>>4PJW:HELIX   41 AE5 SER A  799  MSE A  803  5                                   5    
SHQISGGRDLEPLVYTPDSSLQSELLSFILDHVFIESKIEALHKRRNLLAAFCKLIVYTVVENTAADIFKQYKYYNDYGDIIKETSKTRQIDKIQCAKTLILSLQQLFNEIQENGYNFDRSSSTFSGIKELARRFALTFKTREAIALHKDGIEFAFKEPNPQGESPLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFTFQSLRREVWLPLSYRNSLKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 41 AE5 SER A 799 MSE A 803 5 5 ATOM 10957 N SER A 799 -26.705 23.806 -47.304 1.00 74.33 N ANISOU10957 N SER A 799 9220 12657 6364 725 902 361 N ATOM 10958 CA SER A 799 -25.752 22.846 -47.857 1.00 77.16 C ANISOU10958 CA SER A 799 9552 13096 6669 694 889 151 C ATOM 10959 C SER A 799 -26.120 22.529 -49.302 1.00 86.63 C ANISOU10959 C SER A 799 10716 14510 7688 699 832 155 C ATOM 10960 O SER A 799 -26.984 23.180 -49.889 1.00 86.94 O ANISOU10960 O SER A 799 10752 14639 7643 725 813 335 O ATOM 10961 CB SER A 799 -25.748 21.553 -47.035 1.00 72.29 C ANISOU10961 CB SER A 799 8926 12394 6146 708 806 -72 C ATOM 10962 OG SER A 799 -26.831 20.711 -47.397 1.00 72.95 O ANISOU10962 OG SER A 799 8981 12568 6168 736 684 -130 O ATOM 10963 H SER A 799 -27.205 23.484 -46.682 1.00 89.19 H ATOM 10964 HA SER A 799 -24.860 23.226 -47.840 1.00 92.59 H ATOM 10965 HB2 SER A 799 -24.915 21.081 -47.195 1.00 86.75 H ATOM 10966 HB3 SER A 799 -25.824 21.777 -46.094 1.00 86.75 H ATOM 10967 HG SER A 799 -27.560 21.107 -47.263 1.00 87.54 H ATOM 10968 N HIS A 800 -25.465 21.530 -49.880 1.00105.64 N ANISOU10968 N HIS A 800 13097 17002 10039 682 803 -43 N ATOM 10969 CA HIS A 800 -25.831 21.085 -51.218 1.00103.65 C ANISOU10969 CA HIS A 800 12808 16965 9611 694 737 -79 C ATOM 10970 C HIS A 800 -27.238 20.493 -51.206 1.00 98.30 C ANISOU10970 C HIS A 800 12098 16345 8904 728 596 -109 C ATOM 10971 O HIS A 800 -27.942 20.517 -52.213 1.00105.03 O ANISOU10971 O HIS A 800 12918 17382 9608 751 532 -61 O ATOM 10972 CB HIS A 800 -24.823 20.059 -51.743 1.00109.78 C ANISOU10972 CB HIS A 800 13561 17799 10353 671 738 -305 C ATOM 10973 CG HIS A 800 -25.379 19.147 -52.794 1.00120.88 C ANISOU10973 CG HIS A 800 14920 19393 11617 689 630 -432 C ATOM 10974 ND1 HIS A 800 -25.800 19.598 -54.027 1.00123.12 N ANISOU10974 ND1 HIS A 800 15186 19884 11711 713 617 -322 N ATOM 10975 CD2 HIS A 800 -25.590 17.809 -52.792 1.00120.23 C ANISOU10975 CD2 HIS A 800 14802 19323 11557 689 534 -665 C ATOM 10976 CE1 HIS A 800 -26.243 18.577 -54.739 1.00122.63 C ANISOU10976 CE1 HIS A 800 15077 19966 11553 726 509 -496 C ATOM 10977 NE2 HIS A 800 -26.127 17.481 -54.013 1.00122.44 N ANISOU10977 NE2 HIS A 800 15041 19821 11662 707 461 -709 N ATOM 10978 H HIS A 800 -24.812 21.098 -49.525 