 2324 1650 -3728 C ATOM 14319 CH2 TRP A1038 16.148 -1.749 -41.086 1.00 98.24 C ANISOU14319 CH2 TRP A1038 9680 15909 11740 2312 1654 -3784 C ATOM 14320 H TRP A1038 14.269 -5.335 -34.976 1.00114.68 H ATOM 14321 HA TRP A1038 12.878 -3.819 -36.755 1.00112.35 H ATOM 14322 HB2 TRP A1038 14.551 -6.060 -37.203 1.00117.22 H ATOM 14323 HB3 TRP A1038 13.647 -5.442 -38.352 1.00117.22 H ATOM 14324 HD1 TRP A1038 16.549 -4.398 -36.329 1.00121.36 H ATOM 14325 HE1 TRP A1038 17.884 -2.786 -37.517 1.00123.51 H ATOM 14326 HE3 TRP A1038 13.746 -3.819 -40.308 1.00109.47 H ATOM 14327 HZ2 TRP A1038 17.749 -1.407 -39.914 1.00118.52 H ATOM 14328 HZ3 TRP A1038 14.426 -2.352 -41.965 1.00110.50 H ATOM 14329 HH2 TRP A1038 16.399 -1.166 -41.767 1.00117.89 H ATOM 14330 N LEU A1039 11.587 -5.916 -35.120 1.00 89.28 N ANISOU14330 N LEU A1039 9143 13937 10844 2940 1292 -3253 N ATOM 14331 CA LEU A1039 10.509 -6.857 -34.824 1.00 87.45 C ANISOU14331 CA LEU A1039 9053 13496 10677 2998 1338 -3165 C ATOM 14332 C LEU A1039 9.118 -6.473 -35.350 1.00 87.14 C ANISOU14332 C LEU A1039 9157 13367 10586 2854 1336 -3134 C ATOM 14333 O LEU A1039 8.315 -7.361 -35.639 1.00 88.01 O ANISOU14333 O LEU A1039 9374 13305 10762 2870 1418 -3111 O ATOM 14334 CB LEU A1039 10.428 -7.099 -33.315 1.00 90.65 C ANISOU14334 CB LEU A1039 9454 13875 11114 3149 1260 -3058 C ATOM 14335 CG LEU A1039 11.354 -8.184 -32.761 1.00 94.27 C ANISOU14335 CG LEU A1039 9831 14306 11679 3345 1315 -3045 C ATOM 14336 CD1 LEU A1039 11.403 -8.129 -31.242 1.00 92.52 C ANISOU14336 CD1 LEU A1039 9583 14126 11444 3488 1204 -2944 C ATOM 14337 CD2 LEU A1039 10.922 -9.574 -33.220 1.00 95.64 C ANISOU14337 CD2 LEU A1039 10090 14256 11992 3406 1476 -3026 C ATOM 14338 H LEU A1039 11.951 -5.579 -34.418 1.00107.14 H ATOM 14339 HA LEU A1039 10.738 -7.705 -35.234 1.00104.94 H ATOM 14340 HB2 LEU A1039 10.648 -6.271 -32.860 1.00108.78 H ATOM 14341 HB3 LEU A1039 9.518 -7.355 -33.096 1.00108.78 H ATOM 14342 HG LEU A1039 12.252 -8.028 -33.092 1.00113.12 H ATOM 14343 HD11 LEU A1039 11.995 -8.826 -30.920 1.00111.02 H ATOM 14344 HD12 LEU A1039 11.734 -7.260 -30.969 1.00111.02 H ATOM 14345 HD13 LEU A1039 10.508 -8.268 -30.893 1.00111.02 H ATOM 14346 HD21 LEU A1039 11.531 -10.232 -32.850 1.00114.76 H ATOM 14347 HD22 LEU A1039 10.020 -9.744 -32.906 1.00114.76 H ATOM 14348 HD23 LEU A1039 10.947 -9.608 -34.189 1.00114.76 H ATOM 14349 N PRO A1040 8.811 -5.165 -35.451 1.00 83.04 N ANISOU14349 N PRO A1040 8634 12959 9959 2720 1245 -3133 N ATOM 14350 CA PRO A1040 7.504 -4.805 -36.015 1.00 76.17 C ANISOU14350 CA PRO A1040 7892 12009 9040 2588 1246 -3102 C ATOM 14351 C PRO A1040 7.286 -5.383 -37.412 1.00 75.90 C ANISOU14351 C PRO A1040 7909 11918 9011 2519 1360 -3182 C ATOM 14352 O PRO A1040 6.196 -5.857 -37.736 1.00 71.84 O ANISOU14352 O PRO A1040 7512 11271 8514 2488 1395 -3161 O ATOM 14353 CB PRO A1040 7.570 -3.279 -36.098 1.00 72.94 C ANISOU14353 CB PRO A1040 7434 11756 8525 2459 1157 -3110 C ATOM 14354 CG PRO A1040 8.525 -2.878 -35.046 1.00 68.98 C ANISOU14354 CG PRO A1040 6810 11375 8024 2548 1072 -3112 C ATOM 14355 CD PRO A1040 9.531 -3.982 -34.940 1.00 81.97 C ANISOU14355 CD PRO A1040 8381 13010 9753 2692 1137 -3154 C ATOM 14356 HA PRO A1040 6.783 -5.075 -35.425 1.00 91.40 H ATOM 14357 HB2 PRO A1040 7.892 -3.013 -36.974 1.00 87.53 H ATOM 14358 HB3 PRO A1040 6.692 -2.904 -35.926 1.00 87.53 H ATOM 14359 HG2 PRO A1040 8.959 -2.048 -35.302 1.00 82.78 H ATOM 14360 HG3 PRO A1040 8.053 -2.768 -34.206 1.00 82.78 H ATOM 14361 HD2 PRO A1040 10.302 -3.791 -35.497 1.00 98.36 H ATOM 14362 HD3 PRO A1040 9.787 -4.118 -34.014 1.00 98.36 H ATOM 14363 N LEU A1041 8.335 -5.341 -38.224 1.00 94.24 N ANISOU14363 N LEU A1041 10137 14352 11317 2501 1417 -3282 N ATOM 14364 CA LEU A1041 8.264 -5.770 -39.615 1.00 93.58 C ANISOU14364 CA LEU A1041 10090 14255 11212 2435 1519 -3374 C ATOM 14365 C LEU A1041 8.087 -7.281 -39.742 1.00 91.93 C ANISOU14365 C LEU A1041 9940 13878 11111 2545 1617 -3403 C ATOM 14366 O LEU A1041 7.326 -7.755 -40.586 1.00 91.16 O ANISOU14366 O LEU A1041 9933 13700 11003 2494 1671 -3451 O ATOM 14367 CB LEU A1041 9.526 -5.317 -40.349 1.00 92.35 C ANISOU14367 CB LEU A1041 9806 14268 11014 2402 1563 -3465 C ATOM 14368 CG LEU A1041 9.710 -5.738 -41.805 1.00 85.89 C ANISOU14368 CG LEU A1041 9002 13472 10159 2353 1676 -3572 C ATOM 14369 CD1 LEU A1041 8.656 -5.110 -42.713 1.00 79.67 C ANISOU14369 CD1 LEU A1041 8309 12700 9260 2203 1665 -3572 C ATOM 14370 CD2 LEU A1041 11.113 -5.356 -42.242 1.00 87.39 C ANISOU14370 CD2 LEU A1041 9047 13825 10334 2354 1727 -3644 C ATOM 14371 H LEU A1041 9.114 -5.063 -37.988 1.00113.09 H ATOM 14372 HA LEU A1041 7.502 -5.343 -40.038 1.00112.30 H ATOM 14373 HB2 LEU A1041 9.547 -4.348 -40.332 1.00110.82 H ATOM 14374 HB3 LEU A1041 10.291 -5.658 -39.860 1.00110.82 H ATOM 14375 HG LEU A1041 9.627 -6.702 -41.870 1.00103.06 H ATOM 14376 HD11 LEU A1041 8.810 -5.403 -43.624 1.00 95.60 H ATOM 14377 HD12 LEU A1041 7.777 -5.394 -42.418 1.00 95.60 H ATOM 14378 HD13 LEU A1041 8.728 -4.144 -42.658 1.00 95.60 H ATOM 14379 HD21 LEU A1041 11.238 -5.620 -43.167 1.00104.87 H ATOM 14380 HD22 LEU A1041 11.221 -4.396 -42.154 1.00104.87 H ATOM 14381 HD23 LEU A1041 11.755 -5.814 -41.677 1.00104.87 H HETATM14382 N MSE A1042 8.792 -8.035 -38.905 1.00125.14 N ANISOU14382 N MSE A1042 14089 18035 15424 2700 1643 -3378 N HETATM14383 CA MSE A1042 8.667 -9.486 -38.900 1.00130.01 C ANISOU14383 CA MSE A1042 14756 18474 16169 2822 1752 -3390 C HETATM14384 C MSE A1042 7.269 -9.892 -38.455 1.00129.79 C ANISOU14384 C MSE A1042 14859 18266 16190 2822 1745 -3310 C HETATM14385 O MSE A1042 6.634 -10.744 -39.074 1.00132.21 O ANISOU14385 O MSE A1042 15248 18438 16549 2822 1829 -3361 O HETATM14386 CB MSE A1042 9.686 -10.106 -37.951 1.00136.13 C ANISOU14386 CB MSE A1042 15435 19237 17052 2998 1777 -3351 C HETATM14387 CG MSE A1042 11.122 -9.749 -38.253 1.00145.26 C ANISOU14387 CG MSE A1042 16443 20571 18178 3015 1782 -3427 C HETATM14388 SE MSE A1042 12.259 -10.107 -36.713 1.00165.50 SE ANISOU14388 SE MSE A1042 18868 23172 20841 3228 1742 -3349 SE HETATM14389 CE MSE A1042 11.724 -11.952 -36.354 1.00146.96 C ANISOU14389 CE MSE A1042 16616 20529 18692 3403 1892 -3284 C HETATM14390 H MSE A1042 9.351 -7.728 -38.328 1.00150.17 H HETATM14391 HA MSE A1042 8.833 -9.827 -39.793 1.00156.02 H HETATM14392 HB2 MSE A1042 9.492 -9.805 -37.049 1.00163.36 H HETATM14393 HB3 MSE A1042 9.607 -11.071 -37.997 1.00163.36 H HETATM14394 HG2 MSE A1042 11.437 -10.284 -38.998 1.00174.31 H HETATM14395 HG3 MSE A1042 11.182 -8.805 -38.465 1.00174.31 H HETATM14396 HE1 MSE A1042 12.221 -12.281 -35.588 1.00176.35 H HETATM14397 HE2 MSE A1042 10.773 -11.973 -36.165 1.00176.35 H HETATM14398 HE3 MSE A1042 11.920 -12.495 -37.134 1.00176.35 H ATOM 14399 N SER A1043 6.803 -9.275 -37.373 1.00 99.83 N ANISOU14399 N SER A1043 11079 14474 12378 2827 1646 -3193 N ATOM 14400 CA SER A1043 5.496 -9.581 -36.802 1.00 94.26 C ANISOU14400 CA SER A1043 10487 13604 11726 2835 1640 -3099 C ATOM 14401 C SER A1043 4.379 -9.347 -37.810 1.00 94.98 C ANISOU14401 C SER A1043 10675 13662 11749 2689 1641 -3152 C ATOM 14402 O SER A1043 3.456 -10.153 -37.925 1.00 99.34 O ANISOU14402 O SER A1043 11316 14047 12382 2708 1702 -3150 O ATOM 14403 CB SER A1043 5.252 -8.724 -35.560 1.00 92.29 C ANISOU14403 CB SER A1043 10227 13407 11432 2848 1518 -2977 C ATOM 14404 OG SER A1043 6.168 -9.045 -34.527 1.00 92.42 O ANISOU14404 OG SER A1043 10157 13450 11509 3002 1506 -2925 O ATOM 14405 H SER A1043 7.233 -8.665 -36.946 1.00119.79 H ATOM 14406 HA SER A1043 5.474 -10.514 -36.536 1.00113.12 H ATOM 14407 HB2 SER A1043 5.359 -7.790 -35.796 1.00110.75 H ATOM 14408 HB3 SER A1043 4.350 -8.883 -35.241 1.00110.75 H ATOM 14409 HG SER A1043 6.955 -8.911 -34.789 1.00110.91 H ATOM 14410 N TYR A1044 4.462 -8.230 -38.527 1.00108.26 N ANISOU14410 N TYR A1044 12334 15510 13292 2549 1574 -3199 N ATOM 14411 CA TYR A1044 3.503 -7.914 -39.580 1.00108.37 C ANISOU14411 CA TYR A1044 12423 15530 13223 2410 1567 -3254 C ATOM 14412 C TYR A1044 3.553 -8.969 -40.684 1.00116.62 C ANISOU14412 C TYR A1044 13491 16515 14306 2421 1672 -3389 C ATOM 14413 O TYR A1044 2.546 -9.251 -41.335 1.00116.81 O ANISOU14413 O TYR A1044 13594 16474 14316 2358 1682 -3441 O ATOM 14414 CB TYR A1044 3.804 -6.529 -40.167 1.00106.70 C ANISOU14414 CB TYR A1044 12162 15515 12863 2275 1499 -3271 C ATOM 14415 CG TYR A1044 2.810 -6.045 -41.209 1.00101.23 C ANISOU14415 CG TYR A1044 11540 14854 12071 2133 1482 -3308 C ATOM 14416 CD1 TYR A1044 1.495 -6.492 -41.212 1.00 99.20 C ANISOU14416 CD1 TYR A1044 11384 14463 11844 2115 1477 -3292 C ATOM 14417 CD2 TYR A1044 3.192 -5.140 -42.193 1.00 97.08 C ANISOU14417 CD2 TYR A1044 10970 14494 11421 2022 1478 -3357 C ATOM 14418 CE1 TYR A1044 0.590 -6.053 -42.163 1.00 94.37 C ANISOU14418 CE1 TYR A1044 10824 13896 11137 1992 1453 -3331 C ATOM 14419 CE2 TYR A1044 2.293 -4.693 -43.146 1.00 92.38 C ANISOU14419 CE2 TYR A1044 10434 13939 10725 1903 1465 -3382 C ATOM 14420 CZ TYR A1044 0.995 -5.153 -43.126 1.00 90.57 C ANISOU14420 CZ TYR A1044 10301 13588 10523 1890 1445 -3372 C ATOM 14421 OH TYR A1044 0.100 -4.714 -44.073 1.00 91.84 O ANISOU14421 OH TYR A1044 10512 13804 10581 1778 1423 -3403 O ATOM 14422 H TYR A1044 5.072 -7.633 -38.421 1.00129.92 H ATOM 14423 HA TYR A1044 2.607 -7.902 -39.208 1.00130.05 H ATOM 14424 HB2 TYR A1044 3.808 -5.882 -39.444 1.00128.04 H ATOM 14425 HB3 TYR A1044 4.678 -6.555 -40.586 1.00128.04 H ATOM 14426 HD1 TYR A1044 1.217 -7.099 -40.564 1.00119.04 H ATOM 14427 HD2 TYR A1044 4.068 -4.827 -42.210 1.00116.50 H ATOM 14428 HE1 TYR A1044 -0.287 -6.361 -42.151 1.00113.25 H ATOM 14429 HE2 TYR A1044 2.564 -4.088 -43.798 1.00110.85 H ATOM 14430 HH TYR A1044 0.475 -4.173 -44.594 1.00110.21 H ATOM 14431 N ARG A1045 4.729 -9.560 -40.881 1.00 92.32 N ANISOU14431 N ARG A1045 10339 13464 11275 2508 1747 -3455 N ATOM 14432 CA ARG A1045 4.935 -10.522 -41.960 1.00 89.64 C ANISOU14432 CA ARG A1045 10011 13086 10963 2526 1850 -3598 C ATOM 14433 C ARG A1045 4.399 -11.916 -41.632 1.00 90.54 C ANISOU14433 C ARG A1045 10191 12973 11236 2641 1935 -3605 C ATOM 14434 O ARG A1045 3.876 -12.599 -42.511 1.00 96.21 O ANISOU14434 O ARG A1045 10963 13626 11968 2616 1985 -3724 O ATOM 14435 CB ARG A1045 6.417 -10.603 -42.329 1.00 94.11 C ANISOU14435 CB ARG A1045 10467 13767 11521 2578 1908 -3667 C ATOM 14436 CG ARG A1045 6.860 -9.557 -43.341 1.00 97.78 C ANISOU14436 CG ARG A1045 10882 14441 11830 2447 1882 -3732 C ATOM 14437 CD ARG A1045 8.123 -9.996 -44.056 1.00103.21 C ANISOU14437 CD ARG A1045 11484 15208 12524 2500 1980 -3841 C ATOM 14438 NE ARG A1045 9.284 -10.026 -43.170 1.00104.68 N ANISOU14438 NE ARG A1045 11561 15426 12787 2613 1988 -3789 N ATOM 14439 CZ ARG A1045 10.387 -10.733 -43.402 1.00100.96 C ANISOU14439 CZ ARG A1045 11013 14967 12381 2715 2085 -3859 C ATOM 14440 NH1 ARG A1045 10.486 -11.488 -44.489 1.00 99.04 N ANISOU14440 NH1 ARG A1045 10797 14700 12135 2722 2187 -3987 N ATOM 14441 NH2 ARG A1045 11.392 -10.692 -42.537 1.00 97.59 N ANISOU14441 NH2 ARG A1045 10477 14581 12022 2817 2077 -3806 N ATOM 14442 H ARG A1045 5.428 -9.419 -40.401 1.00110.79 H ATOM 14443 HA ARG A1045 4.458 -10.208 -42.744 1.00107.57 H ATOM 14444 HB2 ARG A1045 6.946 -10.479 -41.526 1.00112.93 H ATOM 14445 HB3 ARG A1045 6.597 -11.477 -42.709 1.00112.93 H ATOM 14446 HG2 ARG A1045 6.161 -9.434 -44.003 1.00117.34 H ATOM 14447 HG3 ARG A1045 7.042 -8.722 -42.883 1.00117.34 H ATOM 14448 HD2 ARG A1045 7.993 -10.889 -44.412 1.00123.85 H ATOM 14449 HD3 ARG A1045 8.311 -9.375 -44.778 1.00123.85 H ATOM 14450 HE ARG A1045 9.252 -9.556 -42.451 1.00125.62 H ATOM 14451 HH11 ARG A1045 9.837 -11.517 -45.052 1.00118.85 H ATOM 14452 HH12 ARG A1045 11.201 -11.944 -44.631 1.00118.85 H ATOM 14453 HH21 ARG A1045 11.331 -10.206 -41.830 1.00117.11 H ATOM 14454 HH22 ARG A1045 12.104 -11.152 -42.684 1.00117.11 H ATOM 14455 N ASN A1046 4.533 -12.340 -40.377 1.00110.74 N ANISOU14455 N ASN A1046 12741 15415 13919 2772 1955 -3482 N ATOM 14456 CA ASN A1046 3.968 -13.617 -39.944 1.00118.01 C ANISOU14456 CA ASN A1046 13725 16102 15009 2892 2051 -3455 C ATOM 14457 C ASN A1046 2.474 -13.691 -40.226 1.00118.77 C ANISOU14457 C ASN A1046 13926 16097 15103 2808 2025 -3471 C ATOM 14458 O ASN A1046 1.946 -14.744 -40.586 1.00120.86 O ANISOU14458 O ASN A1046 14245 16206 15470 2854 2105 -3545 O ATOM 14459 CB ASN A1046 4.203 -13.838 -38.449 1.00119.94 C ANISOU14459 CB ASN A1046 13944 16254 15373 3033 2066 -3285 C ATOM 14460 CG ASN A1046 5.641 -14.186 -38.130 1.00122.69 C ANISOU14460 CG ASN A1046 14184 16655 15778 3159 2119 -3282 C ATOM 14461 OD1 ASN A1046 6.540 -13.362 -38.284 1.00127.87 O ANISOU14461 OD1 ASN A1046 14752 17507 16327 3114 2051 -3313 O ATOM 14462 ND2 ASN A1046 5.864 -15.412 -37.676 1.00118.85 N ANISOU14462 ND2 ASN A1046 13697 15990 15469 3325 2249 -3241 N ATOM 14463 H ASN A1046 4.946 -11.908 -39.758 1.00132.88 H ATOM 14464 HA ASN A1046 4.403 -14.337 -40.428 1.00141.61 H ATOM 14465 HB2 ASN A1046 3.977 -13.026 -37.970 1.00143.93 H ATOM 14466 HB3 ASN A1046 3.643 -14.570 -38.146 1.00143.93 H ATOM 14467 HD21 ASN A1046 6.664 -15.659 -37.480 1.00142.62 H ATOM 14468 HD22 ASN A1046 5.209 -15.961 -37.578 1.00142.62 H ATOM 14469 N SER A1047 1.803 -12.556 -40.072 1.00 99.74 N ANISOU14469 N SER A1047 11538 13780 12579 2687 1910 -3409 N ATOM 14470 CA SER A1047 0.354 -12.494 -40.179 1.00 94.07 C ANISOU14470 CA SER A1047 10907 12976 11858 2610 1872 -3402 C ATOM 14471 C SER A1047 -0.113 -12.445 -41.628 1.00100.68 C ANISOU14471 C SER A1047 11766 13890 12599 2481 1851 -3578 C ATOM 14472 O SER A1047 -1.314 -12.485 -41.897 1.00104.82 O ANISOU14472 O SER A1047 12349 14354 13123 2413 1818 -3609 O ATOM 14473 CB SER A1047 -0.158 -11.259 -39.448 1.00 89.86 C ANISOU14473 CB SER A1047 10385 12520 11238 2537 1759 -3265 C ATOM 14474 OG SER A1047 0.398 -10.084 -40.011 1.00 85.72 O ANISOU14474 OG SER A1047 9808 12213 10549 2424 1678 -3296 O ATOM 14475 H SER A1047 2.171 -11.797 -39.902 1.00119.69 H ATOM 14476 HA SER A1047 -0.032 -13.279 -39.761 1.00112.88 H ATOM 14477 HB2 SER A1047 -1.124 -11.222 -39.527 1.00107.83 H ATOM 14478 HB3 SER A1047 0.098 -11.315 -38.514 1.00107.83 H ATOM 14479 HG SER A1047 1.235 -10.105 -39.950 1.00102.86 H ATOM 14480 N LEU A1048 0.829 -12.349 -42.559 1.00 84.18 N ANISOU14480 N LEU A1048 9620 11940 10426 2450 1870 -3694 N ATOM 14481 CA LEU A1048 0.486 -12.289 -43.976 1.00 79.56 C ANISOU14481 CA LEU A1048 9045 11450 9735 2334 1856 -3863 C ATOM 14482 C LEU A1048 0.822 -13.599 -44.690 1.00 77.50 C ANISOU14482 C LEU A1048 8780 11102 9563 2405 1959 -4033 C ATOM 14483 O LEU A1048 1.697 -14.352 -44.253 1.00 75.71 O ANISOU14483 O LEU A1048 8524 10794 9449 2540 2048 -4019 O ATOM 14484 CB LEU A1048 1.196 -11.112 -44.652 1.00 74.32 C ANISOU14484 CB LEU A1048 8324 11023 8891 2233 1808 -3872 C ATOM 14485 CG LEU A1048 0.794 -9.708 -44.188 1.00 65.88 C ANISOU14485 CG LEU A1048 7258 10057 7718 2140 1702 -3732 C ATOM 14486 CD1 LEU A1048 1.776 -8.663 -44.693 1.00 65.82 C ANISOU14486 CD1 LEU A1048 7176 10258 7575 2076 1685 -3728 C ATOM 14487 CD2 LEU A1048 -0.623 -9.371 -44.640 1.00 64.88 C ANISOU14487 CD2 LEU A1048 7198 9925 7528 2030 1636 -3749 C TER 14488 LEU A1048 ATOM 14489 N LYS B 321 -16.799 -37.679 -24.828 1.00 83.04 N ANISOU14489 N LYS B 321 9070 11135 11348 -37 1899 -1642 N ATOM 14490 CA LYS B 321 -17.195 -37.199 -23.509 1.00 89.64 C ANISOU14490 CA LYS B 321 9909 11914 12238 -18 1828 -1506 C ATOM 14491 C LYS B 321 -18.665 -36.779 -23.489 1.00 86.36 C ANISOU14491 C LYS B 321 9533 11576 11702 -25 1804 -1429 C ATOM 14492 O LYS B 321 -19.116 -36.010 -24.339 1.00 81.42 O ANISOU14492 O LYS B 321 8964 11065 10906 -39 1848 -1393 O ATOM 14493 CB LYS B 321 -16.291 -36.046 -23.071 1.00 93.15 C ANISOU14493 CB LYS B 321 10374 12346 12674 -6 1843 -1395 C ATOM 14494 CG LYS B 321 -14.901 -36.505 -22.663 1.00 97.06 C ANISOU14494 CG LYS B 321 10814 12736 13329 5 1840 -1457 C ATOM 14495 CD LYS B 321 -14.015 -35.349 -22.219 1.00 95.72 C ANISOU14495 CD LYS B 321 10656 12553 13159 15 1851 -1357 C ATOM 14496 CE LYS B 321 -13.496 -34.536 -23.399 1.00 92.76 C ANISOU14496 CE LYS B 321 10312 12274 12657 -6 1948 -1356 C ATOM 14497 NZ LYS B 321 -12.731 -33.335 -22.956 1.00 89.88 N ANISOU14497 NZ LYS B 321 9956 11897 12297 0 1957 -1255 N ATOM 14498 HA LYS B 321 -17.086 -37.920 -22.870 1.00107.57 H ATOM 14499 HB2 LYS B 321 -16.196 -35.422 -23.808 1.00111.78 H ATOM 14500 HB3 LYS B 321 -16.695 -35.601 -22.310 1.00111.78 H ATOM 14501 HG2 LYS B 321 -14.977 -37.128 -21.924 1.00116.47 H ATOM 14502 HG3 LYS B 321 -14.475 -36.937 -23.420 1.00116.47 H ATOM 14503 HD2 LYS B 321 -14.529 -34.757 -21.647 1.00114.86 H ATOM 14504 HD3 LYS B 321 -13.252 -35.701 -21.735 1.00114.86 H ATOM 14505 HE2 LYS B 321 -12.906 -35.090 -23.933 1.00111.31 H ATOM 14506 HE3 LYS B 321 -14.247 -34.235 -23.934 1.00111.31 H ATOM 14507 HZ1 LYS B 321 -12.441 -32.881 -23.665 1.00107.85 H ATOM 14508 HZ2 LYS B 321 -13.253 -32.805 -22.467 1.00107.85 H ATOM 14509 HZ3 LYS B 321 -12.031 -33.584 -22.466 1.00107.85 H ATOM 14510 N ARG B 322 -19.392 -37.287 -22.497 1.00 77.61 N ANISOU14510 N ARG B 322 8397 10403 10690 -15 1732 -1400 N ATOM 14511 CA ARG B 322 -20.846 -37.167 -22.435 1.00 73.12 C ANISOU14511 CA ARG B 322 7845 9896 10041 -26 1703 -1352 C ATOM 14512 C ARG B 322 -21.323 -35.716 -22.381 1.00 73.16 C ANISOU14512 C ARG B 322 7917 9987 9894 -22 1711 -1199 C ATOM 14513 O ARG B 322 -20.769 -34.891 -21.651 1.00 69.07 O ANISOU14513 O ARG B 322 7416 9433 9394 -2 1698 -1089 O ATOM 14514 CB ARG B 322 -21.381 -37.919 -21.211 1.00 71.77 C ANISOU14514 CB ARG B 322 7624 9622 10023 -12 1628 -1327 C ATOM 14515 CG ARG B 322 -21.028 -39.405 -21.161 1.00 69.35 C ANISOU14515 CG ARG B 