1.00126.77 H ATOM 10979 HA HIS A 800 -25.828 21.847 -51.819 1.00124.38 H ATOM 10980 HB2 HIS A 800 -24.069 20.531 -52.130 1.00131.74 H ATOM 10981 HB3 HIS A 800 -24.521 19.509 -51.003 1.00131.74 H ATOM 10982 HD1 HIS A 800 -25.776 20.416 -54.291 1.00147.75 H ATOM 10983 HD2 HIS A 800 -25.405 17.222 -52.094 1.00144.28 H ATOM 10984 HE1 HIS A 800 -26.579 18.623 -55.605 1.00147.16 H ATOM 10985 HE2 HIS A 800 -26.350 16.689 -54.264 1.00146.93 H ATOM 10986 N GLN A 801 -27.655 19.986 -50.052 1.00 90.62 N ANISOU10986 N GLN A 801 11134 15226 8074 736 550 -184 N ATOM 10987 CA GLN A 801 -28.930 19.290 -49.943 1.00 90.87 C ANISOU10987 CA GLN A 801 11125 15305 8095 765 424 -241 C ATOM 10988 C GLN A 801 -30.143 20.215 -50.042 1.00 90.49 C ANISOU10988 C GLN A 801 11073 15310 8000 802 392 -5 C ATOM 10989 O GLN A 801 -31.278 19.740 -50.098 1.00 89.43 O ANISOU10989 O GLN A 801 10893 15251 7837 827 282 -31 O ATOM 10990 CB GLN A 801 -28.988 18.522 -48.622 1.00 90.83 C ANISOU10990 CB GLN A 801 11133 15117 8260 775 405 -371 C ATOM 10991 CG GLN A 801 -27.949 17.422 -48.493 1.00 94.28 C ANISOU10991 CG GLN A 801 11563 15495 8765 752 417 -614 C ATOM 10992 CD GLN A 801 -28.094 16.354 -49.559 1.00102.98 C ANISOU10992 CD GLN A 801 12606 16758 9763 739 334 -806 C ATOM 10993 OE1 GLN A 801 -29.202 15.904 -49.858 1.00106.57 O ANISOU10993 OE1 GLN A 801 13015 17315 10164 753 232 -851 O ATOM 10994 NE2 GLN A 801 -26.974 15.947 -50.146 1.00103.86 N ANISOU10994 NE2 GLN A 801 12713 16900 9847 712 377 -927 N ATOM 10995 H GLN A 801 -27.216 20.033 -49.314 1.00108.75 H ATOM 10996 HA GLN A 801 -28.993 18.643 -50.663 1.00109.04 H ATOM 10997 HB2 GLN A 801 -28.848 19.146 -47.893 1.00108.99 H ATOM 10998 HB3 GLN A 801 -29.863 18.112 -48.539 1.00108.99 H ATOM 10999 HG2 GLN A 801 -27.064 17.811 -48.577 1.00113.14 H ATOM 11000 HG3 GLN A 801 -28.044 16.997 -47.627 1.00113.14 H ATOM 11001 HE21 GLN A 801 -26.219 16.288 -49.915 1.00124.63 H ATOM 11002 HE22 GLN A 801 -27.003 15.343 -50.758 1.00124.63 H ATOM 11003 N ILE A 802 -29.914 21.526 -50.053 1.00 79.15 N ANISOU11003 N ILE A 802 9676 13829 6567 806 490 225 N ATOM 11004 CA ILE A 802 -31.017 22.486 -50.120 1.00 80.70 C ANISOU11004 CA ILE A 802 9869 14047 6746 847 474 472 C ATOM 11005 C ILE A 802 -31.837 22.318 -51.401 1.00 83.54 C ANISOU11005 C ILE A 802 10165 14650 6926 875 374 497 C ATOM 11006 O ILE A 802 -33.069 22.287 -51.364 1.00 83.64 O ANISOU11006 O ILE A 802 10137 14716 6926 912 279 565 O ATOM 11007 CB ILE A 802 -30.526 23.957 -50.007 1.00 75.30 C ANISOU11007 CB ILE A 802 9237 13263 6110 845 615 710 C ATOM 11008 CG1 ILE A 802 -31.716 24.920 -50.032 1.00 73.05 C ANISOU11008 CG1 ILE A 802 