322 7247 9212 9889 -12 1609 -1470 C ATOM 14516 CD ARG B 322 -21.961 -40.234 -22.029 1.00 73.83 C ANISOU14516 CD ARG B 322 7787 9832 10432 -39 1618 -1598 C ATOM 14517 NE ARG B 322 -23.352 -40.150 -21.583 1.00 75.94 N ANISOU14517 NE ARG B 322 8047 10131 10676 -48 1577 -1527 N ATOM 14518 CZ ARG B 322 -23.922 -40.965 -20.697 1.00 71.70 C ANISOU14518 CZ ARG B 322 7453 9498 10290 -45 1521 -1517 C ATOM 14519 NH1 ARG B 322 -23.232 -41.953 -20.140 1.00 68.16 N ANISOU14519 NH1 ARG B 322 6954 8912 10030 -27 1492 -1572 N ATOM 14520 NH2 ARG B 322 -25.195 -40.793 -20.368 1.00 68.97 N ANISOU14520 NH2 ARG B 322 7125 9185 9896 -60 1468 -1426 N ATOM 14521 H ARG B 322 -19.056 -37.717 -21.832 1.00 93.13 H ATOM 14522 HA ARG B 322 -21.228 -37.576 -23.227 1.00 87.74 H ATOM 14523 HB2 ARG B 322 -21.019 -37.506 -20.412 1.00 86.12 H ATOM 14524 HB3 ARG B 322 -22.348 -37.848 -21.204 1.00 86.12 H ATOM 14525 HG2 ARG B 322 -20.122 -39.530 -21.484 1.00 83.21 H ATOM 14526 HG3 ARG B 322 -21.104 -39.721 -20.247 1.00 83.21 H ATOM 14527 HD2 ARG B 322 -21.917 -39.910 -22.943 1.00 88.59 H ATOM 14528 HD3 ARG B 322 -21.688 -41.164 -21.992 1.00 88.59 H ATOM 14529 HE ARG B 322 -23.839 -39.526 -21.919 1.00 91.13 H ATOM 14530 HH11 ARG B 322 -22.406 -42.072 -20.348 1.00 81.79 H ATOM 14531 HH12 ARG B 322 -23.611 -42.473 -19.569 1.00 81.79 H ATOM 14532 HH21 ARG B 322 -25.650 -40.156 -20.725 1.00 82.77 H ATOM 14533 HH22 ARG B 322 -25.566 -41.318 -19.796 1.00 82.77 H ATOM 14534 N LYS B 323 -22.368 -35.421 -23.148 1.00 64.83 N ANISOU14534 N LYS B 323 6896 9045 8693 -41 1727 -1198 N ATOM 14535 CA LYS B 323 -22.971 -34.091 -23.159 1.00 66.23 C ANISOU14535 CA LYS B 323 7136 9304 8725 -38 1728 -1057 C ATOM 14536 C LYS B 323 -23.898 -33.935 -21.953 1.00 61.36 C ANISOU14536 C LYS B 323 6505 8653 8157 -25 1658 -951 C ATOM 14537 O LYS B 323 -24.411 -32.847 -21.685 1.00 59.54 O ANISOU14537 O LYS B 323 6318 8469 7836 -16 1646 -824 O ATOM 14538 CB LYS B 323 -23.751 -33.868 -24.461 1.00 67.16 C ANISOU14538 CB LYS B 323 7299 9559 8662 -61 1765 -1102 C ATOM 14539 CG LYS B 323 -23.003 -34.284 -25.728 1.00 71.13 C ANISOU14539 CG LYS B 323 7812 10103 9110 -74 1834 -1232 C ATOM 14540 CD LYS B 323 -22.687 -33.095 -26.620 1.00 73.22 C ANISOU14540 CD LYS B 323 8156 10458 9205 -74 1896 -1159 C ATOM 14541 CE LYS B 323 -21.860 -33.516 -27.830 1.00 77.73 C ANISOU14541 CE LYS B 323 8738 11068 9728 -84 1970 -1282 C ATOM 14542 NZ LYS B 323 -22.567 -34.498 -28.701 1.00 82.47 N ANISOU14542 NZ LYS B 323 9330 11738 10267 -103 1966 -1436 N ATOM 14543 H LYS B 323 -22.752 -35.980 -23.678 1.00 77.80 H ATOM 14544 HA LYS B 323 -22.273 -33.420 -23.100 1.00 79.48 H ATOM 14545 HB2 LYS B 323 -24.573 -34.382 -24.422 1.00 80.60 H ATOM 14546 HB3 LYS B 323 -23.960 -32.924 -24.539 1.00 80.60 H ATOM 14547 HG2 LYS B 323 -22.166 -34.706 -25.479 1.00 85.36 H ATOM 14548 HG3 LYS B 323 -23.553 -34.903 -26.233 1.00 85.36 H ATOM 14549 HD2 LYS B 323 -23.516 -32.703 -26.939 1.00 87.86 H ATOM 14550 HD3 LYS B 323 -22.178 -32.441 -26.116 1.00 87.86 H ATOM 14551 HE2 LYS B 323 -21.660 -32.731 -28.364 1.00 93.28 H ATOM 14552 HE3 LYS B 323 -21.037 -33.927 -27.522 1.00 93.28 H ATOM 14553 HZ1 LYS B 323 -22.757 -35.234 -28.238 1.00 98.96 H ATOM 14554 HZ2 LYS B 323 -23.325 -34.144 -29.005 1.00 98.96 H ATOM 14555 HZ3 LYS B 323 -22.052 -34.717 -29.393 1.00 98.96 H ATOM 14556 N LEU B 324 -24.098 -35.034 -21.230 1.00 39.33 N ANISOU14556 N LEU B 324 3652 5776 5517 -24 1614 -1003 N ATOM 14557 CA LEU B 324 -24.933 -35.057 -20.036 1.00 32.57 C ANISOU14557 CA LEU B 324 2775 4875 4726 -13 1551 -908 C ATOM 14558 C LEU B 324 -24.360 -34.126 -18.965 1.00 34.15 C ANISOU14558 C LEU B 324 3003 5023 4948 21 1525 -771 C ATOM 14559 O LEU B 324 -23.160 -34.148 -18.693 1.00 46.48 O ANISOU14559 O LEU B 324 4559 6517 6583 38 1532 -787 O ATOM 14560 CB LEU B 324 -25.016 -36.494 -19.510 1.00 32.58 C ANISOU14560 CB LEU B 324 2702 4773 4905 -16 1517 -994 C ATOM 14561 CG LEU B 324 -25.965 -36.801 -18.349 1.00 33.31 C ANISOU14561 CG LEU B 324 2761 4810 5083 -11 1457 -910 C ATOM 14562 CD1 LEU B 324 -27.440 -36.620 -18.749 1.00 33.14 C ANISOU14562 CD1 LEU B 324 2759 4881 4951 -37 1426 -877 C ATOM 14563 CD2 LEU B 324 -25.703 -38.214 -17.811 1.00 32.33 C ANISOU14563 CD2 LEU B 324 2568 4557 5159 -8 1427 -988 C ATOM 14564 H LEU B 324 -23.751 -35.798 -21.418 1.00 47.20 H ATOM 14565 HA LEU B 324 -25.828 -34.757 -20.259 1.00 39.09 H ATOM 14566 HB2 LEU B 324 -25.284 -37.063 -20.248 1.00 39.10 H ATOM 14567 HB3 LEU B 324 -24.127 -36.753 -19.220 1.00 39.10 H ATOM 14568 HG LEU B 324 -25.781 -36.177 -17.630 1.00 39.97 H ATOM 14569 HD11 LEU B 324 -28.001 -36.825 -17.985 1.00 39.77 H ATOM 14570 HD12 LEU B 324 -27.580 -35.701 -19.027 1.00 39.77 H ATOM 14571 HD13 LEU B 324 -27.644 -37.222 -19.481 1.00 39.77 H ATOM 14572 HD21 LEU B 324 -26.313 -38.390 -17.078 1.00 38.80 H ATOM 14573 HD22 LEU B 324 -25.849 -38.855 -18.524 1.00 38.80 H ATOM 14574 HD23 LEU B 324 -24.786 -38.268 -17.500 1.00 38.80 H ATOM 14575 N ILE B 325 -25.216 -33.309 -18.357 1.00 41.78 N ANISOU14575 N ILE B 325 3996 6025 5852 32 1494 -645 N ATOM 14576 CA ILE B 325 -24.781 -32.375 -17.319 1.00 32.76 C ANISOU14576 CA ILE B 325 2881 4846 4721 67 1463 -523 C ATOM 14577 C ILE B 325 -24.683 -33.066 -15.956 1.00 34.42 C ANISOU14577 C ILE B 325 3054 4945 5081 89 1406 -498 C ATOM 14578 O ILE B 325 -25.694 -33.470 -15.383 1.00 44.60 O ANISOU14578 O ILE B 325 4323 6223 6400 88 1373 -460 O ATOM 14579 CB ILE B 325 -25.736 -31.174 -17.209 1.00 25.76 C ANISOU14579 CB ILE B 325 2038 4043 3705 74 1450 -402 C ATOM 14580 CG1 ILE B 325 -25.858 -30.475 -18.565 1.00 26.34 C ANISOU14580 CG1 ILE B 325 2155 4222 3629 55 1506 -416 C ATOM 14581 CG2 ILE B 325 -25.241 -30.194 -16.157 1.00 24.92 C ANISOU14581 CG2 ILE B 325 1956 3904 3610 108 1414 -298 C ATOM 14582 CD1 ILE B 325 -26.925 -29.410 -18.617 1.00 32.79 C ANISOU14582 CD1 ILE B 325 3014 5122 4322 60 1494 -311 C ATOM 14583 H ILE B 325 -26.058 -33.275 -18.529 1.00 50.13 H ATOM 14584 HA ILE B 325 -23.901 -32.038 -17.548 1.00 39.32 H ATOM 14585 HB ILE B 325 -26.612 -31.497 -16.946 1.00 30.91 H ATOM 14586 HG12 ILE B 325 -25.010 -30.053 -18.774 1.00 31.60 H ATOM 14587 HG13 ILE B 325 -26.069 -31.138 -19.240 1.00 31.60 H ATOM 14588 HG21 ILE B 325 -25.858 -29.447 -16.106 1.00 29.91 H ATOM 14589 HG22 ILE B 325 -25.198 -30.646 -15.300 1.00 29.91 H ATOM 14590 HG23 ILE B 325 -24.359 -29.878 -16.410 1.00 29.91 H ATOM 14591 HD11 ILE B 325 -26.937 -29.018 -19.504 1.00 39.34 H ATOM 14592 HD12 ILE B 325 -27.785 -29.815 -18.423 1.00 39.34 H ATOM 14593 HD13 ILE B 325 -26.724 -28.728 -17.957 1.00 39.34 H ATOM 14594 N VAL B 326 -23.459 -33.197 -15.448 1.00 28.50 N ANISOU14594 N VAL B 326 2293 4111 4425 111 1397 -519 N ATOM 14595 CA VAL B 326 -23.212 -33.799 -14.139 1.00 25.61 C ANISOU14595 CA VAL B 326 1899 3635 4199 140 1343 -493 C ATOM 14596 C VAL B 326 -22.581 -32.760 -13.221 1.00 24.93 C ANISOU14596 C VAL B 326 1842 3527 4102 175 1312 -405 C ATOM 14597 O VAL B 326 -21.616 -32.102 -13.595 1.00 33.14 O ANISOU14597 O VAL B 326 2896 4578 5116 176 1336 -423 O ATOM 14598 CB VAL B 326 -22.282 -35.023 -14.247 1.00 26.40 C ANISOU14598 CB VAL B 326 1948 3637 4445 139 1346 -611 C ATOM 14599 CG1 VAL B 326 -22.141 -35.710 -12.895 1.00 29.31 C ANISOU14599 CG1 VAL B 326 2288 3887 4961 173 1287 -575 C ATOM 14600 CG2 VAL B 326 -22.825 -36.004 -15.272 1.00 30.87 C ANISOU14600 CG2 VAL B 326 2482 4228 5021 103 1378 -721 C ATOM 14601 H VAL B 326 -22.743 -32.941 -15.850 1.00 34.20 H ATOM 14602 HA VAL B 326 -24.054 -34.084 -13.750 1.00 30.74 H ATOM 14603 HB VAL B 326 -21.402 -34.735 -14.536 1.00 31.68 H ATOM 14604 HG11 VAL B 326 -21.553 -36.475 -12.990 1.00 35.17 H ATOM 14605 HG12 VAL B 326 -21.767 -35.081 -12.259 1.00 35.17 H ATOM 14606 HG13 VAL B 326 -23.017 -36.001 -12.597 1.00 35.17 H ATOM 14607 HG21 VAL B 326 -22.228 -36.766 -15.326 1.00 37.05 H ATOM 14608 HG22 VAL B 326 -23.708 -36.293 -14.994 1.00 37.05 H ATOM 14609 HG23 VAL B 326 -22.877 -35.562 -16.134 1.00 37.05 H ATOM 14610 N ASP B 327 -23.128 -32.619 -12.018 1.00 24.25 N ANISOU14610 N ASP B 327 1764 3409 4040 202 1262 -313 N ATOM 14611 CA ASP B 327 -22.656 -31.613 -11.074 1.00 23.61 C ANISOU14611 CA ASP B 327 1713 3312 3948 238 1227 -237 C ATOM 14612 C ASP B 327 -21.697 -32.229 -10.070 1.00 23.73 C ANISOU14612 C ASP B 327 1700 3208 4109 274 1188 -256 C ATOM 14613 O ASP B 327 -21.992 -33.261 -9.473 1.00 26.10 O ANISOU14613 O ASP B 327 1970 3438 4507 286 1163 -256 O ATOM 14614 CB ASP B 327 -23.835 -30.978 -10.332 1.00 22.87 C ANISOU14614 CB ASP B 327 1651 3260 3779 251 1195 -125 C ATOM 14615 CG ASP B 327 -24.718 -30.141 -11.241 1.00 26.01 C ANISOU14615 CG ASP B 327 2080 3775 4028 222 1222 -99 C ATOM 14616 OD1 ASP B 327 -24.179 -29.327 -12.017 1.00 24.49 O ANISOU14616 OD1 ASP B 327 1908 3633 3766 209 1253 -119 O ATOM 14617 OD2 ASP B 327 -25.954 -30.300 -11.190 1.00 29.02 O ANISOU14617 OD2 ASP B 327 2463 4196 4366 212 1214 -56 O ATOM 14618 H ASP B 327 -23.779 -33.097 -11.723 1.00 29.10 H ATOM 14619 HA ASP B 327 -22.186 -30.914 -11.556 1.00 28.34 H ATOM 14620 HB2 ASP B 327 -24.382 -31.681 -9.947 1.00 27.45 H ATOM 14621 HB3 ASP B 327 -23.494 -30.401 -9.631 1.00 27.45 H ATOM 14622 N SER B 328 -20.542 -31.595 -9.891 1.00 35.44 N ANISOU14622 N SER B 328 3187 4665 5614 291 1182 -271 N ATOM 14623 CA SER B 328 -19.561 -32.056 -8.919 1.00 29.50 C ANISOU14623 CA SER B 328 2409 3803 4998 330 1137 -289 C ATOM 14624 C SER B 328 -20.011 -31.677 -7.520 1.00 29.57 C ANISOU14624 C SER B 328 2439 3786 5011 377 1079 -187 C ATOM 14625 O SER B 328 -19.851 -32.452 -6.578 1.00 24.37 O ANISOU14625 O SER B 328 1760 3041 4458 414 1034 -173 O ATOM 14626 CB SER B 328 -18.204 -31.428 -9.211 1.00 31.52 C ANISOU14626 CB SER B 328 2657 4044 5275 329 1150 -339 C ATOM 14627 OG SER B 328 -17.922 -31.498 -10.596 1.00 47.94 O ANISOU14627 OG SER B 328 4729 6173 7312 285 1216 -414 O ATOM 14628 H SER B 328 -20.303 -30.892 -10.325 1.00 42.53 H ATOM 14629 HA SER B 328 -19.476 -33.021 -8.969 1.00 35.41 H ATOM 14630 HB2 SER B 328 -18.218 -30.498 -8.937 1.00 37.82 H ATOM 14631 HB3 SER B 328 -17.519 -31.910 -8.723 1.00 37.82 H ATOM 14632 HG SER B 328 -17.174 -31.152 -10.754 1.00 57.52 H ATOM 14633 N VAL B 329 -20.588 -30.481 -7.407 1.00 31.82 N ANISOU14633 N VAL B 329 2766 4145 5178 378 1080 -114 N ATOM 14634 CA VAL B 329 -21.068 -29.943 -6.138 1.00 30.16 C ANISOU14634 CA VAL B 329 2584 3924 4950 423 1031 -17 C ATOM 14635 C VAL B 329 -22.560 -29.675 -6.243 1.00 26.41 C ANISOU14635 C VAL B 329 2140 3527 4365 406 1043 57 C ATOM 14636 O VAL B 329 -22.998 -28.880 -7.070 1.00 32.83 O ANISOU14636 O VAL B 329 2979 4424 5070 373 1073 59 O ATOM 14637 CB VAL B 329 -20.308 -28.650 -5.772 1.00 27.25 C ANISOU14637 CB VAL B 329 2236 3560 4557 445 1012 -3 C ATOM 14638 CG1 VAL B 329 -21.052 -27.829 -4.706 1.00 27.84 C ANISOU14638 CG1 VAL B 329 2352 3655 4571 485 972 97 C ATOM 14639 CG2 VAL B 329 -18.914 -29.001 -5.297 1.00 22.22 C ANISOU14639 CG2 VAL B 329 1565 2831 4046 473 979 -61 C ATOM 14640 H VAL B 329 -20.715 -29.950 -8.071 1.00 38.18 H ATOM 14641 HA VAL B 329 -20.922 -30.595 -5.434 1.00 36.19 H ATOM 14642 HB VAL B 329 -20.223 -28.100 -6.566 1.00 32.69 H ATOM 14643 HG11 VAL B 329 -20.539 -27.030 -4.510 1.00 33.41 H ATOM 14644 HG12 VAL B 329 -21.926 -27.586 -5.049 1.00 33.41 H ATOM 14645 HG13 VAL B 329 -21.148 -28.366 -3.905 1.00 33.41 H ATOM 14646 HG21 VAL B 329 -18.444 -28.184 -5.069 1.00 26.66 H ATOM 14647 HG22 VAL B 329 -18.982 -29.573 -4.517 1.00 26.66 H ATOM 14648 HG23 VAL B 329 -18.447 -29.465 -6.009 1.00 26.66 H ATOM 14649 N LYS B 330 -23.332 -30.336 -5.389 1.00 27.39 N ANISOU14649 N LYS B 330 2264 3623 4522 430 1019 121 N ATOM 14650 CA LYS B 330 -24.786 -30.303 -5.482 1.00 22.60 C ANISOU14650 CA LYS B 330 1677 3082 3829 410 1030 186 C ATOM 14651 C LYS B 330 -25.422 -29.299 -4.520 1.00 25.74 C ANISOU14651 C LYS B 330 2123 3512 4144 446 998 287 C ATOM 14652 O LYS B 330 -26.521 -28.815 -4.775 1.00 33.69 O ANISOU14652 O LYS B 330 3158 4592 5051 426 1005 331 O ATOM 14653 CB LYS B 330 -25.352 -31.693 -5.193 1.00 21.66 C ANISOU14653 CB LYS B 330 1520 2912 3797 407 1032 200 C ATOM 14654 CG LYS B 330 -24.873 -32.788 -6.146 1.00 25.87 C ANISOU14654 CG LYS B 330 2003 3406 4422 370 1062 92 C ATOM 14655 CD LYS B 330 -25.401 -34.163 -5.741 1.00 28.27 C ANISOU14655 CD LYS B 330 2264 3639 4840 368 1057 108 C ATOM 14656 CE LYS B 330 -24.843 -34.613 -4.396 1.00 27.66 C ANISOU14656 CE LYS B 330 2181 3458 4870 428 1010 162 C ATOM 14657 NZ LYS B 330 -25.319 -35.970 -4.016 1.00 37.10 N ANISOU14657 NZ LYS B 330 3371 4575 6151 414 978 182 N ATOM 14658 H LYS B 330 -23.035 -30.816 -4.740 1.00 32.87 H ATOM 14659 HA LYS B 330 -25.039 -30.056 -6.385 1.00 27.12 H ATOM 14660 HB2 LYS B 330 -25.093 -31.952 -4.295 1.00 25.99 H ATOM 14661 HB3 LYS B 330 -26.319 -31.652 -5.255 1.00 25.99 H ATOM 14662 HG2 LYS B 330 -25.191 -32.593 -7.041 1.00 31.05 H ATOM 14663 HG3 LYS B 330 -23.903 -32.820 -6.134 1.00 31.05 H ATOM 14664 HD2 LYS B 330 -26.367 -34.125 -5.670 1.00 33.93 H ATOM 14665 HD3 LYS B 330 -25.139 -34.815 -6.410 1.00 33.93 H ATOM 14666 HE2 LYS B 330 -23.875 -34.636 -4.446 1.00 33.19 H ATOM 14667 HE3 LYS B 330 -25.127 -33.990 -3.709 1.00 33.19 H ATOM 14668 HZ1 LYS B 330 -26.207 -35.975 -3.958 1.00 44.52 H ATOM 14669 HZ2 LYS B 330 -25.066 -36.563 -4.629 1.00 44.52 H ATOM 14670 HZ3 LYS B 330 -24.976 -36.202 -3.229 1.00 44.52 H ATOM 14671 N GLU B 331 -24.722 -28.986 -3.431 1.00 25.72 N ANISOU14671 N GLU B 331 2129 3456 4186 503 960 317 N ATOM 14672 CA GLU B 331 -25.266 -28.157 -2.356 1.00 27.60 C ANISOU14672 CA GLU B 331 2411 3717 4358 549 927 410 C ATOM 14673 C GLU B 331 -24.347 -27.004 -2.003 1.00 28.43 C ANISOU14673 C GLU B 331 2535 3811 4455 581 899 394 C ATOM 14674 O GLU B 331 -23.130 -27.136 -2.048 1.00 35.39 O ANISOU14674 O GLU B 331 3389 4636 5420 590 888 329 O ATOM 14675 CB GLU B 331 -25.478 -28.996 -1.091 1.00 34.25 C ANISOU14675 CB GLU B 331 3247 4505 5262 603 900 482 C ATOM 14676 CG GLU B 331 -26.501 -30.113 -1.235 1.00 40.97 C ANISOU14676 CG GLU B 331 4075 5359 6132 574 928 519 C ATOM 14677 CD GLU B 331 -26.712 -30.887 0.060 1.00 46.60 C ANISOU14677 CD GLU B 331 4788 6015 6902 628 903 607 C ATOM 14678 OE1 GLU B 331 -27.078 -30.257 1.080 1.00 44.08 O ANISOU14678 OE1 GLU B 331 4513 5723 6512 677 878 688 O ATOM 14679 OE2 GLU B 331 -26.520 -32.126 0.050 1.00 45.87 O ANISOU14679 OE2 GLU B 331 4678 5847 6903 609 890 585 O ATOM 14680 H GLU B 331 -23.915 -29.247 -3.289 1.00 30.86 H ATOM 14681 HA GLU B 331 -26.122 -27.794 -2.631 1.00 33.12 H ATOM 14682 HB2 GLU B 331 -24.633 -29.402 -0.843 1.00 41.10 H ATOM 14683 HB3 GLU B 331 -25.781 -28.411 -0.379 1.00 41.10 H ATOM 14684 HG2 GLU B 331 -27.352 -29.730 -1.498 1.00 49.16 H ATOM 14685 HG3 GLU B 331 -26.194 -30.737 -1.911 1.00 49.16 H ATOM 14686 N LEU B 332 -24.946 -25.871 -1.656 1.00 25.83 N ANISOU14686 N LEU B 332 2250 3533 4031 596 885 449 N ATOM 14687 CA LEU B 332 -24.230 -24.799 -0.986 1.00 24.96 C ANISOU14687 CA LEU B 332 2158 3404 3923 640 849 451 C ATOM 14688 C LEU B 332 -24.032 -25.244 0.457 1.00 21.49 C ANISOU14688 C LEU B 332 1723 2914 3527 713 798 497 C ATOM 14689 O LEU B 332 -24.980 -25.714 1.089 1.00 26.79 O ANISOU14689 O LEU B 332 2412 3604 4162 735 797 573 O ATOM 14690 CB LEU B 332 -25.056 -23.510 -1.007 1.00 19.95 C ANISOU14690 CB LEU B 332 1569 2834 3178 639 847 499 C ATOM 14691 CG LEU B 332 -25.514 -22.970 -2.362 1.00 18.72 C ANISOU14691 CG LEU B 332 1422 2735 2957 576 887 475 C ATOM 14692 CD1 LEU B 332 -26.275 -21.668 -2.180 1.00 21.96 C ANISOU14692 CD1 LEU B 332 1877 3192 3277 591 872 530 C ATOM 14693 CD2 LEU B 332 -24.336 -22.761 -3.286 1.00 24.05 C ANISOU14693 CD2 LEU B 332 2069 3389 3682 542 914 394 C ATOM 14694 H LEU B 332 -25.776 -25.699 -1.801 1.00 31.00 H ATOM 14695 HA LEU B 332 -23.368 -24.645 -1.404 1.00 29.96 H ATOM 14696 HB2 LEU B 332 -25.855 -23.661 -0.479 1.00 23.94 H ATOM 14697 HB3 LEU B 332 -24.528 -22.812 -0.589 1.00 23.94 H ATOM 14698 HG LEU B 332 -26.111 -23.613 -2.775 1.00 22.47 H ATOM 14699 HD11 LEU B 332 -26.556 -21.344 -3.050 1.00 26.36 H ATOM 14700 HD12 LEU B 332 -27.051 -21.832 -1.622 1.00 26.36 H ATOM 14701 HD13 LEU B 332 -25.693 -21.019 -1.756 1.00 26.36 H ATOM 14702 HD21 LEU B 332 -24.657 -22.419 -4.134 1.00 28.86 H ATOM 14703 HD22 LEU B 332 -23.726 -22.124 -2.881 1.00 28.86 H ATOM 14704 HD23 LEU B 332 -23.886 -23.610 -3.420 1.00 28.86 H ATOM 14705 N ASP B 333 -22.823 -25.106 0.992 1.00 29.66 N ANISOU14705 N ASP B 333 2744 3886 4638 752 754 454 N ATOM 14706 CA ASP B 333 -22.582 -25.565 2.357 1.00 29.71 C ANISOU14706 CA ASP B 333 2765 3842 4680 826 691 493 C ATOM 14707 C ASP B 333 -23.213 -24.594 3.352 1.00 35.28 C ANISOU14707 C ASP B 333 3525 4592 5288 877 658 562 C ATOM 14708 O ASP B 333 -23.614 -23.490 2.986 1.00 36.67 O ANISOU14708 O ASP B 333 3719 4821 5392 856 677 565 O ATOM 14709 CB ASP B 333 -21.088 -25.787 2.639 1.00 27.54 C ANISOU14709 CB ASP B 333 2463 3485 4517 852 636 415 C ATOM 14710 CG ASP B 333 -20.280 -24.501 2.610 1.00 43.29 C ANISOU14710 CG ASP B 333 4459 5482 6510 856 611 362 C ATOM 14711 OD1 ASP B 333 -20.368 -23.721 3.582 1.00 45.66 O ANISOU14711 OD1 ASP B 333 4796 5790 6763 908 557 392 O ATOM 14712 OD2 ASP B 333 -19.541 -24.282 1.623 1.00 53.24 O ANISOU14712 OD2 ASP B 333 5681 6733 7816 806 645 288 O ATOM 14713 H ASP B 333 -22.141 -24.760 0.599 1.00 35.59 H ATOM 14714 HA ASP B 333 -23.024 -26.421 2.471 1.00 35.65 H ATOM 14715 HB2 ASP B 333 -20.989 -26.182 3.520 1.00 33.05 H ATOM 14716 HB3 ASP B 333 -20.725 -26.383 1.966 1.00 33.05 H ATOM 14717 N SER B 334 -23.321 -25.022 4.605 1.00 54.24 N ANISOU14717 N SER B 334 5956 6969 7682 945 608 618 N ATOM 14718 CA SER B 334 -24.026 -24.250 5.620 1.00 48.19 C ANISOU14718 CA SER B 334 5248 6253 6811 996 581 684 C ATOM 14719 C SER B 334 -23.330 -22.931 5.952 1.00 49.11 C ANISOU14719 C SER B 334 5382 6364 6913 1020 529 630 C ATOM 14720 O SER B 334 -23.992 -21.939 6.261 1.00 59.39 O ANISOU14720 O SER B 334 6720 7721 8125 1034 529 660 O ATOM 14721 CB SER B 334 -24.185 -25.089 6.887 1.00 46.08 C ANISOU14721 CB SER B 334 5017 5958 6534 1064 537 754 C ATOM 14722 OG SER B 334 -24.933 -26.263 6.614 1.00 61.67 O ANISOU14722 OG SER B 334 6970 7933 8527 1043 590 816 O ATOM 14723 H SER B 334 -22.991 -25.762 4.894 1.00 65.08 H ATOM 14724 HA SER B 334 -24.914 -24.041 5.291 1.00 57.83 H ATOM 14725 HB2 SER B 334 -23.307 -25.341 7.213 1.00 55.30 H ATOM 14726 HB3 SER B 334 -24.652 -24.565 7.557 1.00 55.30 H ATOM 14727 HG SER B 334 -25.017 -26.719 7.314 1.00 74.00 H ATOM 14728 N LYS B 335 -22.001 -22.922 5.879 1.00 21.78 N ANISOU14728 N LYS B 335 1890 2835 3549 1024 483 546 N ATOM 14729 CA LYS B 335 -21.223 -21.730 6.203 1.00 20.03 C ANISOU14729 CA LYS B 335 1674 2598 3338 1046 428 486 C ATOM 14730 C LYS B 335 -21.486 -20.586 5.225 1.00 30.55 C ANISOU14730 C LYS B 335 2992 3973 4641 994 484 470 C ATOM 14731 O LYS B 335 -21.556 -19.426 5.634 1.00 35.68 O ANISOU14731 O LYS B 335 3666 4639 5251 1017 455 466 O ATOM 14732 CB LYS B 335 -19.723 -22.036 6.233 1.00 23.86 C ANISOU14732 CB LYS B 335 2119 3003 3943 1057 372 395 C ATOM 14733 CG LYS B 335 -19.278 -22.990 7.341 1.00 32.51 C ANISOU14733 CG LYS B 335 3238 4045 5071 1122 289 402 C ATOM 14734 CD LYS B 335 -17.943 -22.546 7.951 1.00 39.93 C ANISOU14734 CD LYS B 335 4169 4929 6073 1168 191 314 C ATOM 14735 CE LYS B 335 -17.248 -23.662 8.724 1.00 43.74 C ANISOU14735 CE LYS B 335 4663 5347 6610 1221 110 303 C ATOM 14736 NZ LYS B 335 -16.581 -24.640 7.818 1.00 43.38 N ANISOU14736 NZ LYS B 335 4558 5255 6669 1174 149 260 N ATOM 14737 H LYS B 335 -21.524 -23.598 5.643 1.00 26.13 H ATOM 14738 HA LYS B 335 -21.479 -21.425 7.088 1.00 24.03 H ATOM 14739 HB2 LYS B 335 -19.473 -22.437 5.385 1.00 28.63 H ATOM 14740 HB3 LYS B 335 -19.240 -21.203 6.353 1.00 28.63 H ATOM 14741 HG2 LYS B 335 -19.947 -22.999 8.044 1.00 39.02 H ATOM 14742 HG3 LYS B 335 -19.165 -23.880 6.973 1.00 39.02 H ATOM 14743 HD2 LYS B 335 -17.350 -22.260 7.239 1.00 47.92 H ATOM 14744 HD3 LYS B 335 -18.104 -21.812 8.564 1.00 47.92 H ATOM 14745 HE2 LYS B 335 -16.572 -23.275 9.302 1.00 52.49 H ATOM 14746 HE3 LYS B 335 -17.906 -24.140 9.253 1.00 52.49 H ATOM 14747 HZ1 LYS B 335 -16.186 -25.278 8.297 1.00 52.06 H ATOM 14748 HZ2 LYS B 335 -17.182 -25.015 7.279 1.00 52.06 H ATOM 14749 HZ3 LYS B 335 -15.967 -24.227 7.323 1.00 52.06 H ATOM 14750 N THR B 336 -21.619 -20.893 3.937 1.00 28.99 N ANISOU14750 N THR B 336 2760 3792 4464 924 560 458 N ATOM 14751 CA THR B 336 -21.848 -19.825 2.965 1.00 24.66 C ANISOU14751 CA THR B 336 2206 3283 3883 875 610 449 C ATOM 14752 C THR B 336 -23.259 -19.259 3.078 1.00 25.38 C ANISOU14752 C THR B 336 2343 3446 3855 879 631 527 C ATOM 14753 O THR B 336 -23.494 -18.117 2.694 1.00 36.11 O ANISOU14753 O THR B 336 3712 4830 5178 865 644 531 O ATOM 14754 CB THR B 336 -21.580 -20.237 1.485 1.00 23.70 C ANISOU14754 CB THR B 336 2043 3165 3798 798 682 410 C ATOM 14755 OG1 THR B 336 -22.798 -20.631 0.849 1.00 28.21 O ANISOU14755 OG1 THR B 336 2633 3796 4290 760 734 460 O ATOM 14756 CG2 THR B 336 -20.572 -21.352 1.388 1.00 30.67 C ANISOU14756 CG2 THR B 336 2883 3988 4784 793 673 349 C ATOM 14757 H THR B 336 -21.583 -21.686 3.607 1.00 34.79 H ATOM 14758 HA THR B 336 -21.236 -19.102 3.170 1.00 29.60 H ATOM 14759 HB THR B 336 -21.217 -19.472 1.012 1.00 28.44 H ATOM 14760 HG1 THR B 336 -22.648 -20.852 0.052 1.00 33.85 H ATOM 14761 HG21 THR B 336 -20.427 -21.586 0.458 1.00 36.81 H ATOM 14762 HG22 THR B 336 -19.730 -21.072 1.778 1.00 36.81 H ATOM 14763 HG23 THR B 336 -20.896 -22.133 1.862 1.00 36.81 H ATOM 14764 N ILE B 337 -24.194 -20.042 3.607 1.00 24.90 N ANISOU14764 N ILE B 337 2306 3414 3739 899 634 591 N ATOM 14765 CA ILE B 337 -25.534 -19.525 3.864 1.00 22.54 C ANISOU14765 CA ILE B 337 2049 3186 3330 909 649 661 C ATOM 14766 C ILE B 337 -25.452 -18.521 5.001 1.00 23.90 C ANISOU14766 C ILE B 337 2258 3358 3465 973 591 665 C ATOM 14767 O ILE B 337 -26.082 -17.470 4.953 1.00 25.35 O ANISOU14767 O ILE B 337 2464 3581 3586 976 596 683 O ATOM 14768 CB ILE B 337 -26.528 -20.637 4.243 1.00 19.31 C ANISOU14768 CB ILE B 337 1651 2808 2878 917 671 730 C ATOM 14769 CG1 ILE B 337 -26.642 -21.650 3.095 1.00 22.05 C ANISOU14769 CG1 ILE B 337 1959 3151 3267 849 722 713 C ATOM 14770 CG2 ILE B 337 -27.893 -20.033 4.624 1.00 18.27 C ANISOU14770 CG2 ILE B 337 1558 2750 2635 933 683 798 C ATOM 14771 CD1 ILE B 337 -28.042 -21.860 2.543 1.00 21.75 C ANISOU14771 CD1 ILE B 337 1931 3178 3157 807 764 761 C ATOM 14772 H ILE B 337 -24.081 -20.867 3.823 1.00 29.87 H ATOM 14773 HA ILE B 337 -25.865 -19.070 3.074 1.00 27.05 H ATOM 14774 HB ILE B 337 -26.178 -21.101 5.019 1.00 23.17 H ATOM 14775 HG12 ILE B 337 -26.083 -21.347 2.362 1.00 26.46 H ATOM 14776 HG13 ILE B 337 -26.322 -22.509 3.411 1.00 26.46 H ATOM 14777 HG21 ILE B 337 -28.502 -20.751 4.858 1.00 21.93 H ATOM 14778 HG22 ILE B 337 -27.775 -19.438 5.381 1.00 21.93 H ATOM 14779 HG23 ILE B 337 -28.241 -19.537 3.866 1.00 21.93 H ATOM 14780 HD11 ILE B 337 -28.004 -22.514 1.827 1.00 26.11 H ATOM 14781 HD12 ILE B 337 -28.617 -22.181 3.255 1.00 26.11 H ATOM 14782 HD13 ILE B 337 -28.377 -21.016 2.202 1.00 26.11 H ATOM 14783 N ARG B 338 -24.674 -18.860 6.025 1.00 25.87 N ANISOU14783 N ARG B 338 2516 3560 3755 1027 529 642 N ATOM 14784 CA ARG B 338 -24.437 -17.951 7.142 1.00 28.70 C ANISOU14784 CA ARG B 338 2911 3910 4084 1088 460 625 C ATOM 14785 C ARG B 338 -23.840 -16.637 6.646 1.00 27.93 C ANISOU14785 C ARG B 338 2794 3791 4028 1070 448 564 C ATOM 14786 O ARG B 338 -24.156 -15.566 7.161 1.00 31.66 O ANISOU14786 O ARG B 338 3295 4281 4453 1100 419 564 O ATOM 14787 CB ARG B 338 -23.505 -18.593 8.176 1.00 35.35 C ANISOU14787 CB ARG B 338 3762 4693 4977 1142 383 594 C ATOM 14788 CG ARG B 338 -24.221 -19.094 9.423 1.00 50.60 C ANISOU14788 CG ARG B 338 5751 6657 6818 1203 360 663 C ATOM 14789 CD ARG B 338 -23.314 -19.930 10.316 1.00 58.49 C ANISOU14789 CD ARG B 338 6764 7593 7867 1253 283 643 C ATOM 14790 NE ARG B 338 -23.308 -21.340 9.929 1.00 61.36 N ANISOU14790 NE ARG B 338 7103 7931 8279 1232 316 679 N ATOM 14791 CZ ARG B 338 -22.892 -22.332 10.712 1.00 68.54 C ANISOU14791 CZ ARG B 338 8035 8795 9213 1276 264 698 C ATOM 14792 NH1 ARG B 338 -22.444 -22.078 11.935 1.00 82.19 N ANISOU14792 NH1 ARG B 338 9814 10503 10911 1343 173 684 N ATOM 14793 NH2 ARG B 338 -22.927 -23.585 10.277 1.00 60.28 N ANISOU14793 NH2 ARG B 338 6962 7719 8223 1253 299 731 N ATOM 14794 H ARG B 338 -24.270 -19.615 6.098 1.00 31.05 H ATOM 14795 HA ARG B 338 -25.281 -17.754 7.577 1.00 34.44 H ATOM 14796 HB2 ARG B 338 -23.058 -19.351 7.766 1.00 42.42 H ATOM 14797 HB3 ARG B 338 -22.848 -17.937 8.455 1.00 42.42 H ATOM 14798 HG2 ARG B 338 -24.532 -18.333 9.938 1.00 60.72 H ATOM 14799 HG3 ARG B 338 -24.973 -19.647 9.157 1.00 60.72 H ATOM 14800 HD2 ARG B 338 -22.406 -19.595 10.249 1.00 70.19 H ATOM 14801 HD3 ARG B 338 -23.626 -19.869 11.232 1.00 70.19 H ATOM 14802 HE ARG B 338 -23.593 -21.541 9.143 1.00 73.63 H ATOM 14803 HH11 ARG B 338 -22.419 -21.268 12.225 1.00 98.62 H ATOM 14804 HH12 ARG B 338 -22.176 -22.723 12.438 1.00 98.62 H ATOM 14805 HH21 ARG B 338 -23.216 -23.758 9.485 1.00 72.34 H ATOM 14806 HH22 ARG B 338 -22.657 -24.225 10.784 1.00 72.34 H ATOM 14807 N ALA B 339 -22.981 -16.725 5.637 1.00 20.62 N ANISOU14807 N ALA B 339 1817 2826 3192 1021 473 514 N ATOM 14808 CA ALA B 339 -22.341 -15.542 5.078 1.00 25.33 C ANISOU14808 CA ALA B 339 2387 3398 3838 1002 474 465 C ATOM 14809 C ALA B 339 -23.326 -14.710 4.259 1.00 30.82 C ANISOU14809 C ALA B 339 3096 4149 4466 967 533 514 C ATOM 14810 O ALA B 339 -23.255 -13.479 4.253 1.00 26.47 O ANISOU14810 O ALA B 339 2547 3591 3917 977 519 503 O ATOM 14811 CB ALA B 339 -21.161 -15.947 4.227 1.00 19.09 C ANISOU14811 CB ALA B 339 1538 2558 3157 959 497 404 C ATOM 14812 H ALA B 339 -22.751 -17.462 5.256 1.00 24.75 H ATOM 14813 HA ALA B 339 -22.012 -14.989 5.804 1.00 30.39 H ATOM 14814 HB1 ALA B 339 -20.746 -15.149 3.863 1.00 22.91 H ATOM 14815 HB2 ALA B 339 -20.525 -16.429 4.778 1.00 22.91 H ATOM 14816 HB3 ALA B 339 -21.472 -16.517 3.506 1.00 22.91 H ATOM 14817 N GLN B 340 -24.244 -15.387 3.574 1.00 29.18 N ANISOU14817 N GLN B 340 2895 3992 4201 928 592 566 N ATOM 14818 CA GLN B 340 -25.244 -14.710 2.752 1.00 21.14 C ANISOU14818 CA GLN B 340 1891 3028 3114 896 638 612 C ATOM 14819 C GLN B 340 -26.169 -13.834 3.591 1.00 25.20 C ANISOU14819 C GLN B 340 2448 3579 3547 945 607 651 C ATOM 14820 O GLN B 340 -26.610 -12.779 3.133 1.00 33.65 O ANISOU14820 O GLN B 340 3526 4670 4590 939 620 669 O ATOM 14821 CB GLN B 340 -26.077 -15.722 1.959 1.00 17.82 C ANISOU14821 CB GLN B 340 1470 2651 2648 849 690 649 C ATOM 14822 CG GLN B 340 -25.385 -16.265 0.716 1.00 17.91 C ANISOU14822 CG GLN B 340 1444 2642 2719 784 736 606 C ATOM 14823 CD GLN B 340 -26.210 -17.301 -0.047 1.00 22.19 C ANISOU14823 CD GLN B 340 1988 3225 3219 736 774 625 C ATOM 14824 OE1 GLN B 340 -25.725 -17.892 -1.015 1.00 19.57 O ANISOU14824 OE1 GLN B 340 1629 2882 2925 685 810 582 O ATOM 14825 NE2 GLN B 340 -27.456 -17.525 0.380 1.00 24.16 N ANISOU14825 NE2 GLN B 340 2266 3522 3393 752 766 682 N ATOM 14826 H GLN B 340 -24.310 -16.244 3.569 1.00 35.02 H ATOM 14827 HA GLN B 340 -24.789 -14.137 2.115 1.00 25.37 H ATOM 14828 HB2 GLN B 340 -26.282 -16.475 2.535 1.00 21.38 H ATOM 14829 HB3 GLN B 340 -26.899 -15.294 1.676 1.00 21.38 H ATOM 14830 HG2 GLN B 340 -25.203 -15.528 0.113 1.00 21.49 H ATOM 14831 HG3 GLN B 340 -24.552 -16.686 0.981 1.00 21.49 H ATOM 14832 HE21 GLN B 340 -27.762 -17.094 1.059 1.00 29.00 H ATOM 14833 HE22 GLN B 340 -27.952 -18.101 -0.023 1.00 29.00 H ATOM 14834 N LEU B 341 -26.465 -14.272 4.813 1.00 25.22 N ANISOU14834 N LEU B 341 2480 3592 3511 996 568 665 N ATOM 14835 CA LEU B 341 -27.302 -13.494 5.721 1.00 25.83 C ANISOU14835 CA LEU B 341 2599 3708 3508 1046 540 691 C ATOM 14836 C LEU B 341 -26.542 -12.274 6.207 1.00 29.22 C ANISOU14836 C LEU B 341 3030 4091 3982 1080 483 633 C ATOM 14837 O LEU B 341 -27.130 -11.220 6.452 1.00 33.29 O ANISOU14837 O LEU B 341 3566 4627 4453 1103 471 640 O ATOM 14838 CB LEU B 341 -27.704 -14.318 6.945 1.00 25.01 C ANISOU14838 CB LEU B 341 2526 3627 3349 1095 519 720 C ATOM 14839 CG LEU B 341 -28.363 -15.682 6.748 1.00 25.47 C ANISOU14839 CG LEU B 341 2579 3719 3380 1073 567 778 C ATOM 14840 CD1 LEU B 341 -28.756 -16.242 8.106 1.00 24.15 C ANISOU14840 CD1 LEU B 341 2447 3576 3151 1136 548 817 C ATOM 14841 CD2 LEU B 341 -29.566 -15.608 5.820 1.00 28.88 C ANISOU14841 CD2 LEU B 341 3005 4207 3759 1028 621 825 C ATOM 14842 H LEU B 341 -26.192 -15.019 5.140 1.00 30.27 H ATOM 14843 HA LEU B 341 -28.105 -13.202 5.261 1.00 31.00 H ATOM 14844 HB2 LEU B 341 -26.903 -14.470 7.471 1.00 30.01 H ATOM 14845 HB3 LEU B 341 -28.323 -13.784 7.466 1.00 30.01 H ATOM 14846 HG LEU B 341 -27.718 -16.288 6.351 1.00 30.56 H ATOM 14847 HD11 LEU B 341 -29.174 -17.109 7.980 1.00 28.97 H ATOM 14848 HD12 LEU B 341 -27.959 -16.335 8.651 1.00 28.97 H ATOM 14849 HD13 LEU B 341 -29.379 -15.632 8.530 1.00 28.97 H ATOM 14850 HD21 LEU B 341 -29.948 -16.494 5.728 1.00 34.65 H ATOM 14851 HD22 LEU B 341 -30.222 -15.003 6.203 1.00 34.65 H ATOM 14852 HD23 LEU B 341 -29.277 -15.279 4.955 1.00 34.65 H ATOM 14853 N SER B 342 -25.229 -12.430 6.352 1.00 30.70 N ANISOU14853 N SER B 342 3190 4211 4265 1084 446 571 N ATOM 14854 CA SER B 342 -24.392 -11.407 6.963 1.00 29.79 C ANISOU14854 CA SER B 342 3071 4041 4208 1121 377 505 C ATOM 14855 C SER B 342 -24.120 -10.226 6.033 1.00 28.81 C ANISOU14855 C SER B 342 2917 3894 4137 1091 400 490 C ATOM 14856 O SER B 342 -23.866 -9.119 6.506 1.00 25.79 O ANISOU14856 O SER B 342 2537 3481 3782 1124 351 452 O ATOM 14857 CB SER B 342 -23.062 -12.015 7.417 1.00 32.28 C ANISOU14857 CB SER B 342 3359 4289 4617 1137 321 439 C ATOM 14858 OG SER B 342 -23.261 -13.233 8.115 1.00 34.78 O ANISOU14858 OG SER B 342 3700 4621 4893 1161 308 465 O ATOM 14859 H SER B 342 -24.795 -13.129 6.100 1.00 36.84 H ATOM 14860 HA SER B 342 -24.844 -11.064 7.750 1.00 35.75 H ATOM 14861 HB2 SER B 342 -22.513 -12.187 6.636 1.00 38.74 H ATOM 14862 HB3 SER B 342 -22.613 -11.386 8.003 1.00 38.74 H ATOM 14863 HG SER B 342 -23.734 -13.100 8.796 1.00 41.73 H ATOM 14864 N ASP B 343 -24.181 -10.457 4.721 1.00 21.71 N ANISOU14864 N ASP B 343 1989 3008 3252 1031 476 521 N ATOM 14865 CA ASP B 343 -23.802 -9.435 3.746 1.00 24.96 C ANISOU14865 CA ASP B 343 2369 3394 3720 1001 512 519 C ATOM 14866 C ASP B 343 -24.536 -9.589 2.411 1.00 28.72 C ANISOU14866 C ASP B 343 2842 3920 4149 947 597 585 C ATOM 14867 O ASP B 343 -24.220 -10.485 1.625 1.00 25.52 O ANISOU14867 O ASP B 343 2415 3518 3764 898 646 583 O ATOM 14868 CB ASP B 343 -22.289 -9.492 3.513 1.00 24.20 C ANISOU14868 CB ASP B 343 2220 3225 3749 984 504 452 C ATOM 14869 CG ASP B 343 -21.803 -8.439 2.534 1.00 29.76 C ANISOU14869 CG ASP B 343 2887 3897 4523 951 552 457 C ATOM 14870 OD1 ASP B 343 -22.450 -7.376 2.418 1.00 37.26 O ANISOU14870 OD1 ASP B 343 3855 4859 5443 966 556 495 O ATOM 14871 OD2 ASP B 343 -20.766 -8.677 1.881 1.00 31.87 O ANISOU14871 OD2 ASP B 343 3106 4123 4880 910 589 425 O ATOM 14872 H ASP B 343 -24.440 -11.198 4.370 1.00 26.05 H ATOM 14873 HA ASP B 343 -24.017 -8.561 4.107 1.00 29.95 H ATOM 14874 HB2 ASP B 343 -21.834 -9.348 4.358 1.00 29.04 H ATOM 14875 HB3 ASP B 343 -22.057 -10.364 3.156 1.00 29.04 H ATOM 14876 N TYR B 344 -25.499 -8.701 2.156 1.00 26.00 N ANISOU14876 N TYR B 344 2521 3612 3744 957 609 635 N ATOM 14877 CA TYR B 344 -26.258 -8.714 0.904 1.00 27.58 C ANISOU14877 CA TYR B 344 2723 3863 3894 914 677 697 C ATOM 14878 C TYR B 344 -26.024 -7.439 0.081 1.00 24.19 C ANISOU14878 C TYR B 344 2274 3409 3507 906 709 722 C ATOM 14879 O TYR B 344 -26.793 -7.118 -0.829 1.00 25.71 O ANISOU14879 O TYR B 344 2476 3646 3646 889 751 782 O ATOM 14880 CB TYR B 344 -27.756 -8.931 1.181 1.00 24.55 C ANISOU14880 CB TYR B 344 2379 3552 3397 932 669 748 C ATOM 14881 CG TYR B 344 -28.360 -8.019 2.234 1.00 27.90 C ANISOU14881 CG TYR B 344 2833 3984 3785 992 616 747 C ATOM 14882 CD1 TYR B 344 -28.797 -6.743 1.905 1.00 29.23 C ANISOU14882 CD1 TYR B 344 3005 4153 3948 1010 615 773 C ATOM 14883 CD2 TYR B 344 -28.512 -8.442 3.552 1.00 27.72 C ANISOU14883 CD2 TYR B 344 2835 3966 3731 1032 568 721 C ATOM 14884 CE1 TYR B 344 -29.357 -5.907 2.856 1.00 28.60 C ANISOU14884 CE1 TYR B 344 2951 4077 3838 1063 565 760 C ATOM 14885 CE2 TYR B 344 -29.073 -7.611 4.516 1.00 22.18 C ANISOU14885 CE2 TYR B 344 2162 3274 2989 1085 523 711 C ATOM 14886 CZ TYR B 344 -29.493 -6.340 4.159 1.00 24.17 C ANISOU14886 CZ TYR B 344 2416 3525 3243 1098 520 724 C ATOM 14887 OH TYR B 344 -30.054 -5.477 5.083 1.00 30.75 O ANISOU14887 OH TYR B 344 3274 4365 4043 1149 475 703 O ATOM 14888 H TYR B 344 -25.733 -8.074 2.697 1.00 31.19 H ATOM 14889 HA TYR B 344 -25.952 -9.463 0.370 1.00 33.10 H ATOM 14890 HB2 TYR B 344 -28.246 -8.787 0.356 1.00 29.46 H ATOM 14891 HB3 TYR B 344 -27.885 -9.845 1.479 1.00 29.46 H ATOM 14892 HD1 TYR B 344 -28.708 -6.442 1.029 1.00 35.08 H ATOM 14893 HD2 TYR B 344 -28.229 -9.295 3.793 1.00 33.26 H ATOM 14894 HE1 TYR B 344 -29.639 -5.054 2.618 1.00 34.32 H ATOM 14895 HE2 TYR B 344 -29.163 -7.905 5.393 1.00 26.61 H ATOM 14896 HH TYR B 344 -30.086 -5.844 5.837 1.00 36.90 H ATOM 14897 N SER B 345 -24.932 -6.739 0.379 1.00 25.91 N ANISOU14897 N SER B 345 2464 3555 3827 920 688 677 N ATOM 14898 CA SER B 345 -24.617 -5.472 -0.288 1.00 26.31 C ANISOU14898 CA SER B 345 2490 3567 3938 916 720 705 C ATOM 14899 C SER B 345 -24.413 -5.621 -1.798 1.00 24.62 C ANISOU14899 C SER B 345 2253 3369 3733 852 818 751 C ATOM 14900 O SER B 345 -24.504 -4.643 -2.540 1.00 31.32 O ANISOU14900 O SER B 345 3091 4208 4600 847 863 806 O ATOM 14901 CB SER B 345 -23.379 -4.821 0.342 1.00 27.18 C ANISOU14901 CB SER B 345 2566 3586 4174 935 677 637 C ATOM 14902 OG SER B 345 -22.393 -5.784 0.664 1.00 31.58 O ANISOU14902 OG SER B 345 3098 4115 4785 917 662 570 O ATOM 14903 H SER B 345 -24.352 -6.976 0.968 1.00 31.09 H ATOM 14904 HA SER B 345 -25.363 -4.866 -0.156 1.00 31.57 H ATOM 14905 HB2 SER B 345 -23.004 -4.186 -0.288 1.00 32.61 H ATOM 14906 HB3 SER B 345 -23.645 -4.361 1.154 1.00 32.61 H ATOM 14907 HG SER B 345 -22.151 -6.190 -0.031 1.00 37.89 H ATOM 14908 N ASP B 346 -24.155 -6.843 -2.252 1.00 19.27 N ANISOU14908 N ASP B 346 1571 2714 3037 802 851 726 N ATOM 14909 CA ASP B 346 -23.851 -7.088 -3.660 1.00 19.53 C ANISOU14909 CA ASP B 346 1592 2762 3067 731 936 745 C ATOM 14910 C ASP B 346 -25.097 -7.421 -4.478 1.00 21.57 C ANISOU14910 C ASP B 346 1893 3105 3198 710 958 802 C ATOM 14911 O ASP B 346 -25.028 -7.522 -5.704 1.00 21.36 O ANISOU14911 O ASP B 346 1873 3101 3141 652 1018 818 O ATOM 14912 CB ASP B 346 -22.827 -8.217 -3.798 1.00 20.38 C ANISOU14912 CB ASP B 346 1673 2844 3228 685 953 671 C ATOM 14913 CG ASP B 346 -23.305 -9.519 -3.185 1.00 31.50 C ANISOU14913 CG ASP B 346 3101 4286 4581 696 907 642 C ATOM 14914 OD1 ASP B 346 -24.075 -9.473 -2.197 1.00 21.26 O ANISOU14914 OD1 ASP B 346 1831 3009 3238 751 847 659 O ATOM 14915 OD2 ASP B 346 -22.905 -10.588 -3.695 1.00 39.42 O ANISOU14915 OD2 ASP B 346 4094 5296 5590 650 934 601 O ATOM 14916 H ASP B 346 -24.149 -7.551 -1.763 1.00 23.12 H ATOM 14917 HA ASP B 346 -23.458 -6.285 -4.037 1.00 23.44 H ATOM 14918 HB2 ASP B 346 -22.654 -8.374 -4.739 1.00 24.46 H ATOM 14919 HB3 ASP B 346 -22.008 -7.957 -3.348 1.00 24.46 H ATOM 14920 N ILE B 347 -26.224 -7.607 -3.794 1.00 21.56 N ANISOU14920 N ILE B 347 1921 3149 3121 754 905 823 N ATOM 14921 CA ILE B 347 -27.504 -7.847 -4.457 1.00 18.77 C ANISOU14921 CA ILE B 347 1601 2872 2657 742 910 873 C ATOM 14922 C ILE B 347 -28.501 -6.738 -4.102 1.00 22.39 C ANISOU14922 C ILE B 347 2075 3356 3076 804 881 935 C ATOM 14923 O ILE B 347 -29.713 -6.887 -4.269 1.00 29.76 O ANISOU14923 O ILE B 347 3031 4352 3924 815 863 971 O ATOM 14924 CB ILE B 347 -28.075 -9.232 -4.089 1.00 18.35 C ANISOU14924 CB ILE B 347 1565 2855 2554 730 879 842 C ATOM 14925 CG1 ILE B 347 -28.191 -9.383 -2.573 1.00 18.07 C ANISOU14925 CG1 ILE B 347 1533 2801 2531 787 821 823 C ATOM 14926 CG2 ILE B 347 -27.180 -10.334 -4.646 1.00 22.38 C ANISOU14926 CG2 ILE B 347 2058 3344 3101 669 912 781 C ATOM 14927 CD1 ILE B 347 -29.084 -10.523 -2.142 1.00 17.76 C ANISOU14927 CD1 ILE B 347 1513 2804 2430 785 796 823 C ATOM 14928 H ILE B 347 -26.275 -7.597 -2.936 1.00 25.87 H ATOM 14929 HA ILE B 347 -27.368 -7.828 -5.417 1.00 22.52 H ATOM 14930 HB ILE B 347 -28.959 -9.319 -4.480 1.00 22.03 H ATOM 14931 HG12 ILE B 347 -27.307 -9.544 -2.206 1.00 21.68 H ATOM 14932 HG13 ILE B 347 -28.556 -8.564 -2.203 1.00 21.68 H ATOM 14933 HG21 ILE B 347 -27.554 -11.196 -4.405 1.00 26.86 H ATOM 14934 HG22 ILE B 347 -27.138 -10.249 -5.611 1.00 26.86 H ATOM 14935 HG23 ILE B 347 -26.292 -10.240 -4.267 1.00 26.86 H ATOM 14936 HD11 ILE B 347 -29.108 -10.556 -1.173 1.00 21.31 H ATOM 14937 HD12 ILE B 347 -29.977 -10.373 -2.490 1.00 21.31 H ATOM 14938 HD13 ILE B 347 -28.727 -11.354 -2.493 1.00 21.31 H ATOM 14939 N VAL B 348 -27.966 -5.629 -3.600 1.00 28.07 N ANISOU14939 N VAL B 348 4019 2598 4048 -631 728 1419 N ATOM 14940 CA VAL B 348 -28.735 -4.423 -3.318 1.00 26.33 C ANISOU14940 CA VAL B 348 3760 2474 3771 -579 776 1446 C ATOM 14941 C VAL B 348 -28.036 -3.282 -4.057 1.00 24.94 C ANISOU14941 C VAL B 348 3638 2330 3506 -538 735 1364 C ATOM 14942 O VAL B 348 -26.867 -3.408 -4.407 1.00 24.95 O ANISOU14942 O VAL B 348 3700 2303 3477 -537 676 1302 O ATOM 14943 CB VAL B 348 -28.804 -4.175 -1.790 1.00 26.65 C ANISOU14943 CB VAL B 348 3792 2583 3749 -522 828 1500 C ATOM 14944 CG1 VAL B 348 -28.459 -2.735 -1.415 1.00 29.24 C ANISOU14944 CG1 VAL B 348 4159 2997 3953 -442 834 1462 C ATOM 14945 CG2 VAL B 348 -30.172 -4.557 -1.251 1.00 28.09 C ANISOU14945 CG2 VAL B 348 3875 2789 4009 -533 897 1608 C ATOM 14946 H VAL B 348 -27.131 -5.551 -3.409 1.00 33.68 H ATOM 14947 HA VAL B 348 -29.636 -4.516 -3.663 1.00 31.60 H ATOM 14948 HB VAL B 348 -28.152 -4.749 -1.358 1.00 31.97 H ATOM 14949 HG11 VAL B 348 -28.518 -2.637 -0.452 1.00 35.08 H ATOM 14950 HG12 VAL B 348 -27.557 -2.540 -1.714 1.00 35.08 H ATOM 14951 HG13 VAL B 348 -29.088 -2.137 -1.848 1.00 35.08 H ATOM 14952 HG21 VAL B 348 -30.192 -4.393 -0.295 1.00 33.71 H ATOM 14953 HG22 VAL B 348 -30.847 -4.018 -1.693 1.00 33.71 H ATOM 14954 HG23 VAL B 348 -30.330 -5.497 -1.430 1.00 33.71 H ATOM 14955 N THR B 349 -28.742 -2.188 -4.322 1.00 30.31 N ANISOU14955 N THR B 349 4291 3074 4152 -499 767 1371 N ATOM 14956 CA THR B 349 -28.145 -1.075 -5.052 1.00 26.44 C ANISOU14956 CA THR B 349 3846 2615 3587 -458 732 1300 C ATOM 14957 C THR B 349 -28.705 0.270 -4.620 1.00 23.34 C ANISOU14957 C THR B 349 3443 2309 3117 -385 780 1313 C ATOM 14958 O THR B 349 -29.543 0.352 -3.723 1.00 26.28 O ANISOU14958 O THR B 349 3774 2724 3488 -358 842 1379 O ATOM 14959 CB THR B 349 -28.363 -1.222 -6.564 1.00 30.03 C ANISOU14959 CB THR B 349 4288 3018 4104 -499 705 1273 C ATOM 14960 OG1 THR B 349 -27.742 -0.128 -7.248 1.00 36.04 O ANISOU14960 OG1 THR B 349 5089 3813 4790 -451 676 1211 O ATOM 14961 CG2 THR B 349 -29.844 -1.240 -6.889 1.00 33.09 C ANISOU14961 CG2 THR B 349 4586 3420 4568 -525 756 1341 C ATOM 14962 H THR B 349 -29.562 -2.066 -4.093 1.00 36.38 H ATOM 14963 HA THR B 349 -27.190 -1.067 -4.887 1.00 31.73 H ATOM 14964 HB THR B 349 -27.972 -2.057 -6.867 1.00 36.04 H ATOM 14965 HG1 THR B 349 -26.918 -0.120 -7.087 1.00 43.24 H ATOM 14966 HG21 THR B 349 -29.972 -1.334 -7.846 1.00 39.71 H ATOM 14967 HG22 THR B 349 -30.273 -1.985 -6.439 1.00 39.71 H ATOM 14968 HG23 THR B 349 -30.257 -0.414 -6.595 1.00 39.71 H ATOM 14969 N THR B 350 -28.225 1.320 -5.277 1.00 33.56 N ANISOU14969 N THR B 350 4774 3629 4350 -346 753 1253 N ATOM 14970 CA THR B 350 -28.694 2.675 -5.027 1.00 30.76 C ANISOU14970 CA THR B 350 4422 3343 3922 -271 794 1253 C ATOM 14971 C THR B 350 -29.907 2.969 -5.890 1.00 38.19 C ANISOU14971 C THR B 350 5304 4303 4902 -268 836 1292 C ATOM 14972 O THR B 350 -30.148 2.294 -6.890 1.00 44.09 O ANISOU14972 O THR B 350 6019 5006 5727 -327 818 1299 O ATOM 14973 CB THR B 350 -27.606 3.717 -5.346 1.00 27.67 C ANISOU14973 CB THR B 350 4091 2966 3456 -231 746 1172 C ATOM 14974 OG1 THR B 350 -26.941 3.357 -6.564 1.00 30.38 O ANISOU14974 OG1 THR B 350 4444 3267 3832 -269 689 1128 O ATOM 14975 CG2 THR B 350 -26.588 3.799 -4.213 1.00 31.42 C ANISOU14975 CG2 THR B 350 4607 3452 3881 -214 721 1151 C ATOM 14976 H THR B 350 -27.617 1.272 -5.882 1.00 40.28 H ATOM 14977 HA THR B 350 -28.946 2.766 -4.095 1.00 36.91 H ATOM 14978 HB THR B 350 -28.017 4.589 -5.450 1.00 33.20 H ATOM 14979 HG1 THR B 350 -26.346 3.922 -6.744 1.00 36.46 H ATOM 14980 HG21 THR B 350 -25.908 4.458 -4.425 1.00 37.71 H ATOM 14981 HG22 THR B 350 -27.029 4.056 -3.388 1.00 37.71 H ATOM 14982 HG23 THR B 350 -26.162 2.937 -4.087 1.00 37.71 H ATOM 14983 N LEU B 351 -30.661 3.988 -5.497 1.00 42.92 N ANISOU14983 N LEU B 351 5890 4968 5451 -195 892 1319 N ATOM 14984 CA LEU B 351 -31.882 4.363 -6.194 1.00 36.51 C ANISOU14984 CA LEU B 351 5007 4196 4668 -177 939 1371 C ATOM 14985 C LEU B 351 -31.558 5.060 -7.513 1.00 38.94 C ANISOU14985 C LEU B 351 5343 4499 4953 -167 907 1314 C ATOM 14986 O LEU B 351 -30.875 6.084 -7.527 1.00 41.64 O ANISOU14986 O LEU B 351 5753 4854 5214 -111 888 1250 O ATOM 14987 CB LEU B 351 -32.716 5.287 -5.305 1.00 35.83 C ANISOU14987 CB LEU B 351 4904 4187 4524 -83 1011 1418 C ATOM 14988 CG LEU B 351 -33.921 5.959 -5.953 1.00 36.20 C ANISOU14988 CG LEU B 351 4880 4298 4578 -36 1062 1471 C ATOM 14989 CD1 LEU B 351 -34.835 4.923 -6.565 1.00 47.52 C ANISOU14989 CD1 LEU B 351 6193 5733 6130 -116 1070 1554 C ATOM 14990 CD2 LEU B 351 -34.664 6.770 -4.917 1.00 36.61 C ANISOU14990 CD2 LEU B 351 4922 4420 4570 69 1134 1518 C ATOM 14991 H LEU B 351 -30.482 4.486 -4.819 1.00 51.51 H ATOM 14992 HA LEU B 351 -32.403 3.568 -6.386 1.00 43.81 H ATOM 14993 HB2 LEU B 351 -33.047 4.767 -4.556 1.00 43.00 H ATOM 14994 HB3 LEU B 351 -32.138 5.992 -4.975 1.00 43.00 H ATOM 14995 HG LEU B 351 -33.619 6.557 -6.655 1.00 43.45 H ATOM 14996 HD11 LEU B 351 -35.593 5.371 -6.970 1.00 57.02 H ATOM 14997 HD12 LEU B 351 -34.344 4.427 -7.238 1.00 57.02 H ATOM 14998 HD13 LEU B 351 -35.140 4.321 -5.868 1.00 57.02 H ATOM 14999 HD21 LEU B 351 -35.428 7.194 -5.338 1.00 43.94 H ATOM 15000 HD22 LEU B 351 -34.962 6.179 -4.208 1.00 43.94 H ATOM 15001 HD23 LEU B 351 -34.067 7.445 -4.557 1.00 43.94 H ATOM 15002 N ASP B 352 -32.049 4.504 -8.618 1.00 49.02 N ANISOU15002 N ASP B 352 6560 5756 6309 -222 900 1342 N ATOM 15003 CA ASP B 352 -31.878 5.119 -9.933 1.00 48.86 C ANISOU15003 CA ASP B 352 6555 5739 6269 -206 879 1305 C ATOM 15004 C ASP B 352 -33.066 6.036 -10.214 1.00 46.42 C ANISOU15004 C ASP B 352 6181 5517 5938 -141 939 1363 C ATOM 15005 O ASP B 352 -34.187 5.568 -10.411 1.00 46.38 O ANISOU15005 O ASP B 352 6064 5546 6010 -173 971 1451 O ATOM 15006 CB ASP B 352 -31.769 4.039 -11.016 1.00 50.70 C ANISOU15006 CB ASP B 352 6757 5903 6606 -296 840 1309 C ATOM 15007 CG ASP B 352 -31.492 4.614 -12.399 1.00 57.94 C ANISOU15007 CG ASP B 352 7694 6821 7498 -273 821 1275 C ATOM 15008 OD1 ASP B 352 -30.906 5.717 -12.492 1.00 64.10 O ANISOU15008 OD1 ASP B 352 8544 7637 8175 -198 816 1219 O ATOM 15009 OD2 ASP B 352 -31.852 3.951 -13.395 1.00 57.90 O ANISOU15009 OD2 ASP B 352 7631 6782 7589 -336 806 1307 O ATOM 15010 H ASP B 352 -32.488 3.765 -8.633 1.00 58.82 H ATOM 15011 HA ASP B 352 -31.067 5.650 -9.941 1.00 58.63 H ATOM 15012 HB2 ASP B 352 -31.043 3.438 -10.791 1.00 60.85 H ATOM 15013 HB3 ASP B 352 -32.605 3.549 -11.058 1.00 60.85 H ATOM 15014 N LEU B 353 -32.814 7.342 -10.219 1.00 22.42 N ANISOU15014 N LEU B 353 3203 2515 2800 -51 948 1316 N ATOM 15015 CA LEU B 353 -33.868 8.335 -10.398 1.00 22.92 C ANISOU15015 CA LEU B 353 3219 2662 2827 32 1005 1363 C ATOM 15016 C LEU B 353 -34.218 8.580 -11.855 1.00 22.91 C ANISOU15016 C LEU B 353 3173 2695 2838 34 1000 1379 C ATOM 15017 O LEU B 353 -33.366 8.469 -12.739 1.00 25.42 O ANISOU15017 O LEU B 353 3540 2968 3152 5 951 1323 O ATOM 15018 CB LEU B 353 -33.431 9.678 -9.822 1.00 22.39 C ANISOU15018 CB LEU B 353 3242 2606 2659 128 1014 1301 C ATOM 15019 CG LEU B 353 -33.194 9.813 -8.325 1.00 22.53 C ANISOU15019 CG LEU B 353 3306 2612 2642 159 1032 1292 C ATOM 15020 CD1 LEU B 353 -32.677 11.221 -8.055 1.00 24.64 C ANISOU15020 CD1 LEU B 353 3664 2875 2823 244 1031 1226 C ATOM 15021 CD2 LEU B 353 -34.466 9.522 -7.541 1.00 30.62 C ANISOU15021 CD2 LEU B 353 4246 3696 3693 189 1104 1392 C ATOM 15022 H LEU B 353 -32.031 7.682 -10.119 1.00 26.90 H ATOM 15023 HA LEU B 353 -34.669 8.046 -9.933 1.00 27.50 H ATOM 15024 HB2 LEU B 353 -32.599 9.925 -10.256 1.00 26.87 H ATOM 15025 HB3 LEU B 353 -34.110 10.331 -10.054 1.00 26.87 H ATOM 15026 HG LEU B 353 -32.513 9.179 -8.049 1.00 27.03 H ATOM 15027 HD11 LEU B 353 -32.521 11.322 -7.103 1.00 29.57 H ATOM 15028 HD12 LEU B 353 -31.848 11.351 -8.542 1.00 29.57 H ATOM 15029 HD13 LEU B 353 -33.341 11.863 -8.352 1.00 29.57 H ATOM 15030 HD21 LEU B 353 -34.282 9.616 -6.594 1.00 36.75 H ATOM 15031 HD22 LEU B 353 -35.153 10.153 -7.809 1.00 36.75 H ATOM 15032 HD23 LEU B 353 -34.755 8.616 -7.734 1.00 36.75 H ATOM 15033 N ALA B 354 -35.473 8.946 -12.093 1.00 25.61 N ANISOU15033 N ALA B 354 3415 3128 3188 77 1051 1461 N ATOM 15034 CA ALA B 354 -35.864 9.539 -13.362 1.00 27.73 C ANISOU15034 CA ALA B 354 3641 3461 3435 114 1053 1479 C ATOM 15035 C ALA B 354 -35.342 10.981 -13.341 1.00 27.07 C ANISOU15035 C ALA B 354 3665 3378 3241 223 1055 1399 C ATOM 15036 O ALA B 354 -34.971 11.478 -12.276 1.00 36.78 O ANISOU15036 O ALA B 354 4971 4575 4430 263 1064 1356 O ATOM 15037 CB ALA B 354 -37.374 9.503 -13.513 1.00 32.27 C ANISOU15037 CB ALA B 354 4059 4152 4051 128 1101 1597 C ATOM 15038 H ALA B 354 -36.119 8.861 -11.532 1.00 30.73 H ATOM 15039 HA ALA B 354 -35.455 9.060 -14.099 1.00 33.28 H ATOM 15040 HB1 ALA B 354 -37.616 9.902 -14.363 1.00 38.73 H ATOM 15041 HB2 ALA B 354 -37.671 8.580 -13.483 1.00 38.73 H ATOM 15042 HB3 ALA B 354 -37.776 10.004 -12.785 1.00 38.73 H ATOM 15043 N PRO B 355 -35.289 11.649 -14.511 1.00 23.11 N ANISOU15043 N PRO B 355 3167 2915 2699 267 1043 1383 N ATOM 15044 CA PRO B 355 -34.876 13.058 -14.615 1.00 22.77 C ANISOU15044 CA PRO B 355 3210 2870 2573 364 1041 1316 C ATOM 15045 C PRO B 355 -35.475 13.960 -13.518 1.00 23.41 C ANISOU15045 C PRO B 355 3308 2969 2618 454 1095 1328 C ATOM 15046 O PRO B 355 -36.692 14.131 -13.475 1.00 24.64 O ANISOU15046 O PRO B 355 3374 3211 2778 508 1149 1410 O ATOM 15047 CB PRO B 355 -35.413 13.460 -15.984 1.00 23.42 C ANISOU15047 CB PRO B 355 3227 3039 2633 408 1045 1352 C ATOM 15048 CG PRO B 355 -35.310 12.196 -16.797 1.00 22.62 C ANISOU15048 CG PRO B 355 3063 2942 2588 311 1014 1389 C ATOM 15049 CD PRO B 355 -35.506 11.046 -15.839 1.00 23.02 C ANISOU15049 CD PRO B 355 3076 2946 2724 219 1022 1428 C ATOM 15050 HA PRO B 355 -33.909 13.133 -14.609 1.00 27.33 H ATOM 15051 HB2 PRO B 355 -36.336 13.747 -15.905 1.00 28.11 H ATOM 15052 HB3 PRO B 355 -34.861 14.162 -16.363 1.00 28.11 H ATOM 15053 HG2 PRO B 355 -36.002 12.192 -17.476 1.00 27.14 H ATOM 15054 HG3 PRO B 355 -34.432 12.148 -17.208 1.00 27.14 H ATOM 15055 HD2 PRO B 355 -36.410 10.700 -15.908 1.00 27.62 H ATOM 15056 HD3 PRO B 355 -34.848 10.353 -16.005 1.00 27.62 H ATOM 15057 N PRO B 356 -34.630 14.521 -12.633 1.00 24.86 N ANISOU15057 N PRO B 356 3600 3079 2767 473 1081 1255 N ATOM 15058 CA PRO B 356 -35.106 15.259 -11.454 1.00 28.76 C ANISOU15058 CA PRO B 356 4124 3577 3226 558 1136 1268 C ATOM 15059 C PRO B 356 -35.480 16.721 -11.707 1.00 28.55 C ANISOU15059 C PRO B 356 4133 3570 3146 678 1170 1259 C ATOM 15060 O PRO B 356 -35.926 17.397 -10.779 1.00 32.93 O ANISOU15060 O PRO B 356 4719 4125 3667 765 1223 1273 O ATOM 15061 CB PRO B 356 -33.909 15.183 -10.502 1.00 26.01 C ANISOU15061 CB PRO B 356 3876 3142 2865 516 1098 1193 C ATOM 15062 CG PRO B 356 -32.741 15.153 -11.398 1.00 24.38 C ANISOU15062 CG PRO B 356 3712 2888 2663 456 1024 1123 C ATOM 15063 CD PRO B 356 -33.165 14.371 -12.616 1.00 24.42 C ANISOU15063 CD PRO B 356 3633 2937 2707 410 1013 1166 C ATOM 15064 HA PRO B 356 -35.861 14.800 -11.054 1.00 34.51 H ATOM 15065 HB2 PRO B 356 -33.890 15.968 -9.933 1.00 31.21 H ATOM 15066 HB3 PRO B 356 -33.960 14.372 -9.972 1.00 31.21 H ATOM 15067 HG2 PRO B 356 -32.498 16.059 -11.643 1.00 29.26 H ATOM 15068 HG3 PRO B 356 -32.001 14.712 -10.951 1.00 29.26 H ATOM 15069 HD2 PRO B 356 -32.776 14.757 -13.417 1.00 29.30 H ATOM 15070 HD3 PRO B 356 -32.922 13.437 -12.519 1.00 29.30 H ATOM 15071 N THR B 357 -35.309 17.193 -12.938 1.00 22.69 N ANISOU15071 N THR B 357 3384 2842 2394 691 1144 1240 N ATOM 15072 CA THR B 357 -35.644 18.569 -13.290 1.00 22.98 C ANISOU15072 CA THR B 357 3451 2893 2388 805 1175 1236 C ATOM 15073 C THR B 357 -36.310 18.583 -14.657 1.00 30.12 C ANISOU15073 C THR B 357 4261 3888 3296 828 1175 1285 C ATOM 15074 O THR B 357 -36.242 17.598 -15.392 1.00 30.99 O ANISOU15074 O THR B 357 4305 4033 3435 747 1141 1304 O ATOM 15075 CB THR B 357 -34.390 19.490 -13.318 1.00 24.50 C ANISOU15075 CB THR B 357 3765 2989 2553 806 1135 1143 C ATOM 15076 OG1 THR B 357 -33.580 19.191 -14.464 1.00 31.19 O ANISOU15076 OG1 THR B 357 4605 3830 3417 737 1070 1108 O ATOM 15077 CG2 THR B 357 -33.563 19.328 -12.048 1.00 21.90 C ANISOU15077 CG2 THR B 357 3522 2581 2219 764 1119 1093 C ATOM 15078 H THR B 357 -34.998 16.731 -13.594 1.00 27.22 H ATOM 15079 HA THR B 357 -36.271 18.924 -12.640 1.00 27.58 H ATOM 15080 HB THR B 357 -34.680 20.414 -13.369 1.00 29.39 H ATOM 15081 HG1 THR B 357 -32.904 19.690 -14.475 1.00 37.43 H ATOM 15082 HG21 THR B 357 -32.786 19.908 -12.083 1.00 26.28 H ATOM 15083 HG22 THR B 357 -34.097 19.561 -11.273 1.00 26.28 H ATOM 15084 HG23 THR B 357 -33.266 18.409 -11.962 1.00 26.28 H ATOM 15085 N LYS B 358 -36.953 19.697 -14.993 1.00 44.01 N ANISOU15085 N LYS B 358 6013 5687 5023 943 1215 1310 N ATOM 15086 CA LYS B 358 -37.577 19.852 -16.304 1.00 38.93 C ANISOU15086 CA LYS B 358 5277 5144 4372 980 1213 1358 C ATOM 15087 C LYS B 358 -36.525 19.834 -17.402 1.00 34.41 C ANISOU15087 C LYS B 358 4740 4540 3796 926 1147 1298 C ATOM 15088 O LYS B 358 -36.719 19.227 -18.455 1.00 32.03 O ANISOU15088 O LYS B 358 4356 4317 3496 895 1121 1330 O ATOM 15089 CB LYS B 358 -38.363 21.159 -16.374 1.00 33.57 C ANISOU15089 CB LYS B 358 4597 4500 3658 1126 1268 1392 C ATOM 15090 CG LYS B 358 -39.623 21.156 -15.542 1.00 43.92 C ANISOU15090 CG LYS B 358 5840 5879 4968 1201 1338 1475 C ATOM 15091 CD LYS B 358 -40.145 22.564 -15.295 1.00 45.65 C ANISOU15091 CD LYS B 358 6107 6090 5147 1357 1397 1490 C ATOM 15092 CE LYS B 358 -41.317 22.558 -14.323 1.00 48.01 C ANISOU15092 CE LYS B 358 6350 6451 5442 1442 1468 1573 C ATOM 15093 NZ LYS B 358 -42.466 21.780 -14.856 1.00 48.49 N ANISOU15093 NZ LYS B 358 6229 6668 5528 1428 1475 1680 N ATOM 15094 H LYS B 358 -37.043 20.380 -14.479 1.00 52.82 H ATOM 15095 HA LYS B 358 -38.191 19.117 -16.456 1.00 46.72 H ATOM 15096 HB2 LYS B 358 -37.799 21.881 -16.056 1.00 40.28 H ATOM 15097 HB3 LYS B 358 -38.617 21.322 -17.296 1.00 40.28 H ATOM 15098 HG2 LYS B 358 -40.312 20.656 -16.007 1.00 52.70 H ATOM 15099 HG3 LYS B 358 -39.436 20.748 -14.682 1.00 52.70 H ATOM 15100 HD2 LYS B 358 -39.436 23.106 -14.914 1.00 54.78 H ATOM 15101 HD3 LYS B 358 -40.446 22.946 -16.134 1.00 54.78 H ATOM 15102 HE2 LYS B 358 -41.038 22.152 -13.488 1.00 57.62 H ATOM 15103 HE3 LYS B 358 -41.612 23.469 -14.171 1.00 57.62 H ATOM 15104 HZ1 LYS B 358 -43.137 21.791 -14.272 1.00 58.19 H ATOM 15105 HZ2 LYS B 358 -42.744 22.136 -15.623 1.00 58.19 H ATOM 15106 HZ3 LYS B 358 -42.221 20.937 -15.001 1.00 58.19 H ATOM 15107 N LYS B 359 -35.412 20.511 -17.150 1.00 31.59 N ANISOU15107 N LYS B 359 4500 4075 3428 919 1120 1218 N ATOM 15108 CA LYS B 359 -34.333 20.597 -18.127 1.00 33.48 C ANISOU15108 CA LYS B 359 4773 4284 3666 874 1059 1164 C ATOM 15109 C LYS B 359 -33.756 19.213 -18.421 1.00 38.02 C ANISOU15109 C LYS B 359 5321 4859 4266 761 1007 1151 C ATOM 15110 O LYS B 359 -33.555 18.850 -19.583 1.00 32.62 O ANISOU15110 O LYS B 359 4597 4224 3574 745 973 1157 O ATOM 15111 CB LYS B 359 -33.236 21.538 -17.624 1.00 37.62 C ANISOU15111 CB LYS B 359 5416 4697 4184 873 1041 1091 C ATOM 15112 CG LYS B 359 -32.311 22.055 -18.719 1.00 41.13 C ANISOU15112 CG LYS B 359 5881 5125 4623 862 994 1056 C ATOM 15113 CD LYS B 359 -31.570 23.324 -18.304 1.00 44.07 C ANISOU15113 CD LYS B 359 6353 5407 4986 888 997 1012 C ATOM 15114 CE LYS B 359 -32.516 24.516 -18.117 1.00 51.08 C ANISOU15114 CE LYS B 359 7260 6301 5847 1015 1071 1047 C ATOM 15115 NZ LYS B 359 -33.488 24.694 -19.242 1.00 45.86 N ANISOU15115 NZ LYS B 359 6505 5745 5176 1096 1097 1110 N ATOM 15116 H LYS B 359 -35.255 20.933 -16.417 1.00 37.91 H ATOM 15117 HA LYS B 359 -34.684 20.959 -18.956 1.00 40.18 H ATOM 15118 HB2 LYS B 359 -33.653 22.305 -17.202 1.00 45.15 H ATOM 15119 HB3 LYS B 359 -32.691 21.063 -16.976 1.00 45.15 H ATOM 15120 HG2 LYS B 359 -31.651 21.374 -18.924 1.00 49.36 H ATOM 15121 HG3 LYS B 359 -32.837 22.257 -19.508 1.00 49.36 H ATOM 15122 HD2 LYS B 359 -31.115 23.166 -17.462 1.00 52.89 H ATOM 15123 HD3 LYS B 359 -30.927 23.556 -18.992 1.00 52.89 H ATOM 15124 HE2 LYS B 359 -33.026 24.386 -17.302 1.00 61.30 H ATOM 15125 HE3 LYS B 359 -31.988 25.327 -18.049 1.00 61.30 H ATOM 15126 HZ1 LYS B 359 -34.011 25.397 -19.083 1.00 55.03 H ATOM 15127 HZ2 LYS B 359 -33.049 24.827 -20.005 1.00 55.03 H ATOM 15128 HZ3 LYS B 359 -33.996 23.968 -19.323 1.00 55.03 H ATOM 15129 N LEU B 360 -33.507 18.439 -17.368 1.00 40.85 N ANISOU15129 N LEU B 360 5705 5166 4652 691 1003 1138 N ATOM 15130 CA LEU B 360 -32.943 17.097 -17.509 1.00 30.45 C ANISOU15130 CA LEU B 360 4373 3831 3365 586 960 1128 C ATOM 15131 C LEU B 360 -33.954 16.133 -18.106 1.00 33.71 C ANISOU15131 C LEU B 360 4674 4338 3795 569 981 1210 C ATOM 15132 O LEU B 360 -33.585 15.174 -18.789 1.00 35.99 O ANISOU15132 O LEU B 360 4942 4633 4100 505 946 1215 O ATOM 15133 CB LEU B 360 -32.474 16.567 -16.153 1.00 29.37 C ANISOU15133 CB LEU B 360 4285 3619 3255 524 954 1099 C ATOM 15134 CG LEU B 360 -31.088 17.044 -15.718 1.00 30.97 C ANISOU15134 CG LEU B 360 4584 3735 3449 495 906 1016 C ATOM 15135 CD1 LEU B 360 -30.869 16.824 -14.229 1.00 33.86 C ANISOU15135 CD1 LEU B 360 4991 4051 3823 469 914 1000 C ATOM 15136 CD2 LEU B 360 -30.022 16.323 -16.519 1.00 25.17 C ANISOU15136 CD2 LEU B 360 3854 2980 2731 422 841 981 C ATOM 15137 H LEU B 360 -33.656 18.669 -16.553 1.00 49.02 H ATOM 15138 HA LEU B 360 -32.175 17.135 -18.101 1.00 36.54 H ATOM 15139 HB2 LEU B 360 -33.107 16.850 -15.475 1.00 35.24 H ATOM 15140 HB3 LEU B 360 -32.451 15.598 -16.192 1.00 35.24 H ATOM 15141 HG LEU B 360 -31.009 17.994 -15.897 1.00 37.17 H ATOM 15142 HD11 LEU B 360 -29.982 17.138 -13.991 1.00 40.63 H ATOM 15143 HD12 LEU B 360 -31.540 17.320 -13.735 1.00 40.63 H ATOM 15144 HD13 LEU B 360 -30.948 15.877 -14.035 1.00 40.63 H ATOM 15145 HD21 LEU B 360 -29.149 16.634 -16.234 1.00 30.21 H ATOM 15146 HD22 LEU B 360 -30.101 15.369 -16.362 1.00 30.21 H ATOM 15147 HD23 LEU B 360 -30.151 16.516 -17.461 1.00 30.21 H HETATM15148 N MSE B 361 -35.229 16.384 -17.838 1.00 50.16 N ANISOU15148 N MSE B 361 6681 6500 5878 627 1037 1283 N HETATM15149 CA MSE B 361 -36.285 15.568 -18.408 1.00 49.42 C ANISOU15149 CA MSE B 361 6451 6521 5805 606 1056 1378 C HETATM15150 C MSE B 361 -36.372 15.791 -19.912 1.00 54.74 C ANISOU15150 C MSE B 361 7073 7289 6435 643 1031 1393 C HETATM15151 O MSE B 361 -36.581 14.852 -20.679 1.00 60.44 O ANISOU15151 O MSE B 361 7704 8073 7186 578 982 1399 O HETATM15152 CB MSE B 361 -37.625 15.885 -17.760 1.00 52.52 C ANISOU15152 CB MSE B 361 6759 6992 6206 668 1121 1457 C HETATM15153 CG MSE B 361 -38.707 14.919 -18.163 1.00 51.63 C ANISOU15153 CG MSE B 361 6478 7004 6137 617 1135 1567 C HETATM15154 SE MSE B 361 -40.466 15.460 -17.517 1.00 50.28 SE ANISOU15154 SE MSE B 361 6173 6962 5969 715 1214 1681 SE HETATM15155 CE MSE B 361 -41.608 14.459 -18.755 1.00 55.82 C ANISOU15155 CE MSE B 361 6627 7855 6726 631 1176 1782 C HETATM15156 H MSE B 361 -35.507 17.020 -17.329 1.00 60.19 H HETATM15157 HA MSE B 361 -36.086 14.633 -18.239 1.00 59.30 H HETATM15158 HB2 MSE B 361 -37.528 15.843 -16.795 1.00 63.03 H HETATM15159 HB3 MSE B 361 -37.902 16.776 -18.027 1.00 63.03 H HETATM15160 HG2 MSE B 361 -38.743 14.870 -19.131 1.00 61.96 H HETATM15161 HG3 MSE B 361 -38.506 14.045 -17.793 1.00 61.96 H HETATM15162 HE1 MSE B 361 -42.537 14.639 -18.543 1.00 66.98 H HETATM15163 HE2 MSE B 361 -41.414 14.742 -19.662 1.00 66.98 H HETATM15164 HE3 MSE B 361 -41.424 13.511 -18.658 1.00 66.98 H HETATM15165 N MSE B 362 -36.221 17.040 -20.331 1.00100.71 N ANISOU15165 N MSE B 362 12940 13116 12211 737 1032 1357 N HETATM15166 CA MSE B 362 -36.283 17.374 -21.745 1.00 97.74 C ANISOU15166 CA MSE B 362 12516 12837 11784 789 1006 1367 C HETATM15167 C MSE B 362 -35.063 16.800 -22.456 1.00102.92 C ANISOU15167 C MSE B 362 13230 13447 12426 731 944 1309 C HETATM15168 O MSE B 362 -35.162 16.325 -23.585 1.00104.12 O ANISOU15168 O MSE B 362 13307 13687 12567 720 883 1288 O HETATM15169 CB MSE B 362 -36.361 18.892 -21.929 1.00 99.31 C ANISOU15169 CB MSE B 362 12754 13029 11952 902 1026 1346 C HETATM15170 CG MSE B 362 -36.556 19.339 -23.373 1.00111.58 C ANISOU15170 CG MSE B 362 14245 14697 13453 972 1004 1365 C HETATM15171 SE MSE B 362 -35.255 20.663 -23.985 1.00132.44 SE ANISOU15171 SE MSE B 362 17002 17240 16081 1022 973 1283 SE HETATM15172 CE MSE B 362 -36.014 22.266 -23.167 1.00112.54 C ANISOU15172 CE MSE B 362 14515 14675 13570 1140 1050 1307 C HETATM15173 H MSE B 362 -36.082 17.714 -19.816 1.00120.86 H HETATM15174 HA MSE B 362 -37.085 16.983 -22.128 1.00117.29 H HETATM15175 HB2 MSE B 362 -37.109 19.230 -21.412 1.00119.18 H HETATM15176 HB3 MSE B 362 -35.535 19.287 -21.607 1.00119.18 H HETATM15177 HG2 MSE B 362 -36.483 18.564 -23.951 1.00133.89 H HETATM15178 HG3 MSE B 362 -37.439 19.731 -23.460 1.00133.89 H HETATM15179 HE1 MSE B 362 -35.456 23.028 -23.391 1.00135.05 H HETATM15180 HE2 MSE B 362 -36.911 22.400 -23.509 1.00135.05 H HETATM15181 HE3 MSE B 362 -36.040 22.147 -22.204 1.00135.05 H ATOM 15182 N TRP B 363 -33.919 16.828 -21.776 1.00 50.34 N ANISOU15182 N TRP B 363 6686 6646 5795 681 922 1233 N ATOM 15183 CA TRP B 363 -32.679 16.284 -22.326 1.00 40.35 C ANISOU15183 CA TRP B 363 5479 5329 4525 629 865 1179 C ATOM 15184 C TRP B 363 -32.829 14.795 -22.636 1.00 48.80 C ANISOU15184 C TRP B 363 6485 6425 5631 545 820 1174 C ATOM 15185 O TRP B 363 -32.519 14.351 -23.742 1.00 61.57 O ANISOU15185 O TRP B 363 8065 8086 7244 532 740 1108 O ATOM 15186 CB TRP B 363 -31.511 16.502 -21.359 1.00 41.81 C ANISOU15186 CB TRP B 363 5769 5373 4744 577 843 1102 C ATOM 15187 CG TRP B 363 -31.037 17.927 -21.275 1.00 48.97 C ANISOU15187 CG TRP B 363 6729 6239 5639 630 841 1059 C ATOM 15188 CD1 TRP B 363 -31.552 19.006 -21.934 1.00 47.10 C ANISOU15188 CD1 TRP B 363 6465 6059 5373 721 864 1082 C ATOM 15189 CD2 TRP B 363 -29.952 18.424 -20.482 1.00 50.76 C ANISOU15189 CD2 TRP B 363 7038 6363 5885 591 817 997 C ATOM 15190 NE1 TRP B 363 -30.854 20.143 -21.602 1.00 48.74 N ANISOU15190 NE1 TRP B 363 6742 6191 5586 739 860 1039 N ATOM 15191 CE2 TRP B 363 -29.864 19.811 -20.711 1.00 50.14 C ANISOU15191 CE2 TRP B 363 6984 6276 5790 657 829 988 C ATOM 15192 CE3 TRP B 363 -29.042 17.829 -19.599 1.00 54.32 C ANISOU15192 CE3 TRP B 363 7537 6736 6365 508 784 953 C ATOM 15193 CZ2 TRP B 363 -28.907 20.614 -20.094 1.00 54.83 C ANISOU15193 CZ2 TRP B 363 7652 6787 6396 635 810 940 C ATOM 15194 CZ3 TRP B 363 -28.087 18.627 -18.987 1.00 52.95 C ANISOU15194 CZ3 TRP B 363 7426 6495 6197 492 761 905 C ATOM 15195 CH2 TRP B 363 -28.027 20.003 -19.238 1.00 55.26 C ANISOU15195 CH2 TRP B 363 7744 6780 6472 551 774 900 C ATOM 15196 H TRP B 363 -33.834 17.158 -20.986 1.00 60.41 H ATOM 15197 HA TRP B 363 -32.473 16.744 -23.155 1.00 48.42 H ATOM 15198 HB2 TRP B 363 -31.789 16.230 -20.470 1.00 50.17 H ATOM 15199 HB3 TRP B 363 -30.762 15.958 -21.648 1.00 50.17 H ATOM 15200 HD1 TRP B 363 -32.271 18.976 -22.522 1.00 56.52 H ATOM 15201 HE1 TRP B 363 -31.011 20.933 -21.904 1.00 58.49 H ATOM 15202 HE3 TRP B 363 -29.074 16.915 -19.431 1.00 65.18 H ATOM 15203 HZ2 TRP B 363 -28.865 21.528 -20.258 1.00 65.80 H ATOM 15204 HZ3 TRP B 363 -27.478 18.242 -18.399 1.00 63.54 H ATOM 15205 HH2 TRP B 363 -27.379 20.515 -18.811 1.00 66.31 H ATOM 15206 N LYS B 364 -33.310 14.031 -21.659 1.00 34.14 N ANISOU15206 N LYS B 364 4599 4530 3842 474 836 1195 N ATOM 15207 CA LYS B 364 -33.539 12.597 -21.841 1.00 34.09 C ANISOU15207 CA LYS B 364 4511 4518 3922 365 757 1142 C ATOM 15208 C LYS B 364 -34.497 12.310 -23.001 1.00 40.26 C ANISOU15208 C LYS B 364 5152 5429 4716 365 684 1113 C ATOM 15209 O LYS B 364 -34.342 11.317 -23.711 1.00 51.59 O ANISOU15209 O LYS B 364 6547 6864 6193 297 586 1030 O ATOM 15210 CB LYS B 364 -34.080 11.972 -20.551 1.00 39.95 C ANISOU15210 CB LYS B 364 5230 5212 4737 300 802 1198 C ATOM 15211 CG LYS B 364 -34.323 10.467 -20.637 1.00 40.34 C ANISOU15211 CG LYS B 364 5200 5236 4893 177 721 1154 C ATOM 15212 CD LYS B 364 -34.767 9.902 -19.297 1.00 51.43 C ANISOU15212 CD LYS B 364 6585 6588 6368 117 777 1229 C ATOM 15213 CE LYS B 364 -35.192 8.440 -19.394 1.00 58.00 C ANISOU15213 CE LYS B 364 7321 7394 7322 -9 698 1202 C ATOM 15214 NZ LYS B 364 -34.048 7.485 -19.329 1.00 60.05 N ANISOU15214 NZ LYS B 364 7667 7525 7622 -81 645 1126 N ATOM 15215 H LYS B 364 -33.513 14.319 -20.875 1.00 40.97 H ATOM 15216 HA LYS B 364 -32.692 12.170 -22.044 1.00 40.90 H ATOM 15217 HB2 LYS B 364 -33.440 12.128 -19.838 1.00 47.94 H ATOM 15218 HB3 LYS B 364 -34.924 12.395 -20.330 1.00 47.94 H ATOM 15219 HG2 LYS B 364 -35.020 10.291 -21.288 1.00 48.41 H ATOM 15220 HG3 LYS B 364 -33.500 10.023 -20.897 1.00 48.41 H ATOM 15221 HD2 LYS B 364 -34.031 9.961 -18.668 1.00 61.71 H ATOM 15222 HD3 LYS B 364 -35.524 10.414 -18.972 1.00 61.71 H ATOM 15223 HE2 LYS B 364 -35.790 8.237 -18.658 1.00 69.60 H ATOM 15224 HE3 LYS B 364 -35.648 8.301 -20.238 1.00 69.60 H ATOM 15225 HZ1 LYS B 364 -34.347 6.649 -19.390 1.00 72.05 H ATOM 15226 HZ2 LYS B 364 -33.484 7.641 -20.000 1.00 72.05 H ATOM 15227 HZ3 LYS B 364 -33.614 7.583 -18.558 1.00 72.05 H ATOM 15228 N GLU B 365 -35.490 13.174 -23.182 1.00 57.19 N ANISOU15228 N GLU B 365 7224 7683 6821 444 730 1180 N ATOM 15229 CA GLU B 365 -36.447 13.032 -24.275 1.00 62.77 C ANISOU15229 CA GLU B 365 7791 8530 7528 454 663 1164 C ATOM 15230 C GLU B 365 -35.772 13.269 -25.622 1.00 65.81 C ANISOU15230 C GLU B 365 8200 8961 7845 503 595 1086 C ATOM 15231 O GLU B 365 -36.063 12.577 -26.602 1.00 69.54 O ANISOU15231 O GLU B 365 8588 9502 8330 467 493 1015 O ATOM 15232 CB GLU B 365 -37.600 14.025 -24.093 1.00 64.03 C ANISOU15232 CB GLU B 365 7875 8802 7651 547 743 1270 C ATOM 15233 CG GLU B 365 -38.599 14.066 -25.246 1.00 71.76 C ANISOU15233 CG GLU B 365 8704 9947 8614 575 680 1267 C ATOM 15234 CD GLU B 365 -39.508 15.281 -25.184 1.00 77.92 C ANISOU15234 CD GLU B 365 9435 10838 9334 702 771 1376 C ATOM 15235 OE1 GLU B 365 -39.613 15.996 -26.207 1.00 70.66 O ANISOU15235 OE1 GLU B 365 8489 10018 8341 793 756 1374 O ATOM 15236 OE2 GLU B 365 -40.113 15.521 -24.115 1.00 76.85 O ANISOU15236 OE2 GLU B 365 9288 10693 9220 720 861 1467 O ATOM 15237 H GLU B 365 -35.633 13.858 -22.680 1.00 68.62 H ATOM 15238 HA GLU B 365 -36.812 12.134 -24.268 1.00 75.32 H ATOM 15239 HB2 GLU B 365 -38.089 13.788 -23.290 1.00 76.83 H ATOM 15240 HB3 GLU B 365 -37.228 14.916 -23.996 1.00 76.83 H ATOM 15241 HG2 GLU B 365 -38.114 14.096 -26.086 1.00 86.11 H ATOM 15242 HG3 GLU B 365 -39.156 13.272 -25.211 1.00 86.11 H ATOM 15243 N THR B 366 -34.871 14.248 -25.654 1.00 53.04 N ANISOU15243 N THR B 366 6696 7303 6153 586 650 1103 N ATOM 15244 CA THR B 366 -34.299 14.744 -26.903 1.00 47.71 C ANISOU15244 CA THR B 366 6037 6690 5400 661 612 1064 C ATOM 15245 C THR B 366 -32.818 14.375 -27.029 1.00 47.13 C ANISOU15245 C THR B 366 6077 6515 5317 633 581 999 C ATOM 15246 O THR B 366 -32.096 14.929 -27.859 1.00 44.49 O ANISOU15246 O THR B 366 5781 6210 4913 703 572 989 O ATOM 15247 CB THR B 366 -34.524 16.287 -27.037 1.00 48.42 C ANISOU15247 CB THR B 366 6150 6836 5411 792 699 1154 C ATOM 15248 OG1 THR B 366 -34.489 16.667 -28.416 1.00 56.04 O ANISOU15248 OG1 THR B 366 7069 7918 6307 869 653 1132 O ATOM 15249 CG2 THR B 366 -33.498 17.119 -26.239 1.00 35.81 C ANISOU15249 CG2 THR B 366 4707 5110 3791 823 779 1195 C ATOM 15250 H THR B 366 -34.570 14.647 -24.954 1.00 63.64 H ATOM 15251 HA THR B 366 -34.765 14.320 -27.640 1.00 57.25 H ATOM 15252 HB THR B 366 -35.402 16.499 -26.685 1.00 58.10 H ATOM 15253 HG1 THR B 366 -34.609 17.495 -28.489 1.00 67.25 H ATOM 15254 HG21 THR B 366 -33.677 18.065 -26.353 1.00 42.98 H ATOM 15255 HG22 THR B 366 -33.555 16.898 -25.296 1.00 42.98 H ATOM 15256 HG23 THR B 366 -32.600 16.928 -26.553 1.00 42.98 H ATOM 15257 N GLY B 367 -32.383 13.416 -26.216 1.00 64.20 N ANISOU15257 N GLY B 367 8281 8562 7549 533 566 966 N ATOM 15258 CA GLY B 367 -31.005 12.963 -26.228 1.00 61.14 C ANISOU15258 CA GLY B 367 7994 8079 7159 504 539 912 C ATOM 15259 C GLY B 367 -30.857 11.644 -26.957 1.00 68.53 C ANISOU15259 C GLY B 367 8890 9019 8130 443 432 806 C ATOM 15260 O GLY B 367 -31.848 11.032 -27.363 1.00 67.76 O ANISOU15260 O GLY B 367 8690 8986 8068 405 371 770 O ATOM 15261 H GLY B 367 -32.878 13.008 -25.642 1.00 77.04 H ATOM 15262 HA2 GLY B 367 -30.449 13.625 -26.668 1.00 73.37 H ATOM 15263 HA3 GLY B 367 -30.691 12.851 -25.317 1.00 73.37 H ATOM 15264 N GLY B 368 -29.609 11.210 -27.112 1.00 56.11 N ANISOU15264 N GLY B 368 7400 7375 6545 434 406 757 N ATOM 15265 CA GLY B 368 -29.291 9.999 -27.846 1.00 60.44 C ANISOU15265 CA GLY B 368 7937 7916 7112 396 307 649 C ATOM 15266 C GLY B 368 -28.768 10.332 -29.228 1.00 59.11 C ANISOU15266 C GLY B 368 7768 7845 6846 493 265 604 C ATOM 15267 O GLY B 368 -29.031 11.413 -29.755 1.00 57.11 O ANISOU15267 O GLY B 368 7487 7691 6523 580 299 657 O ATOM 15268 H GLY B 368 -28.918 11.611 -26.794 1.00 67.33 H ATOM 15269 HA2 GLY B 368 -28.615 9.493 -27.369 1.00 72.53 H ATOM 15270 HA3 GLY B 368 -30.087 9.451 -27.936 1.00 72.53 H ATOM 15271 N VAL B 369 -28.029 9.404 -29.824 1.00 51.16 N ANISOU15271 N VAL B 369 6795 6813 5831 488 195 513 N ATOM 15272 CA VAL B 369 -27.385 9.672 -31.102 1.00 50.76 C ANISOU15272 CA VAL B 369 6753 6856 5676 593 162 475 C ATOM 15273 C VAL B 369 -28.419 9.903 -32.197 1.00 52.77 C ANISOU15273 C VAL B 369 6910 7264 5879 647 106 441 C ATOM 15274 O VAL B 369 -28.226 10.746 -33.072 1.00 52.48 O ANISOU15274 O VAL B 369 6857 7338 5744 755 121 471 O ATOM 15275 CB VAL B 369 -26.411 8.539 -31.524 1.00 49.57 C ANISOU15275 CB VAL B 369 6663 6652 5522 590 98 377 C ATOM 15276 CG1 VAL B 369 -25.444 8.236 -30.402 1.00 47.88 C ANISOU15276 CG1 VAL B 369 6535 6293 5363 533 149 416 C ATOM 15277 CG2 VAL B 369 -27.155 7.270 -31.936 1.00 51.58 C ANISOU15277 CG2 VAL B 369 6875 6898 5825 528 -12 254 C ATOM 15278 H VAL B 369 -27.886 8.616 -29.511 1.00 61.39 H ATOM 15279 HA VAL B 369 -26.864 10.486 -31.018 1.00 60.91 H ATOM 15280 HB VAL B 369 -25.894 8.840 -32.287 1.00 59.49 H ATOM 15281 HG11 VAL B 369 -24.846 7.527 -30.684 1.00 57.45 H ATOM 15282 HG12 VAL B 369 -24.936 9.037 -30.198 1.00 57.45 H ATOM 15283 HG13 VAL B 369 -25.946 7.955 -29.621 1.00 57.45 H ATOM 15284 HG21 VAL B 369 -26.508 6.594 -32.190 1.00 61.89 H ATOM 15285 HG22 VAL B 369 -27.685 6.957 -31.186 1.00 61.89 H ATOM 15286 HG23 VAL B 369 -27.733 7.474 -32.688 1.00 61.89 H ATOM 15287 N GLU B 370 -29.518 9.159 -32.140 1.00 54.49 N ANISOU15287 N GLU B 370 7054 7488 6162 569 40 386 N ATOM 15288 CA GLU B 370 -30.563 9.258 -33.153 1.00 60.38 C ANISOU15288 CA GLU B 370 7696 8382 6864 606 -29 347 C ATOM 15289 C GLU B 370 -31.175 10.655 -33.208 1.00 66.47 C ANISOU15289 C GLU B 370 8410 9263 7583 683 48 461 C ATOM 15290 O GLU B 370 -31.186 11.294 -34.260 1.00 67.02 O ANISOU15290 O GLU B 370 8448 9465 7552 791 38 466 O ATOM 15291 CB GLU B 370 -31.662 8.229 -32.886 1.00 72.01 C ANISOU15291 CB GLU B 370 9094 9829 8439 485 -111 287 C ATOM 15292 CG GLU B 370 -31.210 6.785 -33.030 1.00 85.31 C ANISOU15292 CG GLU B 370 10829 11410 10176 412 -208 159 C ATOM 15293 CD GLU B 370 -32.374 5.820 -33.154 1.00 93.01 C ANISOU15293 CD GLU B 370 11714 12386 11238 303 -318 86 C ATOM 15294 OE1 GLU B 370 -33.469 6.134 -32.640 1.00 94.01 O ANISOU15294 OE1 GLU B 370 11743 12553 11422 250 -294 163 O ATOM 15295 OE2 GLU B 370 -32.195 4.749 -33.773 1.00 96.48 O ANISOU15295 OE2 GLU B 370 12182 12789 11688 274 -431 -46 O ATOM 15296 H GLU B 370 -29.683 8.585 -31.521 1.00 65.39 H ATOM 15297 HA GLU B 370 -30.178 9.066 -34.022 1.00 72.46 H ATOM 15298 HB2 GLU B 370 -31.986 8.348 -31.980 1.00 86.42 H ATOM 15299 HB3 GLU B 370 -32.385 8.376 -33.515 1.00 86.42 H ATOM 15300 HG2 GLU B 370 -30.664 6.702 -33.827 1.00102.37 H ATOM 15301 HG3 GLU B 370 -30.694 6.535 -32.247 1.00102.37 H ATOM 15302 N LYS B 371 -31.689 11.117 -32.073 1.00 49.85 N ANISOU15302 N LYS B 371 6295 7102 5542 637 129 555 N ATOM 15303 CA LYS B 371 -32.322 12.429 -31.994 1.00 47.64 C ANISOU15303 CA LYS B 371 5972 6908 5221 713 211 666 C ATOM 15304 C LYS B 371 -31.337 13.559 -32.291 1.00 51.50 C ANISOU15304 C LYS B 371 6537 7406 5624 822 283 731 C ATOM 15305 O LYS B 371 -31.702 14.564 -32.903 1.00 55.23 O ANISOU15305 O LYS B 371 6968 7990 6027 921 315 792 O ATOM 15306 CB LYS B 371 -32.927 12.632 -30.605 1.00 46.67 C ANISOU15306 CB LYS B 371 5845 6706 5181 649 289 750 C ATOM 15307 CG LYS B 371 -34.382 12.211 -30.481 1.00 46.70 C ANISOU15307 CG LYS B 371 5719 6779 5244 591 252 756 C ATOM 15308 CD LYS B 371 -35.309 13.210 -31.147 1.00 52.69 C ANISOU15308 CD LYS B 371 6384 7702 5935 691 274 820 C ATOM 15309 CE LYS B 371 -36.752 12.989 -30.732 1.00 54.71 C ANISOU15309 CE LYS B 371 6510 8023 6256 638 268 867 C ATOM 15310 NZ LYS B 371 -37.644 14.055 -31.266 1.00 53.87 N ANISOU15310 NZ LYS B 371 6313 8075 6079 747 306 948 N ATOM 15311 H LYS B 371 -31.683 10.687 -31.329 1.00 59.82 H ATOM 15312 HA LYS B 371 -33.039 12.475 -32.645 1.00 57.17 H ATOM 15313 HB2 LYS B 371 -32.416 12.114 -29.965 1.00 56.01 H ATOM 15314 HB3 LYS B 371 -32.874 13.574 -30.379 1.00 56.01 H ATOM 15315 HG2 LYS B 371 -34.504 11.350 -30.912 1.00 56.03 H ATOM 15316 HG3 LYS B 371 -34.620 12.154 -29.543 1.00 56.03 H ATOM 15317 HD2 LYS B 371 -35.051 14.108 -30.886 1.00 63.23 H ATOM 15318 HD3 LYS B 371 -35.250 13.109 -32.110 1.00 63.23 H ATOM 15319 HE2 LYS B 371 -37.058 12.136 -31.078 1.00 65.66 H ATOM 15320 HE3 LYS B 371 -36.812 13.000 -29.764 1.00 65.66 H ATOM 15321 HZ1 LYS B 371 -38.483 13.906 -31.010 1.00 64.64 H ATOM 15322 HZ2 LYS B 371 -37.385 14.850 -30.958 1.00 64.64 H ATOM 15323 HZ3 LYS B 371 -37.609 14.064 -32.155 1.00 64.64 H ATOM 15324 N LEU B 372 -30.094 13.393 -31.848 1.00 52.58 N ANISOU15324 N LEU B 372 6781 7426 5772 801 308 726 N ATOM 15325 CA LEU B 372 -29.074 14.428 -32.009 1.00 51.40 C ANISOU15325 CA LEU B 372 6704 7267 5559 884 375 799 C ATOM 15326 C LEU B 372 -28.695 14.673 -33.469 1.00 55.47 C ANISOU15326 C LEU B 372 7190 7914 5971 993 335 778 C ATOM 15327 O LEU B 372 -28.520 15.819 -33.880 1.00 57.99 O ANISOU15327 O LEU B 372 7511 8293 6230 1086 391 864 O ATOM 15328 CB LEU B 372 -27.818 14.073 -31.211 1.00 52.14 C ANISOU15328 CB LEU B 372 6905 7215 5690 827 398 798 C ATOM 15329 CG LEU B 372 -27.676 14.717 -29.830 1.00 45.92 C ANISOU15329 CG LEU B 372 6187 6308 4952 783 486 882 C ATOM 15330 CD1 LEU B 372 -28.964 14.632 -29.018 1.00 55.22 C ANISOU15330 CD1 LEU B 372 7315 7477 6189 734 508 899 C ATOM 15331 CD2 LEU B 372 -26.530 14.064 -29.074 1.00 40.41 C ANISOU15331 CD2 LEU B 372 5579 5480 4297 712 485 862 C ATOM 15332 H LEU B 372 -29.813 12.686 -31.448 1.00 63.10 H ATOM 15333 HA LEU B 372 -29.422 15.261 -31.654 1.00 61.68 H ATOM 15334 HB2 LEU B 372 -27.803 13.112 -31.082 1.00 62.56 H ATOM 15335 HB3 LEU B 372 -27.044 14.338 -31.731 1.00 62.56 H ATOM 15336 HG LEU B 372 -27.459 15.656 -29.943 1.00 55.10 H ATOM 15337 HD11 LEU B 372 -28.822 15.053 -28.156 1.00 66.26 H ATOM 15338 HD12 LEU B 372 -29.670 15.092 -29.499 1.00 66.26 H ATOM 15339 HD13 LEU B 372 -29.199 13.699 -28.897 1.00 66.26 H ATOM 15340 HD21 LEU B 372 -26.450 14.480 -28.201 1.00 48.50 H ATOM 15341 HD22 LEU B 372 -26.717 13.117 -28.974 1.00 48.50 H ATOM 15342 HD23 LEU B 372 -25.709 14.188 -29.576 1.00 48.50 H ATOM 15343 N PHE B 373 -28.550 13.601 -34.243 1.00 62.62 N ANISOU15343 N PHE B 373 8074 8861 6856 986 241 665 N ATOM 15344 CA PHE B 373 -28.186 13.724 -35.656 1.00 64.87 C ANISOU15344 CA PHE B 373 8334 9283 7031 1099 198 636 C ATOM 15345 C PHE B 373 -29.353 14.174 -36.542 1.00 64.57 C ANISOU15345 C PHE B 373 8188 9412 6933 1169 167 640 C ATOM 15346 O PHE B 373 -29.172 14.398 -37.739 1.00 64.43 O ANISOU15346 O PHE B 373 8140 9529 6812 1277 137 627 O ATOM 15347 CB PHE B 373 -27.630 12.398 -36.185 1.00 58.51 C ANISOU15347 CB PHE B 373 7555 8462 6212 1081 104 503 C ATOM 15348 CG PHE B 373 -26.171 12.184 -35.888 1.00 53.44 C ANISOU15348 CG PHE B 373 7011 7723 5571 1084 136 516 C ATOM 15349 CD1 PHE B 373 -25.200 12.872 -36.597 1.00 59.32 C ANISOU15349 CD1 PHE B 373 7777 8537 6224 1196 175 579 C ATOM 15350 CD2 PHE B 373 -25.770 11.280 -34.917 1.00 56.83 C ANISOU15350 CD2 PHE B 373 7502 8000 6091 977 129 474 C ATOM 15351 CE1 PHE B 373 -23.856 12.672 -36.334 1.00 61.06 C ANISOU15351 CE1 PHE B 373 8074 8680 6445 1198 204 602 C ATOM 15352 CE2 PHE B 373 -24.430 11.074 -34.653 1.00 58.91 C ANISOU15352 CE2 PHE B 373 7847 8186 6351 984 157 492 C ATOM 15353 CZ PHE B 373 -23.471 11.772 -35.360 1.00 57.58 C ANISOU15353 CZ PHE B 373 7693 8091 6092 1092 194 557 C ATOM 15354 H PHE B 373 -28.657 12.790 -33.977 1.00 75.14 H ATOM 15355 HA PHE B 373 -27.485 14.389 -35.736 1.00 77.84 H ATOM 15356 HB2 PHE B 373 -28.125 11.669 -35.779 1.00 70.21 H ATOM 15357 HB3 PHE B 373 -27.743 12.375 -37.148 1.00 70.21 H ATOM 15358 HD1 PHE B 373 -25.454 13.480 -37.253 1.00 71.18 H ATOM 15359 HD2 PHE B 373 -26.411 10.808 -34.437 1.00 68.19 H ATOM 15360 HE1 PHE B 373 -23.213 13.142 -36.813 1.00 73.27 H ATOM 15361 HE2 PHE B 373 -24.174 10.468 -33.995 1.00 70.70 H ATOM 15362 HZ PHE B 373 -22.569 11.636 -35.182 1.00 69.09 H ATOM 15363 N SER B 374 -30.539 14.309 -35.950 1.00 54.93 N ANISOU15363 N SER B 374 6906 8194 5773 1114 178 666 N ATOM 15364 CA SER B 374 -31.759 14.607 -36.701 1.00 50.79 C ANISOU15364 CA SER B 374 6264 7832 5204 1165 140 670 C ATOM 15365 C SER B 374 -32.445 15.904 -36.259 1.00 48.55 C ANISOU15365 C SER B 374 5946 7580 4921 1215 241 807 C ATOM 15366 O SER B 374 -33.588 16.164 -36.638 1.00 53.13 O ANISOU15366 O SER B 374 6421 8285 5481 1247 223 828 O ATOM 15367 CB SER B 374 -32.729 13.432 -36.571 1.00 51.99 C ANISOU15367 CB SER B 374 6345 7984 5424 1055 39 569 C ATOM 15368 OG SER B 374 -32.778 12.971 -35.234 1.00 54.00 O ANISOU15368 OG SER B 374 6639 8081 5799 933 73 581 O ATOM 15369 H SER B 374 -30.665 14.232 -35.103 1.00 65.92 H ATOM 15370 HA SER B 374 -31.531 14.700 -37.640 1.00 60.95 H ATOM 15371 HB2 SER B 374 -33.616 13.722 -36.837 1.00 62.39 H ATOM 15372 HB3 SER B 374 -32.430 12.709 -37.144 1.00 62.39 H ATOM 15373 HG SER B 374 -33.035 13.589 -34.726 1.00 64.80 H ATOM 15374 N LEU B 375 -31.750 16.712 -35.462 1.00 40.55 N ANISOU15374 N LEU B 375 5023 6454 3930 1225 344 899 N ATOM 15375 CA LEU B 375 -32.279 18.005 -35.023 1.00 39.35 C ANISOU15375 CA LEU B 375 4865 6311 3775 1285 446 1026 C ATOM 15376 C LEU B 375 -31.217 19.103 -35.066 1.00 38.86 C ANISOU15376 C LEU B 375 4881 6169 3714 1340 518 1087 C ATOM 15377 O LEU B 375 -30.021 18.817 -34.977 1.00 41.00 O ANISOU15377 O LEU B 375 5224 6341 4012 1300 508 1048 O ATOM 15378 CB LEU B 375 -32.827 17.902 -33.600 1.00 42.30 C ANISOU15378 CB LEU B 375 5259 6566 4245 1194 495 1053 C ATOM 15379 CG LEU B 375 -34.055 17.015 -33.388 1.00 36.71 C ANISOU15379 CG LEU B 375 4446 5909 3594 1116 435 1003 C ATOM 15380 CD1 LEU B 375 -34.378 16.924 -31.906 1.00 34.16 C ANISOU15380 CD1 LEU B 375 4159 5460 3362 1034 498 1044 C ATOM 15381 CD2 LEU B 375 -35.255 17.539 -34.165 1.00 40.85 C ANISOU15381 CD2 LEU B 375 4843 6613 4066 1199 424 1046 C ATOM 15382 H LEU B 375 -30.964 16.535 -35.159 1.00 48.66 H ATOM 15383 HA LEU B 375 -33.007 18.266 -35.609 1.00 47.22 H ATOM 15384 HB2 LEU B 375 -32.123 17.554 -33.030 1.00 50.76 H ATOM 15385 HB3 LEU B 375 -33.065 18.794 -33.303 1.00 50.76 H ATOM 15386 HG LEU B 375 -33.858 16.120 -33.708 1.00 44.05 H ATOM 15387 HD11 LEU B 375 -35.157 16.359 -31.787 1.00 40.99 H ATOM 15388 HD12 LEU B 375 -33.617 16.541 -31.441 1.00 40.99 H ATOM 15389 HD13 LEU B 375 -34.559 17.815 -31.568 1.00 40.99 H ATOM 15390 HD21 LEU B 375 -36.013 16.953 -34.007 1.00 49.02 H ATOM 15391 HD22 LEU B 375 -35.461 18.436 -33.860 1.00 49.02 H ATOM 15392 HD23 LEU B 375 -35.038 17.552 -35.110 1.00 49.02 H ATOM 15393 N PRO B 376 -31.651 20.371 -35.184 1.00 47.60 N ANISOU15393 N PRO B 376 5951 7275 4860 1398 576 1140 N ATOM 15394 CA PRO B 376 -30.689 21.481 -35.207 1.00 47.86 C ANISOU15394 CA PRO B 376 6031 7187 4968 1408 621 1150 C ATOM 15395 C PRO B 376 -29.945 21.620 -33.881 1.00 52.40 C ANISOU15395 C PRO B 376 6712 7561 5636 1308 653 1138 C ATOM 15396 O PRO B 376 -30.396 21.094 -32.863 1.00 58.36 O ANISOU15396 O PRO B 376 7498 8264 6412 1246 662 1136 O ATOM 15397 CB PRO B 376 -31.568 22.718 -35.442 1.00 50.80 C ANISOU15397 CB PRO B 376 6345 7605 5353 1493 675 1212 C ATOM 15398 CG PRO B 376 -32.913 22.196 -35.858 1.00 47.03 C ANISOU15398 CG PRO B 376 5767 7309 4794 1542 647 1233 C ATOM 15399 CD PRO B 376 -33.044 20.847 -35.248 1.00 48.20 C ANISOU15399 CD PRO B 376 5939 7462 4914 1457 601 1198 C ATOM 15400 HA PRO B 376 -30.056 21.379 -35.936 1.00 57.44 H ATOM 15401 HB2 PRO B 376 -31.640 23.226 -34.620 1.00 60.97 H ATOM 15402 HB3 PRO B 376 -31.182 23.261 -36.147 1.00 60.97 H ATOM 15403 HG2 PRO B 376 -33.607 22.787 -35.525 1.00 56.44 H ATOM 15404 HG3 PRO B 376 -32.953 22.136 -36.825 1.00 56.44 H ATOM 15405 HD2 PRO B 376 -33.420 20.914 -34.356 1.00 57.85 H ATOM 15406 HD3 PRO B 376 -33.574 20.268 -35.817 1.00 57.85 H ATOM 15407 N ALA B 377 -28.816 22.320 -33.898 1.00 44.85 N ANISOU15407 N ALA B 377 5803 6505 4733 1289 667 1130 N ATOM 15408 CA ALA B 377 -28.061 22.584 -32.679 1.00 44.84 C ANISOU15408 CA ALA B 377 5895 6329 4812 1194 685 1112 C ATOM 15409 C ALA B 377 -28.674 23.787 -31.959 1.00 46.17 C ANISOU15409 C ALA B 377 6086 6430 5028 1211 741 1144 C ATOM 15410 O ALA B 377 -28.588 23.905 -30.737 1.00 47.88 O ANISOU15410 O ALA B 377 6372 6528 5292 1144 757 1127 O ATOM 15411 CB ALA B 377 -26.588 22.828 -33.005 1.00 45.26 C ANISOU15411 CB ALA B 377 5979 6325 4893 1161 668 1095 C ATOM 15412 H ALA B 377 -28.463 22.655 -34.607 1.00 53.82 H ATOM 15413 HA ALA B 377 -28.120 21.814 -32.092 1.00 53.81 H ATOM 15414 HB1 ALA B 377 -26.107 23.001 -32.180 1.00 54.31 H ATOM 15415 HB2 ALA B 377 -26.227 22.040 -33.440 1.00 54.31 H ATOM 15416 HB3 ALA B 377 -26.518 23.594 -33.596 1.00 54.31 H ATOM 15417 N GLN B 378 -29.291 24.675 -32.738 1.00 44.79 N ANISOU15417 N GLN B 378 5852 6336 4832 1310 771 1189 N ATOM 15418 CA GLN B 378 -30.065 25.796 -32.209 1.00 41.83 C ANISOU15418 CA GLN B 378 5488 5920 4485 1356 830 1226 C ATOM 15419 C GLN B 378 -31.544 25.460 -32.390 1.00 41.57 C ANISOU15419 C GLN B 378 5374 6014 4405 1427 842 1263 C ATOM 15420 O GLN B 378 -32.063 25.568 -33.501 1.00 46.93 O ANISOU15420 O GLN B 378 5962 6836 5033 1514 837 1296 O ATOM 15421 CB GLN B 378 -29.721 27.090 -32.958 1.00 40.72 C ANISOU15421 CB GLN B 378 5335 5783 4355 1423 862 1263 C ATOM 15422 CG GLN B 378 -30.265 28.360 -32.305 1.00 46.41 C ANISOU15422 CG GLN B 378 6098 6430 5107 1464 927 1294 C ATOM 15423 CD GLN B 378 -29.753 28.573 -30.887 1.00 51.12 C ANISOU15423 CD GLN B 378 6809 6862 5752 1372 932 1255 C ATOM 15424 OE1 GLN B 378 -30.488 29.047 -30.020 1.00 54.20 O ANISOU15424 OE1 GLN B 378 7238 7203 6152 1398 976 1263 O ATOM 15425 NE2 GLN B 378 -28.491 28.227 -30.647 1.00 44.64 N ANISOU15425 NE2 GLN B 378 6038 5966 4956 1271 887 1214 N ATOM 15426 H GLN B 378 -29.275 24.647 -33.597 1.00 53.75 H ATOM 15427 HA GLN B 378 -29.878 25.915 -31.264 1.00 50.20 H ATOM 15428 HB2 GLN B 378 -28.756 27.174 -33.007 1.00 48.87 H ATOM 15429 HB3 GLN B 378 -30.090 27.037 -33.854 1.00 48.87 H ATOM 15430 HG2 GLN B 378 -29.998 29.126 -32.837 1.00 55.70 H ATOM 15431 HG3 GLN B 378 -31.233 28.304 -32.268 1.00 55.70 H ATOM 15432 HE21 GLN B 378 -28.006 27.901 -31.278 1.00 53.56 H ATOM 15433 HE22 GLN B 378 -28.160 28.330 -29.860 1.00 53.56 H ATOM 15434 N PRO B 379 -32.223 25.031 -31.309 1.00 40.12 N ANISOU15434 N PRO B 379 5214 5793 4238 1389 858 1262 N ATOM 15435 CA PRO B 379 -33.599 24.521 -31.415 1.00 43.97 C ANISOU15435 CA PRO B 379 5611 6415 4680 1436 863 1304 C ATOM 15436 C PRO B 379 -34.572 25.451 -32.141 1.00 46.53 C ANISOU15436 C PRO B 379 5850 6853 4977 1563 899 1367 C ATOM 15437 O PRO B 379 -34.541 26.668 -31.955 1.00 45.03 O ANISOU15437 O PRO B 379 5698 6590 4822 1616 952 1388 O ATOM 15438 CB PRO B 379 -34.012 24.338 -29.954 1.00 36.86 C ANISOU15438 CB PRO B 379 4765 5416 3823 1382 897 1302 C ATOM 15439 CG PRO B 379 -32.724 24.032 -29.262 1.00 35.78 C ANISOU15439 CG PRO B 379 4735 5128 3730 1276 874 1237 C ATOM 15440 CD PRO B 379 -31.716 24.920 -29.929 1.00 37.59 C ANISOU15440 CD PRO B 379 4995 5314 3972 1295 867 1222 C ATOM 15441 HA PRO B 379 -33.600 23.657 -31.855 1.00 52.76 H ATOM 15442 HB2 PRO B 379 -34.403 25.158 -29.614 1.00 44.23 H ATOM 15443 HB3 PRO B 379 -34.633 23.597 -29.875 1.00 44.23 H ATOM 15444 HG2 PRO B 379 -32.800 24.245 -28.319 1.00 42.93 H ATOM 15445 HG3 PRO B 379 -32.497 23.098 -29.388 1.00 42.93 H ATOM 15446 HD2 PRO B 379 -31.698 25.791 -29.503 1.00 45.10 H ATOM 15447 HD3 PRO B 379 -30.840 24.502 -29.923 1.00 45.10 H ATOM 15448 N LEU B 380 -35.422 24.852 -32.970 1.00 40.26 N ANISOU15448 N LEU B 380 4939 6244 4112 1609 868 1397 N ATOM 15449 CA LEU B 380 -36.398 25.583 -33.764 1.00 41.47 C ANISOU15449 CA LEU B 380 4991 6539 4229 1731 893 1461 C ATOM 15450 C LEU B 380 -37.812 25.202 -33.331 1.00 40.64 C ANISOU15450 C LEU B 380 4798 6545 4099 1752 907 1517 C ATOM 15451 O LEU B 380 -38.221 24.047 -33.450 1.00 35.54 O ANISOU15451 O LEU B 380 4087 6017 3401 1701 858 1514 O ATOM 15452 CB LEU B 380 -36.183 25.274 -35.244 1.00 41.48 C ANISOU15452 CB LEU B 380 4910 6698 4154 1775 837 1449 C ATOM 15453 CG LEU B 380 -34.810 25.682 -35.786 1.00 35.11 C ANISOU15453 CG LEU B 380 4167 5801 3370 1765 831 1409 C ATOM 15454 CD1 LEU B 380 -34.596 25.129 -37.197 1.00 29.76 C ANISOU15454 CD1 LEU B 380 3410 5289 2607 1805 770 1384 C ATOM 15455 CD2 LEU B 380 -34.644 27.204 -35.751 1.00 29.57 C ANISOU15455 CD2 LEU B 380 3500 5011 2725 1830 904 1449 C ATOM 15456 H LEU B 380 -35.452 24.001 -33.091 1.00 48.31 H ATOM 15457 HA LEU B 380 -36.279 26.536 -33.627 1.00 49.77 H ATOM 15458 HB2 LEU B 380 -36.280 24.318 -35.379 1.00 49.78 H ATOM 15459 HB3 LEU B 380 -36.855 25.746 -35.761 1.00 49.78 H ATOM 15460 HG LEU B 380 -34.126 25.299 -35.214 1.00 42.13 H ATOM 15461 HD11 LEU B 380 -33.720 25.402 -37.513 1.00 35.71 H ATOM 15462 HD12 LEU B 380 -34.650 24.161 -37.168 1.00 35.71 H ATOM 15463 HD13 LEU B 380 -35.284 25.482 -37.782 1.00 35.71 H ATOM 15464 HD21 LEU B 380 -33.768 27.434 -36.098 1.00 35.49 H ATOM 15465 HD22 LEU B 380 -35.334 27.609 -36.299 1.00 35.49 H ATOM 15466 HD23 LEU B 380 -34.727 27.509 -34.834 1.00 35.49 H ATOM 15467 N TRP B 381 -38.554 26.186 -32.834 1.00 58.68 N ANISOU15467 N TRP B 381 7079 8800 6417 1830 975 1573 N ATOM 15468 CA TRP B 381 -39.845 25.939 -32.201 1.00 57.16 C ANISOU15468 CA TRP B 381 6813 8688 6219 1850 1001 1636 C ATOM 15469 C TRP B 381 -40.977 25.776 -33.211 1.00 61.18 C ANISOU15469 C TRP B 381 7151 9443 6650 1929 976 1704 C ATOM 15470 O TRP B 381 -42.022 25.211 -32.890 1.00 71.35 O ANISOU15470 O TRP B 381 8343 10850 7917 1918 975 1759 O ATOM 15471 CB TRP B 381 -40.171 27.081 -31.236 1.00 53.36 C ANISOU15471 CB TRP B 381 6402 8076 5797 1917 1085 1667 C ATOM 15472 CG TRP B 381 -39.112 27.283 -30.191 1.00 50.84 C ANISOU15472 CG TRP B 381 6243 7534 5539 1839 1106 1596 C ATOM 15473 CD1 TRP B 381 -38.156 26.387 -29.812 1.00 46.40 C ANISOU15473 CD1 TRP B 381 5750 6887 4994 1710 1061 1526 C ATOM 15474 CD2 TRP B 381 -38.897 28.458 -29.399 1.00 54.57 C ANISOU15474 CD2 TRP B 381 6825 7853 6056 1886 1174 1588 C ATOM 15475 NE1 TRP B 381 -37.366 26.925 -28.829 1.00 46.28 N ANISOU15475 NE1 TRP B 381 5872 6682 5032 1671 1091 1477 N ATOM 15476 CE2 TRP B 381 -37.798 28.198 -28.558 1.00 50.74 C ANISOU15476 CE2 TRP B 381 6467 7204 5610 1775 1160 1510 C ATOM 15477 CE3 TRP B 381 -39.529 29.704 -29.316 1.00 59.45 C ANISOU15477 CE3 TRP B 381 7448 8461 6678 2017 1248 1639 C ATOM 15478 CZ2 TRP B 381 -37.311 29.136 -27.650 1.00 54.81 C ANISOU15478 CZ2 TRP B 381 7110 7557 6160 1782 1210 1477 C ATOM 15479 CZ3 TRP B 381 -39.046 30.637 -28.409 1.00 57.20 C ANISOU15479 CZ3 TRP B 381 7300 8005 6427 2029 1307 1605 C ATOM 15480 CH2 TRP B 381 -37.949 30.346 -27.589 1.00 54.84 C ANISOU15480 CH2 TRP B 381 7124 7555 6159 1908 1284 1523 C ATOM 15481 H TRP B 381 -38.328 27.016 -32.851 1.00 70.42 H ATOM 15482 HA TRP B 381 -39.789 25.120 -31.685 1.00 68.60 H ATOM 15483 HB2 TRP B 381 -40.256 27.905 -31.739 1.00 64.03 H ATOM 15484 HB3 TRP B 381 -41.005 26.882 -30.782 1.00 64.03 H ATOM 15485 HD1 TRP B 381 -38.059 25.531 -30.163 1.00 55.68 H ATOM 15486 HE1 TRP B 381 -36.703 26.531 -28.449 1.00 55.54 H ATOM 15487 HE3 TRP B 381 -40.258 29.904 -29.858 1.00 71.34 H ATOM 15488 HZ2 TRP B 381 -36.584 28.946 -27.102 1.00 65.78 H ATOM 15489 HZ3 TRP B 381 -39.457 31.468 -28.345 1.00 68.64 H ATOM 15490 HH2 TRP B 381 -37.646 30.989 -26.990 1.00 65.81 H ATOM 15491 N ASN B 382 -40.767 26.276 -34.424 1.00 54.83 N ANISOU15491 N ASN B 382 6303 8725 5806 2005 958 1704 N ATOM 15492 CA ASN B 382 -41.772 26.195 -35.479 1.00 59.34 C ANISOU15492 CA ASN B 382 6708 9544 6293 2087 930 1760 C ATOM 15493 C ASN B 382 -41.410 25.117 -36.499 1.00 55.56 C ANISOU15493 C ASN B 382 6172 9214 5724 2032 836 1700 C ATOM 15494 O ASN B 382 -40.277 25.070 -36.975 1.00 58.82 O ANISOU15494 O ASN B 382 6661 9549 6137 2007 810 1629 O ATOM 15495 CB ASN B 382 -41.912 27.552 -36.171 1.00 62.42 C ANISOU15495 CB ASN B 382 7088 9940 6689 2209 980 1798 C ATOM 15496 CG ASN B 382 -43.216 27.685 -36.935 1.00 62.98 C ANISOU15496 CG ASN B 382 7029 10220 6680 2257 964 1859 C ATOM 15497 OD1 ASN B 382 -43.629 26.770 -37.647 1.00 61.13 O ANISOU15497 OD1 ASN B 382 6675 10193 6358 2234 902 1850 O ATOM 15498 ND2 ASN B 382 -43.879 28.825 -36.779 1.00 57.17 N ANISOU15498 ND2 ASN B 382 6314 9441 5968 2324 1023 1917 N ATOM 15499 H ASN B 382 -40.042 26.671 -34.665 1.00 65.80 H ATOM 15500 HA ASN B 382 -42.629 25.965 -35.086 1.00 71.20 H ATOM 15501 HB2 ASN B 382 -41.882 28.253 -35.502 1.00 74.90 H ATOM 15502 HB3 ASN B 382 -41.182 27.662 -36.801 1.00 74.90 H ATOM 15503 HD21 ASN B 382 -44.624 28.949 -37.191 1.00 68.61 H ATOM 15504 HD22 ASN B 382 -43.564 29.440 -36.266 1.00 68.61 H ATOM 15505 N ASN B 383 -42.364 24.249 -36.825 1.00 53.38 N ANISOU15505 N ASN B 383 5762 9155 5364 2013 777 1727 N ATOM 15506 CA ASN B 383 -42.114 23.174 -37.784 1.00 50.57 C ANISOU15506 CA ASN B 383 5357 8941 4918 1966 643 1654 C ATOM 15507 C ASN B 383 -41.816 23.707 -39.180 1.00 56.50 C ANISOU15507 C ASN B 383 6076 9782 5610 2047 633 1613 C ATOM 15508 O ASN B 383 -41.128 23.052 -39.964 1.00 57.63 O ANISOU15508 O ASN B 383 6236 9957 5705 2019 540 1519 O ATOM 15509 CB ASN B 383 -43.289 22.190 -37.832 1.00 49.41 C ANISOU15509 CB ASN B 383 5045 8931 4798 1881 541 1620 C ATOM 15510 CG ASN B 383 -43.196 21.110 -36.762 1.00 54.92 C ANISOU15510 CG ASN B 383 5775 9480 5612 1708 508 1544 C ATOM 15511 OD1 ASN B 383 -42.231 21.051 -35.999 1.00 60.55 O ANISOU15511 OD1 ASN B 383 6636 10001 6370 1658 556 1517 O ATOM 15512 ND2 ASN B 383 -44.210 20.255 -36.695 1.00 56.98 N ANISOU15512 ND2 ASN B 383 5893 9832 5924 1614 424 1518 N ATOM 15513 H ASN B 383 -43.163 24.259 -36.507 1.00 64.05 H ATOM 15514 HA ASN B 383 -41.333 22.679 -37.491 1.00 60.69 H ATOM 15515 HB2 ASN B 383 -44.116 22.679 -37.693 1.00 59.29 H ATOM 15516 HB3 ASN B 383 -43.302 21.755 -38.698 1.00 59.29 H ATOM 15517 HD21 ASN B 383 -44.205 19.627 -36.108 1.00 68.37 H ATOM 15518 HD22 ASN B 383 -44.872 20.330 -37.239 1.00 68.37 H ATOM 15519 N ARG B 384 -42.326 24.898 -39.482 1.00 61.80 N ANISOU15519 N ARG B 384 6705 10492 6285 2153 735 1682 N ATOM 15520 CA ARG B 384 -42.033 25.552 -40.752 1.00 63.32 C ANISOU15520 CA ARG B 384 6877 10761 6422 2233 756 1662 C ATOM 15521 C ARG B 384 -40.527 25.732 -40.894 1.00 62.32 C ANISOU15521 C ARG B 384 6871 10458 6350 2220 758 1598 C ATOM 15522 O ARG B 384 -39.968 25.562 -41.979 1.00 68.61 O ANISOU15522 O ARG B 384 7660 11325 7084 2238 719 1541 O ATOM 15523 CB ARG B 384 -42.728 26.915 -40.836 1.00 63.90 C ANISOU15523 CB ARG B 384 6961 10793 6524 2295 828 1743 C ATOM 15524 CG ARG B 384 -44.249 26.852 -40.956 1.00 69.11 C ANISOU15524 CG ARG B 384 7499 11651 7108 2316 827 1816 C ATOM 15525 CD ARG B 384 -44.843 28.217 -41.274 1.00 73.75 C ANISOU15525 CD ARG B 384 8104 12215 7705 2390 897 1887 C ATOM 15526 NE ARG B 384 -44.396 28.714 -42.572 1.00 80.78 N ANISOU15526 NE ARG B 384 8995 13156 8540 2438 893 1861 N ATOM 15527 CZ ARG B 384 -44.641 29.938 -43.031 1.00 76.10 C ANISOU15527 CZ ARG B 384 8426 12534 7955 2505 953 1913 C ATOM 15528 NH1 ARG B 384 -45.325 30.806 -42.296 1.00 69.50 N ANISOU15528 NH1 ARG B 384 7617 11615 7174 2536 1022 1986 N ATOM 15529 NH2 ARG B 384 -44.189 30.297 -44.227 1.00 63.69 N ANISOU15529 NH2 ARG B 384 6848 11018 6333 2546 947 1894 N ATOM 15530 H ARG B 384 -42.846 25.349 -38.967 1.00 74.16 H ATOM 15531 HA ARG B 384 -42.349 24.999 -41.483 1.00 75.99 H ATOM 15532 HB2 ARG B 384 -42.518 27.419 -40.034 1.00 76.68 H ATOM 15533 HB3 ARG B 384 -42.392 27.386 -41.614 1.00 76.68 H ATOM 15534 HG2 ARG B 384 -44.488 26.242 -41.672 1.00 82.93 H ATOM 15535 HG3 ARG B 384 -44.623 26.546 -40.115 1.00 82.93 H ATOM 15536 HD2 ARG B 384 -45.810 28.147 -41.292 1.00 88.51 H ATOM 15537 HD3 ARG B 384 -44.565 28.851 -40.594 1.00 88.51 H ATOM 15538 HE ARG B 384 -43.945 28.180 -43.072 1.00 96.93 H ATOM 15539 HH11 ARG B 384 -45.618 30.576 -41.520 1.00 83.40 H ATOM 15540 HH12 ARG B 384 -45.480 31.597 -42.596 1.00 83.40 H ATOM 15541 HH21 ARG B 384 -43.744 29.737 -44.704 1.00 76.43 H ATOM 15542 HH22 ARG B 384 -44.345 31.088 -44.525 1.00 76.43 H ATOM 15543 N LEU B 385 -39.874 26.064 -39.786 1.00 50.36 N ANISOU15543 N LEU B 385 5473 8714 4949 2181 800 1607 N ATOM 15544 CA LEU B 385 -38.432 26.259 -39.784 1.00 47.18 C ANISOU15544 CA LEU B 385 5190 8134 4601 2145 803 1555 C ATOM 15545 C LEU B 385 -37.679 24.951 -39.565 1.00 52.13 C ANISOU15545 C LEU B 385 5879 8720 5207 2032 718 1469 C ATOM 15546 O LEU B 385 -36.607 24.750 -40.137 1.00 53.79 O ANISOU15546 O LEU B 385 6136 8893 5408 2017 689 1413 O ATOM 15547 CB LEU B 385 -38.021 27.278 -38.718 1.00 48.48 C ANISOU15547 CB LEU B 385 5466 8069 4883 2140 884 1589 C ATOM 15548 CG LEU B 385 -38.494 28.724 -38.905 1.00 52.92 C ANISOU15548 CG LEU B 385 6030 8605 5474 2221 957 1655 C ATOM 15549 CD1 LEU B 385 -37.606 29.660 -38.091 1.00 47.63 C ANISOU15549 CD1 LEU B 385 5490 7706 4903 2206 1022 1654 C ATOM 15550 CD2 LEU B 385 -38.514 29.148 -40.373 1.00 60.74 C ANISOU15550 CD2 LEU B 385 6960 9723 6394 2273 943 1662 C ATOM 15551 H LEU B 385 -40.245 26.182 -39.019 1.00 60.44 H ATOM 15552 HA LEU B 385 -38.165 26.612 -40.648 1.00 56.61 H ATOM 15553 HB2 LEU B 385 -38.366 26.975 -37.864 1.00 58.17 H ATOM 15554 HB3 LEU B 385 -37.052 27.299 -38.680 1.00 58.17 H ATOM 15555 HG LEU B 385 -39.398 28.802 -38.563 1.00 63.51 H ATOM 15556 HD11 LEU B 385 -37.913 30.572 -38.215 1.00 57.16 H ATOM 15557 HD12 LEU B 385 -37.666 29.415 -37.154 1.00 57.16 H ATOM 15558 HD13 LEU B 385 -36.691 29.574 -38.399 1.00 57.16 H ATOM 15559 HD21 LEU B 385 -38.819 30.067 -40.431 1.00 72.88 H ATOM 15560 HD22 LEU B 385 -37.617 29.074 -40.735 1.00 72.88 H ATOM 15561 HD23 LEU B 385 -39.117 28.567 -40.861 1.00 72.88 H ATOM 15562 N LEU B 386 -38.227 24.062 -38.741 1.00 56.95 N ANISOU15562 N LEU B 386 6487 9342 5811 1957 681 1466 N ATOM 15563 CA LEU B 386 -37.559 22.795 -38.470 1.00 54.38 C ANISOU15563 CA LEU B 386 6222 8976 5464 1852 601 1390 C ATOM 15564 C LEU B 386 -37.427 21.974 -39.746 1.00 57.80 C ANISOU15564 C LEU B 386 6594 9578 5790 1871 489 1312 C ATOM 15565 O LEU B 386 -36.433 21.268 -39.932 1.00 61.76 O ANISOU15565 O LEU B 386 7165 10023 6277 1825 434 1233 O ATOM 15566 CB LEU B 386 -38.307 21.985 -37.409 1.00 55.47 C ANISOU15566 CB LEU B 386 6349 9121 5608 1772 583 1415 C ATOM 15567 CG LEU B 386 -37.757 20.572 -37.168 1.00 56.07 C ANISOU15567 CG LEU B 386 6462 9129 5714 1636 485 1294 C ATOM 15568 CD1 LEU B 386 -36.324 20.617 -36.629 1.00 49.33 C ANISOU15568 CD1 LEU B 386 5767 8088 4887 1600 528 1279 C ATOM 15569 CD2 LEU B 386 -38.670 19.771 -36.247 1.00 58.28 C ANISOU15569 CD2 LEU B 386 6680 9373 6090 1514 459 1267 C ATOM 15570 H LEU B 386 -38.976 24.167 -38.332 1.00 68.34 H ATOM 15571 HA LEU B 386 -36.667 22.974 -38.135 1.00 65.26 H ATOM 15572 HB2 LEU B 386 -38.263 22.464 -36.567 1.00 66.57 H ATOM 15573 HB3 LEU B 386 -39.233 21.895 -37.685 1.00 66.57 H ATOM 15574 HG LEU B 386 -37.729 20.108 -38.019 1.00 67.29 H ATOM 15575 HD11 LEU B 386 -36.011 19.710 -36.489 1.00 59.19 H ATOM 15576 HD12 LEU B 386 -35.758 21.067 -37.275 1.00 59.19 H ATOM 15577 HD13 LEU B 386 -36.318 21.103 -35.789 1.00 59.19 H ATOM 15578 HD21 LEU B 386 -38.291 18.887 -36.118 1.00 69.93 H ATOM 15579 HD22 LEU B 386 -38.738 20.229 -35.394 1.00 69.93 H ATOM 15580 HD23 LEU B 386 -39.546 19.699 -36.656 1.00 69.93 H ATOM 15581 N LYS B 387 -38.419 22.059 -40.629 1.00 66.97 N ANISOU15581 N LYS B 387 7626 10942 6877 1939 450 1326 N ATOM 15582 CA LYS B 387 -38.368 21.251 -41.840 1.00 68.08 C ANISOU15582 CA LYS B 387 7707 11236 6923 1951 325 1226 C ATOM 15583 C LYS B 387 -37.184 21.670 -42.705 1.00 66.38 C ANISOU15583 C LYS B 387 7555 10971 6695 2003 363 1185 C ATOM 15584 O LYS B 387 -36.511 20.817 -43.266 1.00 66.86 O ANISOU15584 O LYS B 387 7646 11049 6708 1984 276 1085 O ATOM 15585 CB LYS B 387 -39.673 21.288 -42.648 1.00 66.86 C ANISOU15585 CB LYS B 387 7399 11302 6703 2001 270 1236 C ATOM 15586 CG LYS B 387 -39.778 20.086 -43.585 1.00 73.74 C ANISOU15586 CG LYS B 387 8209 12308 7502 1970 95 1098 C ATOM 15587 CD LYS B 387 -41.034 20.079 -44.432 1.00 83.76 C ANISOU15587 CD LYS B 387 9325 13785 8714 2000 29 1090 C ATOM 15588 CE LYS B 387 -41.012 18.900 -45.402 1.00 88.29 C ANISOU15588 CE LYS B 387 9860 14464 9224 1964 -151 927 C ATOM 15589 NZ LYS B 387 -39.943 19.024 -46.436 1.00 80.30 N ANISOU15589 NZ LYS B 387 8934 13440 8138 2037 -130 857 N ATOM 15590 H LYS B 387 -39.112 22.562 -40.554 1.00 80.36 H ATOM 15591 HA LYS B 387 -38.220 20.328 -41.580 1.00 81.69 H ATOM 15592 HB2 LYS B 387 -40.428 21.268 -42.039 1.00 80.23 H ATOM 15593 HB3 LYS B 387 -39.695 22.096 -43.185 1.00 80.23 H ATOM 15594 HG2 LYS B 387 -39.016 20.090 -44.185 1.00 88.49 H ATOM 15595 HG3 LYS B 387 -39.775 19.274 -43.054 1.00 88.49 H ATOM 15596 HD2 LYS B 387 -41.811 19.991 -43.858 1.00100.51 H ATOM 15597 HD3 LYS B 387 -41.082 20.900 -44.946 1.00100.51 H ATOM 15598 HE2 LYS B 387 -40.854 18.083 -44.903 1.00105.95 H ATOM 15599 HE3 LYS B 387 -41.867 18.850 -45.858 1.00105.95 H ATOM 15600 HZ1 LYS B 387 -39.963 18.320 -46.980 1.00 96.36 H ATOM 15601 HZ2 LYS B 387 -40.068 19.763 -46.915 1.00 96.36 H ATOM 15602 HZ3 LYS B 387 -39.145 19.064 -46.045 1.00 96.36 H ATOM 15603 N LEU B 388 -36.923 22.975 -42.781 1.00 50.46 N ANISOU15603 N LEU B 388 5553 8888 4731 2070 487 1263 N ATOM 15604 CA LEU B 388 -35.804 23.511 -43.560 1.00 51.76 C ANISOU15604 CA LEU B 388 5756 9005 4905 2122 529 1250 C ATOM 15605 C LEU B 388 -34.490 22.801 -43.228 1.00 57.96 C ANISOU15605 C LEU B 388 6649 9649 5725 2048 491 1183 C ATOM 15606 O LEU B 388 -33.596 22.695 -44.070 1.00 64.76 O ANISOU15606 O LEU B 388 7523 10525 6558 2082 479 1141 O ATOM 15607 CB LEU B 388 -35.637 25.012 -43.296 1.00 52.13 C ANISOU15607 CB LEU B 388 5818 8945 5045 2176 653 1348 C ATOM 15608 CG LEU B 388 -36.808 25.939 -43.635 1.00 54.07 C ANISOU15608 CG LEU B 388 5965 9312 5266 2268 717 1428 C ATOM 15609 CD1 LEU B 388 -36.478 27.380 -43.249 1.00 51.98 C ANISOU15609 CD1 LEU B 388 5774 8869 5108 2276 801 1502 C ATOM 15610 CD2 LEU B 388 -37.155 25.846 -45.111 1.00 64.30 C ANISOU15610 CD2 LEU B 388 7172 10818 6441 2340 687 1403 C ATOM 15611 H LEU B 388 -37.387 23.580 -42.385 1.00 60.55 H ATOM 15612 HA LEU B 388 -35.985 23.388 -44.505 1.00 62.11 H ATOM 15613 HB2 LEU B 388 -35.451 25.129 -42.351 1.00 62.56 H ATOM 15614 HB3 LEU B 388 -34.875 25.322 -43.809 1.00 62.56 H ATOM 15615 HG LEU B 388 -37.586 25.663 -43.127 1.00 64.88 H ATOM 15616 HD11 LEU B 388 -37.233 27.947 -43.473 1.00 62.38 H ATOM 15617 HD12 LEU B 388 -36.306 27.419 -42.295 1.00 62.38 H ATOM 15618 HD13 LEU B 388 -35.692 27.666 -43.740 1.00 62.38 H ATOM 15619 HD21 LEU B 388 -37.897 26.441 -45.299 1.00 77.16 H ATOM 15620 HD22 LEU B 388 -36.381 26.107 -45.634 1.00 77.16 H ATOM 15621 HD23 LEU B 388 -37.403 24.931 -45.320 1.00 77.16 H ATOM 15622 N PHE B 389 -34.385 22.321 -41.993 1.00 53.97 N ANISOU15622 N PHE B 389 6217 9012 5277 1952 482 1180 N ATOM 15623 CA PHE B 389 -33.206 21.603 -41.528 1.00 48.56 C ANISOU15623 CA PHE B 389 5637 8190 4625 1873 453 1122 C ATOM 15624 C PHE B 389 -33.323 20.114 -41.834 1.00 53.92 C ANISOU15624 C PHE B 389 6310 8967 5211 1838 326 1019 C ATOM 15625 O PHE B 389 -32.420 19.520 -42.423 1.00 60.62 O ANISOU15625 O PHE B 389 7196 9814 6024 1844 280 943 O ATOM 15626 CB PHE B 389 -33.037 21.801 -40.021 1.00 48.20 C ANISOU15626 CB PHE B 389 5679 7951 4682 1783 507 1163 C ATOM 15627 CG PHE B 389 -31.850 21.085 -39.441 1.00 41.83 C ANISOU15627 CG PHE B 389 4980 7001 3913 1694 486 1110 C ATOM 15628 CD1 PHE B 389 -31.962 19.784 -38.975 1.00 42.54 C ANISOU15628 CD1 PHE B 389 5101 7100 3961 1624 414 1053 C ATOM 15629 CD2 PHE B 389 -30.619 21.717 -39.359 1.00 40.47 C ANISOU15629 CD2 PHE B 389 4872 6690 3816 1680 534 1122 C ATOM 15630 CE1 PHE B 389 -30.867 19.125 -38.437 1.00 40.65 C ANISOU15630 CE1 PHE B 389 4960 6730 3754 1550 402 1009 C ATOM 15631 CE2 PHE B 389 -29.521 21.063 -38.825 1.00 44.90 C ANISOU15631 CE2 PHE B 389 5521 7130 4410 1599 516 1079 C ATOM 15632 CZ PHE B 389 -29.646 19.765 -38.365 1.00 41.99 C ANISOU15632 CZ PHE B 389 5188 6768 4000 1538 455 1023 C ATOM 15633 H PHE B 389 -34.997 22.401 -41.394 1.00 64.77 H ATOM 15634 HA PHE B 389 -32.418 21.950 -41.976 1.00 58.28 H ATOM 15635 HB2 PHE B 389 -32.930 22.748 -39.840 1.00 57.84 H ATOM 15636 HB3 PHE B 389 -33.831 21.469 -39.572 1.00 57.84 H ATOM 15637 HD1 PHE B 389 -32.783 19.348 -39.022 1.00 51.04 H ATOM 15638 HD2 PHE B 389 -30.529 22.589 -39.668 1.00 48.57 H ATOM 15639 HE1 PHE B 389 -30.954 18.252 -38.129 1.00 48.77 H ATOM 15640 HE2 PHE B 389 -28.700 21.496 -38.776 1.00 53.88 H ATOM 15641 HZ PHE B 389 -28.910 19.325 -38.005 1.00 50.39 H ATOM 15642 N THR B 390 -34.431 19.513 -41.410 1.00 58.17 N ANISOU15642 N THR B 390 6798 9589 5717 1801 262 1014 N ATOM 15643 CA THR B 390 -34.651 18.081 -41.598 1.00 60.90 C ANISOU15643 CA THR B 390 7124 9999 6015 1742 116 892 C ATOM 15644 C THR B 390 -34.794 17.701 -43.073 1.00 62.21 C ANISOU15644 C THR B 390 7221 10354 6064 1825 12 806 C ATOM 15645 O THR B 390 -34.661 16.535 -43.441 1.00 64.85 O ANISOU15645 O THR B 390 7562 10699 6380 1775 -108 663 O ATOM 15646 CB THR B 390 -35.892 17.598 -40.824 1.00 61.35 C ANISOU15646 CB THR B 390 7105 10035 6170 1626 82 870 C ATOM 15647 OG1 THR B 390 -37.064 18.253 -41.323 1.00 67.57 O ANISOU15647 OG1 THR B 390 7767 10998 6909 1704 85 942 O ATOM 15648 CG2 THR B 390 -35.739 17.889 -39.334 1.00 50.28 C ANISOU15648 CG2 THR B 390 5778 8443 4884 1544 186 941 C ATOM 15649 H THR B 390 -35.076 19.916 -41.008 1.00 69.81 H ATOM 15650 HA THR B 390 -33.883 17.603 -41.246 1.00 73.08 H ATOM 15651 HB THR B 390 -35.988 16.639 -40.938 1.00 73.62 H ATOM 15652 HG1 THR B 390 -37.741 17.991 -40.902 1.00 81.08 H ATOM 15653 HG21 THR B 390 -36.524 17.582 -38.854 1.00 60.34 H ATOM 15654 HG22 THR B 390 -34.957 17.431 -38.985 1.00 60.34 H ATOM 15655 HG23 THR B 390 -35.635 18.843 -39.191 1.00 60.34 H ATOM 15656 N ARG B 391 -35.075 18.700 -43.902 1.00 68.78 N ANISOU15656 N ARG B 391 7988 11271 6874 1917 82 859 N ATOM 15657 CA ARG B 391 -35.156 18.544 -45.348 1.00 64.37 C ANISOU15657 CA ARG B 391 7370 10865 6223 1996 23 782 C ATOM 15658 C ARG B 391 -33.838 18.013 -45.922 1.00 68.37 C ANISOU15658 C ARG B 391 7961 11315 6702 2017 2 695 C ATOM 15659 O ARG B 391 -33.822 17.296 -46.926 1.00 70.90 O ANISOU15659 O ARG B 391 8261 11739 6939 2054 -96 580 O ATOM 15660 CB ARG B 391 -35.459 19.913 -45.947 1.00 61.40 C ANISOU15660 CB ARG B 391 6932 10553 5845 2092 143 885 C ATOM 15661 CG ARG B 391 -35.919 19.940 -47.377 1.00 75.40 C ANISOU15661 CG ARG B 391 8619 12515 7516 2180 99 836 C ATOM 15662 CD ARG B 391 -36.309 21.374 -47.741 1.00 74.81 C ANISOU15662 CD ARG B 391 8484 12491 7448 2268 233 960 C ATOM 15663 NE ARG B 391 -35.251 22.323 -47.396 1.00 71.01 N ANISOU15663 NE ARG B 391 8070 11854 7055 2290 363 1043 N ATOM 15664 CZ ARG B 391 -35.317 23.639 -47.573 1.00 69.96 C ANISOU15664 CZ ARG B 391 7906 11717 6960 2360 484 1149 C ATOM 15665 NH1 ARG B 391 -36.396 24.204 -48.103 1.00 64.33 N ANISOU15665 NH1 ARG B 391 7100 11153 6189 2425 512 1197 N ATOM 15666 NH2 ARG B 391 -34.289 24.396 -47.215 1.00 68.07 N ANISOU15666 NH2 ARG B 391 7727 11319 6817 2361 570 1207 N ATOM 15667 H ARG B 391 -35.229 19.504 -43.640 1.00 82.54 H ATOM 15668 HA ARG B 391 -35.872 17.931 -45.578 1.00 77.25 H ATOM 15669 HB2 ARG B 391 -36.155 20.328 -45.415 1.00 73.68 H ATOM 15670 HB3 ARG B 391 -34.653 20.450 -45.895 1.00 73.68 H ATOM 15671 HG2 ARG B 391 -35.198 19.654 -47.960 1.00 90.49 H ATOM 15672 HG3 ARG B 391 -36.695 19.368 -47.484 1.00 90.49 H ATOM 15673 HD2 ARG B 391 -36.468 21.430 -48.696 1.00 89.77 H ATOM 15674 HD3 ARG B 391 -37.110 21.622 -47.252 1.00 89.77 H ATOM 15675 HE ARG B 391 -34.530 22.004 -47.053 1.00 85.21 H ATOM 15676 HH11 ARG B 391 -37.066 23.718 -48.335 1.00 77.19 H ATOM 15677 HH12 ARG B 391 -36.426 25.057 -48.212 1.00 77.19 H ATOM 15678 HH21 ARG B 391 -33.587 24.034 -46.873 1.00 81.68 H ATOM 15679 HH22 ARG B 391 -34.322 25.248 -47.328 1.00 81.68 H ATOM 15680 N CYS B 392 -32.738 18.364 -45.258 1.00 65.67 N ANISOU15680 N CYS B 392 7711 10803 6438 1991 94 748 N ATOM 15681 CA CYS B 392 -31.386 18.127 -45.761 1.00 62.90 C ANISOU15681 CA CYS B 392 7427 10392 6082 2022 108 705 C ATOM 15682 C CYS B 392 -30.703 16.895 -45.141 1.00 68.46 C ANISOU15682 C CYS B 392 8228 10994 6789 1944 32 615 C ATOM 15683 O CYS B 392 -29.473 16.811 -45.130 1.00 62.20 O ANISOU15683 O CYS B 392 7503 10102 6026 1947 72 613 O ATOM 15684 CB CYS B 392 -30.526 19.369 -45.474 1.00 57.33 C ANISOU15684 CB CYS B 392 6746 9563 5474 2038 249 824 C ATOM 15685 SG CYS B 392 -31.197 20.939 -46.091 1.00 70.82 S ANISOU15685 SG CYS B 392 8355 11360 7195 2132 352 938 S ATOM 15686 H CYS B 392 -32.751 18.753 -44.491 1.00 78.81 H ATOM 15687 HA CYS B 392 -31.422 18.000 -46.722 1.00 75.49 H ATOM 15688 HB2 CYS B 392 -30.421 19.454 -44.514 1.00 68.80 H ATOM 15689 HB3 CYS B 392 -29.657 19.242 -45.885 1.00 68.80 H ATOM 15690 HG CYS B 392 -30.440 21.826 -45.806 1.00 84.99 H ATOM 15691 N LEU B 393 -31.495 15.936 -44.657 1.00 77.01 N ANISOU15691 N LEU B 393 9307 12107 7844 1875 -81 541 N ATOM 15692 CA LEU B 393 -30.980 14.853 -43.804 1.00 78.14 C ANISOU15692 CA LEU B 393 9546 12139 8005 1789 -142 473 C ATOM 15693 C LEU B 393 -30.891 13.463 -44.453 1.00 86.73 C ANISOU15693 C LEU B 393 10653 13249 9052 1769 -285 283 C ATOM 15694 O LEU B 393 -31.165 12.454 -43.801 1.00 90.59 O ANISOU15694 O LEU B 393 11165 13613 9643 1631 -350 182 O ATOM 15695 CB LEU B 393 -31.830 14.737 -42.532 1.00 80.19 C ANISOU15695 CB LEU B 393 9786 12272 8412 1639 -124 491 C ATOM 15696 CG LEU B 393 -31.779 15.872 -41.516 1.00 75.00 C ANISOU15696 CG LEU B 393 9151 11521 7824 1626 16 651 C ATOM 15697 CD1 LEU B 393 -32.688 15.497 -40.354 1.00 76.75 C ANISOU15697 CD1 LEU B 393 9348 11637 8176 1484 14 642 C ATOM 15698 CD2 LEU B 393 -30.358 16.122 -41.041 1.00 65.22 C ANISOU15698 CD2 LEU B 393 8028 10148 6603 1630 96 704 C ATOM 15699 H LEU B 393 -32.340 15.887 -44.807 1.00 92.41 H ATOM 15700 HA LEU B 393 -30.083 15.093 -43.526 1.00 93.77 H ATOM 15701 HB2 LEU B 393 -32.757 14.646 -42.803 1.00 96.23 H ATOM 15702 HB3 LEU B 393 -31.557 13.931 -42.066 1.00 96.23 H ATOM 15703 HG LEU B 393 -32.116 16.686 -41.921 1.00 90.00 H ATOM 15704 HD11 LEU B 393 -32.668 16.209 -39.696 1.00 92.10 H ATOM 15705 HD12 LEU B 393 -33.591 15.378 -40.687 1.00 92.10 H ATOM 15706 HD13 LEU B 393 -32.369 14.670 -39.959 1.00 92.10 H ATOM 15707 HD21 LEU B 393 -30.364 16.848 -40.398 1.00 78.26 H ATOM 15708 HD22 LEU B 393 -30.017 15.315 -40.626 1.00 78.26 H ATOM 15709 HD23 LEU B 393 -29.808 16.360 -41.804 1.00 78.26 H ATOM 15710 N THR B 394 -30.523 13.394 -45.727 1.00107.36 N ANISOU15710 N THR B 394 13256 15978 11559 1884 -318 226 N ATOM 15711 CA THR B 394 -30.084 12.119 -46.307 1.00113.23 C ANISOU15711 CA THR B 394 14057 16725 12239 1896 -439 53 C ATOM 15712 C THR B 394 -29.227 12.373 -47.558 1.00113.43 C ANISOU15712 C THR B 394 14086 16801 12210 2023 -389 42 C ATOM 15713 O THR B 394 -29.674 13.040 -48.492 1.00114.27 O ANISOU15713 O THR B 394 14109 17035 12275 2104 -364 73 O ATOM 15714 CB THR B 394 -31.264 11.152 -46.627 1.00113.30 C ANISOU15714 CB THR B 394 14012 16805 12233 1830 -611 -104 C ATOM 15715 OG1 THR B 394 -32.250 11.208 -45.588 1.00113.79 O ANISOU15715 OG1 THR B 394 14016 16777 12443 1678 -600 -62 O ATOM 15716 CG2 THR B 394 -30.755 9.721 -46.726 1.00108.35 C ANISOU15716 CG2 THR B 394 13479 16071 11618 1780 -719 -288 C ATOM 15717 H THR B 394 -30.515 14.057 -46.273 1.00128.84 H ATOM 15718 HA THR B 394 -29.518 11.673 -45.658 1.00135.87 H ATOM 15719 HB THR B 394 -31.667 11.398 -47.474 1.00135.96 H ATOM 15720 HG1 THR B 394 -32.552 11.989 -45.520 1.00136.55 H ATOM 15721 HG21 THR B 394 -30.092 9.653 -47.432 1.00130.02 H ATOM 15722 HG22 THR B 394 -30.349 9.455 -45.887 1.00130.02 H ATOM 15723 HG23 THR B 394 -31.490 9.121 -46.926 1.00130.02 H ATOM 15724 N PRO B 395 -27.992 11.829 -47.582 1.00101.52 N ANISOU15724 N PRO B 395 12669 15200 10703 2047 -371 4 N ATOM 15725 CA PRO B 395 -26.982 12.228 -48.573 1.00100.75 C ANISOU15725 CA PRO B 395 12565 15137 10578 2169 -292 39 C ATOM 15726 C PRO B 395 -27.290 11.734 -49.983 1.00103.40 C ANISOU15726 C PRO B 395 12869 15615 10805 2274 -380 -84 C ATOM 15727 O PRO B 395 -26.413 11.811 -50.846 1.00104.18 O ANISOU15727 O PRO B 395 12970 15749 10866 2386 -335 -78 O ATOM 15728 CB PRO B 395 -25.712 11.554 -48.053 1.00 94.85 C ANISOU15728 CB PRO B 395 11923 14253 9864 2151 -274 19 C ATOM 15729 CG PRO B 395 -26.214 10.306 -47.422 1.00 95.35 C ANISOU15729 CG PRO B 395 12057 14259 9912 2060 -406 -124 C ATOM 15730 CD PRO B 395 -27.552 10.655 -46.805 1.00 98.84 C ANISOU15730 CD PRO B 395 12437 14739 10380 1971 -443 -96 C TER 15731 PRO B 395 HETATM15732 O1 MES A1101 -27.448 -20.747 9.177 1.00 44.45 O HETATM15733 C2 MES A1101 -28.726 -21.090 8.638 1.00 47.88 C HETATM15734 C3 MES A1101 -28.639 -22.227 7.618 1.00 45.96 C HETATM15735 N4 MES A1101 -28.060 -23.403 8.259 1.00 45.16 N HETATM15736 C5 MES A1101 -27.306 -23.143 9.475 1.00 50.86 C HETATM15737 C6 MES A1101 -26.546 -21.850 9.199 1.00 40.66 C HETATM15738 C7 MES A1101 -28.910 -24.589 8.291 1.00 48.86 C HETATM15739 C8 MES A1101 -28.644 -25.374 7.009 1.00 43.71 C HETATM15740 S MES A1101 -29.999 -26.267 6.632 1.00 97.13 S HETATM15741 O1S MES A1101 -29.676 -27.281 5.602 1.00 74.33 O HETATM15742 O2S MES A1101 -31.045 -25.361 6.110 1.00 83.85 O HETATM15743 O3S MES A1101 -30.490 -26.958 7.846 1.00 88.17 O HETATM15744 H21 MES A1101 -29.379 -21.397 9.458 1.00 57.46 H HETATM15745 H22 MES A1101 -29.170 -20.211 8.166 1.00 57.46 H HETATM15746 H31 MES A1101 -28.036 -21.929 6.758 1.00 55.15 H HETATM15747 H32 MES A1101 -29.645 -22.465 7.265 1.00 55.15 H HETATM15748 HN4 MES A1101 -27.337 -23.672 7.609 1.00 54.19 H HETATM15749 H51 MES A1101 -27.978 -23.022 10.327 1.00 61.03 H HETATM15750 H52 MES A1101 -26.612 -23.961 9.680 1.00 61.03 H HETATM15751 H61 MES A1101 -25.787 -21.699 9.969 1.00 48.79 H HETATM15752 H62 MES A1101 -26.030 -21.928 8.239 1.00 48.79 H HETATM15753 H71 MES A1101 -28.672 -25.200 9.164 1.00 58.63 H HETATM15754 H72 MES A1101 -29.961 -24.298 8.344 1.00 58.63 H HETATM15755 H81 MES A1101 -28.413 -24.686 6.194 1.00 52.45 H HETATM15756 H82 MES A1101 -27.789 -26.038 7.151 1.00 52.45 H HETATM15757 O HOH A1201 -39.555 45.004 -18.554 1.00 39.55 O HETATM15758 O HOH A1202 -36.297 -12.002 -11.755 1.00 33.72 O HETATM15759 O HOH A1203 -59.666 -29.884 1.453 1.00 19.43 O HETATM15760 O HOH A1204 -47.754 -18.859 -0.029 1.00 14.28 O HETATM15761 O HOH A1205 -29.010 -34.170 -21.430 1.00 23.56 O HETATM15762 O HOH A1206 -39.676 46.143 -24.567 1.00 28.97 O HETATM15763 O HOH A1207 -42.262 -26.017 -7.402 1.00 33.85 O HETATM15764 O HOH A1208 -27.711 13.397 -25.935 1.00 23.70 O HETATM15765 O HOH A1209 -45.962 -2.067 -10.437 1.00 35.52 O HETATM15766 O HOH A1210 -17.637 14.508 -44.886 1.00 56.53 O HETATM15767 O HOH A1211 -47.381 13.102 -20.451 1.00 39.82 O HETATM15768 O HOH B 501 -18.974 -10.252 2.405 1.00 20.65 O HETATM15769 O HOH B 502 -19.444 -18.503 7.141 1.00 31.33 O HETATM15770 O HOH B 503 -27.270 -18.111 -3.197 1.00 14.23 O CONECT 1 2 CONECT 2 1 3 5 9 CONECT 3 2 4 17 CONECT 4 3 CONECT 5 2 6 10 11 CONECT 6 5 7 12 13 CONECT 7 6 8 CONECT 8 7 14 15 16 CONECT 9 2 CONECT 10 5 CONECT 11 5 CONECT 12 6 CONECT 13 6 CONECT 14 8 CONECT 15 8 CONECT 16 8 CONECT 17 3 CONECT 105 124 CONECT 124 105 125 CONECT 125 124 126 128 132 CONECT 126 125 127 140 CONECT 127 126 CONECT 128 125 129 133 134 CONECT 129 128 130 135 136 CONECT 130 129 131 CONECT 131 130 137 138 139 CONECT 132 125 CONECT 133 128 CONECT 134 128 CONECT 135 129 CONECT 136 129 CONECT 137 131 CONECT 138 131 CONECT 139 131 CONECT 140 126 CONECT 152 159 CONECT 159 152 160 167 CONECT 160 159 161 163 168 CONECT 161 160 162 176 CONECT 162 161 CONECT 163 160 164 169 170 CONECT 164 163 165 171 172 CONECT 165 164 166 CONECT 166 165 173 174 175 CONECT 167 159 CONECT 168 160 CONECT 169 163 CONECT 170 163 CONECT 171 164 CONECT 172 164 CONECT 173 166 CONECT 174 166 CONECT 175 166 CONECT 176 161 CONECT 772 785 CONECT 785 772 786 793 CONECT 786 785 787 789 794 CONECT 787 786 788 802 CONECT 788 787 CONECT 789 786 790 795 796 CONECT 790 789 791 797 798 CONECT 791 790 792 CONECT 792 791 799 800 801 CONECT 793 785 CONECT 794 786 CONECT 795 789 CONECT 796 789 CONECT 797 790 CONECT 798 790 CONECT 799 792 CONECT 800 792 CONECT 801 792 CONECT 802 787 CONECT 848 864 CONECT 864 848 865 872 CONECT 865 864 866 868 873 CONECT 866 865 867 881 CONECT 867 866 CONECT 868 865 869 874 875 CONECT 869 868 870 876 877 CONECT 870 869 871 CONECT 871 870 878 879 880 CONECT 872 864 CONECT 873 865 CONECT 874 868 CONECT 875 868 CONECT 876 869 CONECT 877 869 CONECT 878 871 CONECT 879 871 CONECT 880 871 CONECT 881 866 CONECT 1002 1022 CONECT 1022 1002 1023 1030 CONECT 1023 1022 1024 1026 1031 CONECT 1024 1023 1025 1039 CONECT 1025 1024 CONECT 1026 1023 1027 1032 1033 CONECT 1027 1026 1028 1034 1035 CONECT 1028 1027 1029 CONECT 1029 1028 1036 1037 1038 CONECT 1030 1022 CONECT 1031 1023 CONECT 1032 1026 CONECT 1033 1026 CONECT 1034 1027 CONECT 1035 1027 CONECT 1036 1029 CONECT 1037 1029 CONECT 1038 1029 CONECT 1039 1024 CONECT 1228 1240 CONECT 1240 1228 1241 1248 CONECT 1241 1240 1242 1244 1249 CONECT 1242 1241 1243 1257 CONECT 1243 1242 CONECT 1244 1241 1245 1250 1251 CONECT 1245 1244 1246 1252 1253 CONECT 1246 1245 1247 CONECT 1247 1246 1254 1255 1256 CONECT 1248 1240 CONECT 1249 1241 CONECT 1250 1244 CONECT 1251 1244 CONECT 1252 1245 CONECT 1253 1245 CONECT 1254 1247 CONECT 1255 1247 CONECT 1256 1247 CONECT 1257 1242 CONECT 1769 1788 CONECT 1788 1769 1789 1796 CONECT 1789 1788 1790 1792 1797 CONECT 1790 1789 1791 1805 CONECT 1791 1790 CONECT 1792 1789 1793 1798 1799 CONECT 1793 1792 1794 1800 1801 CONECT 1794 1793 1795 CONECT 1795 1794 1802 1803 1804 CONECT 1796 1788 CONECT 1797 1789 CONECT 1798 1792 CONECT 1799 1792 CONECT 1800 1793 CONECT 1801 1793 CONECT 1802 1795 CONECT 1803 1795 CONECT 1804 1795 CONECT 1805 1790 1806 1813 CONECT 1806 1805 1807 1809 1814 CONECT 1807 1806 1808 1822 CONECT 1808 1807 CONECT 1809 1806 1810 1815 1816 CONECT 1810 1809 1811 1817 1818 CONECT 1811 1810 1812 CONECT 1812 1811 1819 1820 1821 CONECT 1813 1805 CONECT 1814 1806 CONECT 1815 1809 CONECT 1816 1809 CONECT 1817 1810 CONECT 1818 1810 CONECT 1819 1812 CONECT 1820 1812 CONECT 1821 1812 CONECT 1822 1807 CONECT 2205 2213 CONECT 2213 2205 2214 2221 CONECT 2214 2213 2215 2217 2222 CONECT 2215 2214 2216 2230 CONECT 2216 2215 CONECT 2217 2214 2218 2223 2224 CONECT 2218 2217 2219 2225 2226 CONECT 2219 2218 2220 CONECT 2220 2219 2227 2228 2229 CONECT 2221 2213 CONECT 2222 2214 CONECT 2223 2217 CONECT 2224 2217 CONECT 2225 2218 CONECT 2226 2218 CONECT 2227 2220 CONECT 2228 2220 CONECT 2229 2220 CONECT 2230 2215 CONECT 2254 2271 CONECT 2271 2254 2272 2279 CONECT 2272 2271 2273 2275 2280 CONECT 2273 2272 2274 2288 CONECT 2274 2273 CONECT 2275 2272 2276 2281 2282 CONECT 2276 2275 2277 2283 2284 CONECT 2277 2276 2278 CONECT 2278 2277 2285 2286 2287 CONECT 2279 2271 CONECT 2280 2272 CONECT 2281 2275 CONECT 2282 2275 CONECT 2283 2276 CONECT 2284 2276 CONECT 2285 2278 CONECT 2286 2278 CONECT 2287 2278 CONECT 2288 2273 CONECT 2471 2483 CONECT 2483 2471 2484 2491 CONECT 2484 2483 2485 2487 2492 CONECT 2485 2484 2486 2500 CONECT 2486 2485 CONECT 2487 2484 2488 2493 2494 CONECT 2488 2487 2489 2495 2496 CONECT 2489 2488 2490 CONECT 2490 2489 2497 2498 2499 CONECT 2491 2483 CONECT 2492 2484 CONECT 2493 2487 CONECT 2494 2487 CONECT 2495 2488 CONECT 2496 2488 CONECT 2497 2490 CONECT 2498 2490 CONECT 2499 2490 CONECT 2500 2485 CONECT 3091 3103 CONECT 3103 3091 3104 3111 CONECT 3104 3103 3105 3107 3112 CONECT 3105 3104 3106 3120 CONECT 3106 3105 CONECT 3107 3104 3108 3113 3114 CONECT 3108 3107 3109 3115 3116 CONECT 3109 3108 3110 CONECT 3110 3109 3117 3118 3119 CONECT 3111 3103 CONECT 3112 3104 CONECT 3113 3107 CONECT 3114 3107 CONECT 3115 3108 CONECT 3116 3108 CONECT 3117 3110 CONECT 3118 3110 CONECT 3119 3110 CONECT 3120 3105 3121 3128 CONECT 3121 3120 3122 3124 3129 CONECT 3122 3121 3123 3137 CONECT 3123 3122 CONECT 3124 3121 3125 3130 3131 CONECT 3125 3124 3126 3132 3133 CONECT 3126 3125 3127 CONECT 3127 3126 3134 3135 3136 CONECT 3128 3120 CONECT 3129 3121 CONECT 3130 3124 CONECT 3131 3124 CONECT 3132 3125 CONECT 3133 3125 CONECT 3134 3127 CONECT 3135 3127 CONECT 3136 3127 CONECT 3137 3122 CONECT 3613 3635 CONECT 3635 3613 3636 3643 CONECT 3636 3635 3637 3639 3644 CONECT 3637 3636 3638 3652 CONECT 3638 3637 CONECT 3639 3636 3640 3645 3646 CONECT 3640 3639 3641 3647 3648 CONECT 3641 3640 3642 CONECT 3642 3641 3649 3650 3651 CONECT 3643 3635 CONECT 3644 3636 CONECT 3645 3639 CONECT 3646 3639 CONECT 3647 3640 CONECT 3648 3640 CONECT 3649 3642 CONECT 3650 3642 CONECT 3651 3642 CONECT 3652 3637 CONECT 3654 3674 CONECT 3674 3654 3675 3682 CONECT 3675 3674 3676 3678 3683 CONECT 3676 3675 3677 3691 CONECT 3677 3676 CONECT 3678 3675 3679 3684 3685 CONECT 3679 3678 3680 3686 3687 CONECT 3680 3679 3681 CONECT 3681 3680 3688 3689 3690 CONECT 3682 3674 CONECT 3683 3675 CONECT 3684 3678 CONECT 3685 3678 CONECT 3686 3679 CONECT 3687 3679 CONECT 3688 3681 CONECT 3689 3681 CONECT 3690 3681 CONECT 3691 3676 CONECT 3953 3965 CONECT 3965 3953 3966 3973 CONECT 3966 3965 3967 3969 3974 CONECT 3967 3966 3968 3982 CONECT 3968 3967 CONECT 3969 3966 3970 3975 3976 CONECT 3970 3969 3971 3977 3978 CONECT 3971 3970 3972 CONECT 3972 3971 3979 3980 3981 CONECT 3973 3965 CONECT 3974 3966 CONECT 3975 3969 CONECT 3976 3969 CONECT 3977 3970 CONECT 3978 3970 CONECT 3979 3972 CONECT 3980 3972 CONECT 3981 3972 CONECT 3982 3967 CONECT 4666 4675 CONECT 4675 4666 4676 4683 CONECT 4676 4675 4677 4679 4684 CONECT 4677 4676 4678 4692 CONECT 4678 4677 CONECT 4679 4676 4680 4685 4686 CONECT 4680 4679 4681 4687 4688 CONECT 4681 4680 4682 CONECT 4682 4681 4689 4690 4691 CONECT 4683 4675 CONECT 4684 4676 CONECT 4685 4679 CONECT 4686 4679 CONECT 4687 4680 CONECT 4688 4680 CONECT 4689 4682 CONECT 4690 4682 CONECT 4691 4682 CONECT 4692 4677 CONECT 6086 6095 CONECT 6095 6086 6096 6103 CONECT 6096 6095 6097 6099 6104 CONECT 6097 6096 6098 6112 CONECT 6098 6097 CONECT 6099 6096 6100 6105 6106 CONECT 6100 6099 6101 6107 6108 CONECT 6101 6100 6102 CONECT 6102 6101 6109 6110 6111 CONECT 6103 6095 CONECT 6104 6096 CONECT 6105 6099 CONECT 6106 6099 CONECT 6107 6100 CONECT 6108 6100 CONECT 6109 6102 CONECT 6110 6102 CONECT 6111 6102 CONECT 6112 6097 CONECT 6311 6320 CONECT 6320 6311 6321 6328 CONECT 6321 6320 6322 6324 6329 CONECT 6322 6321 6323 6337 CONECT 6323 6322 CONECT 6324 6321 6325 6330 6331 CONECT 6325 6324 6326 6332 6333 CONECT 6326 6325 6327 CONECT 6327 6326 6334 6335 6336 CONECT 6328 6320 CONECT 6329 6321 CONECT 6330 6324 CONECT 6331 6324 CONECT 6332 6325 CONECT 6333 6325 CONECT 6334 6327 CONECT 6335 6327 CONECT 6336 6327 CONECT 6337 6322 CONECT 6625 6642 CONECT 6642 6625 6643 6650 CONECT 6643 6642 6644 6646 6651 CONECT 6644 6643 6645 6659 CONECT 6645 6644 CONECT 6646 6643 6647 6652 6653 CONECT 6647 6646 6648 6654 6655 CONECT 6648 6647 6649 CONECT 6649 6648 6656 6657 6658 CONECT 6650 6642 CONECT 6651 6643 CONECT 6652 6646 CONECT 6653 6646 CONECT 6654 6647 CONECT 6655 6647 CONECT 6656 6649 CONECT 6657 6649 CONECT 6658 6649 CONECT 6659 6644 CONECT 9757 9767 CONECT 9767 9757 9768 9775 CONECT 9768 9767 9769 9771 9776 CONECT 9769 9768 9770 9784 CONECT 9770 9769 CONECT 9771 9768 9772 9777 9778 CONECT 9772 9771 9773 9779 9780 CONECT 9773 9772 9774 CONECT 9774 9773 9781 9782 9783 CONECT 9775 9767 CONECT 9776 9768 CONECT 9777 9771 CONECT 9778 9771 CONECT 9779 9772 CONECT 9780 9772 CONECT 9781 9774 CONECT 9782 9774 CONECT 9783 9774 CONECT 9784 9769 CONECT1037710392 CONECT10392103771039310400 CONECT1039310392103941039610401 CONECT10394103931039510409 CONECT1039510394 CONECT1039610393103971040210403 CONECT1039710396103981040410405 CONECT103981039710399 CONECT1039910398104061040710408 CONECT1040010392 CONECT1040110393 CONECT1040210396 CONECT1040310396 CONECT1040410397 CONECT1040510397 CONECT1040610399 CONECT1040710399 CONECT1040810399 CONECT1040910394 CONECT1088410901 CONECT10901108841090210909 CONECT1090210901109031090510910 CONECT10903109021090410918 CONECT1090410903 CONECT1090510902109061091110912 CONECT1090610905109071091310914 CONECT109071090610908 CONECT1090810907109151091610917 CONECT1090910901 CONECT1091010902 CONECT1091110905 CONECT1091210905 CONECT1091310906 CONECT1091410906 CONECT1091510908 CONECT1091610908 CONECT1091710908 CONECT1091810903 CONECT1100511022 CONECT11022110051102311030 CONECT1102311022110241102611031 CONECT11024110231102511039 CONECT1102511024 CONECT1102611023110271103211033 CONECT1102711026110281103411035 CONECT110281102711029 CONECT1102911028110361103711038 CONECT1103011022 CONECT1103111023 CONECT1103211026 CONECT1103311026 CONECT1103411027 CONECT1103511027 CONECT1103611029 CONECT1103711029 CONECT1103811029 CONECT1103911024 CONECT1107111077 CONECT110771107111078 CONECT1107811077110791108111085 CONECT11079110781108011086 CONECT1108011079 CONECT110811107811082 CONECT110821108111083 CONECT110831108211084 CONECT1108411083 CONECT1108511078 CONECT1108611079 CONECT1191911932 CONECT11932119191193311940 CONECT1193311932119341193611941 CONECT11934119331193511949 CONECT1193511934 CONECT1193611933119371194211943 CONECT1193711936119381194411945 CONECT119381193711939 CONECT1193911938119461194711948 CONECT1194011932 CONECT1194111933 CONECT1194211936 CONECT1194311936 CONECT1194411937 CONECT1194511937 CONECT1194611939 CONECT1194711939 CONECT1194811939 CONECT1194911934 CONECT1208912108 CONECT12108120891210912116 CONECT1210912108121101211212117 CONECT12110121091211112125 CONECT1211112110 CONECT1211212109121131211812119 CONECT1211312112121141212012121 CONECT121141211312115 CONECT1211512114121221212312124 CONECT1211612108 CONECT1211712109 CONECT1211812112 CONECT1211912112 CONECT1212012113 CONECT1212112113 CONECT1212212115 CONECT1212312115 CONECT1212412115 CONECT1212512110 CONECT1233212344 CONECT12344123321234512352 CONECT1234512344123461234812353 CONECT12346123451234712361 CONECT1234712346 CONECT1234812345123491235412355 CONECT1234912348123501235612357 CONECT123501234912351 CONECT1235112350123581235912360 CONECT1235212344 CONECT1235312345 CONECT1235412348 CONECT1235512348 CONECT1235612349 CONECT1235712349 CONECT1235812351 CONECT1235912351 CONECT1236012351 CONECT1236112346 CONECT1277112784 CONECT12784127711278512792 CONECT1278512784127861278812793 CONECT12786127851278712801 CONECT1278712786 CONECT1278812785127891279412795 CONECT1278912788127901279612797 CONECT127901278912791 CONECT1279112790127981279912800 CONECT1279212784 CONECT1279312785 CONECT1279412788 CONECT1279512788 CONECT1279612789 CONECT1279712789 CONECT1279812791 CONECT1279912791 CONECT1280012791 CONECT1280112786 CONECT1327813286 CONECT13286132781328713294 CONECT1328713286132881329013295 CONECT13288132871328913303 CONECT1328913288 CONECT1329013287132911329613297 CONECT1329113290132921329813299 CONECT132921329113293 CONECT1329313292133001330113302 CONECT1329413286 CONECT1329513287 CONECT1329613290 CONECT1329713290 CONECT1329813291 CONECT1329913291 CONECT1330013293 CONECT1330113293 CONECT1330213293 CONECT1330313288 CONECT1409514113 CONECT14113140951411414121 CONECT1411414113141151411714122 CONECT14115141141411614130 CONECT1411614115 CONECT1411714114141181412314124 CONECT1411814117141191412514126 CONECT141191411814120 CONECT1412014119141271412814129 CONECT1412114113 CONECT1412214114 CONECT1412314117 CONECT1412414117 CONECT1412514118 CONECT1412614118 CONECT1412714120 CONECT1412814120 CONECT1412914120 CONECT1413014115 CONECT1416614181 CONECT14181141661418214189 CONECT1418214181141831418514190 CONECT14183141821418414198 CONECT1418414183 CONECT1418514182141861419114192 CONECT1418614185141871419314194 CONECT141871418614188 CONECT1418814187141951419614197 CONECT1418914181 CONECT1419014182 CONECT1419114185 CONECT1419214185 CONECT1419314186 CONECT1419414186 CONECT1419514188 CONECT1419614188 CONECT1419714188 CONECT1419814183 CONECT1436514382 CONECT14382143651438314390 CONECT1438314382143841438614391 CONECT14384143831438514399 CONECT1438514384 CONECT1438614383143871439214393 CONECT1438714386143881439414395 CONECT143881438714389 CONECT1438914388143961439714398 CONECT1439014382 CONECT1439114383 CONECT1439214386 CONECT1439314386 CONECT1439414387 CONECT1439514387 CONECT1439614389 CONECT1439714389 CONECT1439814389 CONECT1439914384 CONECT1513115148 CONECT15148151311514915156 CONECT1514915148151501515215157 CONECT15150151491515115165 CONECT1515115150 CONECT1515215149151531515815159 CONECT1515315152151541516015161 CONECT151541515315155 CONECT1515515154151621516315164 CONECT1515615148 CONECT1515715149 CONECT1515815152 CONECT1515915152 CONECT1516015153 CONECT1516115153 CONECT1516215155 CONECT1516315155 CONECT1516415155 CONECT15165151501516615173 CONECT1516615165151671516915174 CONECT15167151661516815182 CONECT1516815167 CONECT1516915166151701517515176 CONECT1517015169151711517715178 CONECT151711517015172 CONECT1517215171151791518015181 CONECT1517315165 CONECT1517415166 CONECT1517515169 CONECT1517615169 CONECT1517715170 CONECT1517815170 CONECT1517915172 CONECT1518015172 CONECT1518115172 CONECT1518215167 CONECT157321573315737 CONECT1573315732157341574415745 CONECT1573415733157351574615747 CONECT1573515734157361573815748 CONECT1573615735157371574915750 CONECT1573715732157361575115752 CONECT1573815735157391575315754 CONECT1573915738157401575515756 CONECT1574015739157411574215743 CONECT1574115740 CONECT1574215740 CONECT1574315740 CONECT1574415733 CONECT1574515733 CONECT1574615734 CONECT1574715734 CONECT1574815735 CONECT1574915736 CONECT1575015736 CONECT1575115737 CONECT1575215737 CONECT1575315738 CONECT1575415738 CONECT1575515739 CONECT1575615739 MASTER 470 0 37 57 0 0 2 6 8000 2 692 87 END