8946 12973 5836 896 599 968 C ATOM 11009 CG2 ILE A 802 -29.580 24.326 -51.143 1.00 80.41 C ANISOU11009 CG2 ILE A 802 9884 14036 6632 822 693 734 C ATOM 11010 CD1 ILE A 802 -31.410 26.290 -49.460 1.00 74.48 C ANISOU11010 CD1 ILE A 802 9183 12975 6142 896 737 1184 C ATOM 11011 H ILE A 802 -29.133 21.886 -50.022 1.00 94.97 H ATOM 11012 HA ILE A 802 -31.612 22.321 -49.371 1.00 96.84 H ATOM 11013 HB ILE A 802 -30.058 24.065 -49.164 1.00 90.36 H ATOM 11014 HG12 ILE A 802 -32.001 25.039 -50.952 1.00 87.66 H ATOM 11015 HG13 ILE A 802 -32.439 24.536 -49.512 1.00 87.66 H ATOM 11016 HG21 ILE A 802 -29.300 25.249 -51.033 1.00 96.49 H ATOM 11017 HG22 ILE A 802 -28.808 23.740 -51.114 1.00 96.49 H ATOM 11018 HG23 ILE A 802 -30.045 24.220 -51.988 1.00 96.49 H ATOM 11019 HD11 ILE A 802 -32.208 26.839 -49.512 1.00 89.38 H ATOM 11020 HD12 ILE A 802 -31.134 26.192 -48.536 1.00 89.38 H ATOM 11021 HD13 ILE A 802 -30.696 26.695 -49.977 1.00 89.38 H HETATM11022 N MSE A 803 -31.137 22.189 -52.524 1.00109.25 N ANISOU11022 N MSE A 803 13408 18061 10041 861 394 435 N HETATM11023 CA MSE A 803 -31.761 22.079 -53.840 1.00112.33 C ANISOU11023 CA MSE A 803 13740 18703 10237 894 309 451 C HETATM11024 C MSE A 803 -32.246 20.662 -54.109 1.00107.51 C ANISOU11024 C MSE A 803 13063 18212 9573 885 165 181 C HETATM11025 O MSE A 803 -33.017 20.425 -55.038 1.00106.79 O ANISOU11025 O MSE A 803 12908 18330 9337 915 61 161 O HETATM11026 CB MSE A 803 -30.756 22.482 -54.926 1.00116.46 C ANISOU11026 CB MSE A 803 14279 19347 10625 892 400 486 C HETATM11027 CG MSE A 803 -29.457 21.666 -54.914 1.00122.85 C ANISOU11027 CG MSE A 803 15106 20118 11454 841 450 256 C HETATM11028 SE MSE A 803 -28.185 22.178 -56.295 1.00153.22 SE ANISOU11028 SE MSE A 803 18968 24126 15123 844 577 314 SE HETATM11029 CE MSE A 803 -28.587 20.779 -57.591 1.00128.10 C ANISOU11029 CE MSE A 803 15710 21228 11733 868 423 50 C HETATM11030 H MSE A 803 -30.278 22.161 -52.549 1.00131.10 H HETATM11031 HA MSE A 803 -32.515 22.688 -53.886 1.00134.80 H HETATM11032 HB2 MSE A 803 -31.172 22.361 -55.795 1.00139.76 H HETATM11033 HB3 MSE A 803 -30.520 23.414 -54.802 1.00139.76 H HETATM11034 HG2 MSE A 803 -29.024 21.784 -54.054 1.00147.42 H HETATM11035 HG3 MSE A 803 -29.676 20.730 -55.045 1.00147.42 H HETATM11036 HE1 MSE A 803 -28.420 19.914 -57.184 1.00153.72 H HETATM11037 HE2 MSE A 803 -29.519 20.848 -57.850 1.00153.72 H HETATM11038 HE3 MSE A 803 -28.018 20.895 -58.367 1.00153.72 H ATOM 11039 N SER A 804 -31.790 19.727 -53.283 1.00 96.32 N ANISOU11039 N SER A 804 11658 16657 8282 847 161 -29 N ATOM 11040 CA SER A 804 -32.008 18.302 -53.514 1.00 99.91 C ANISOU11040 CA SER A 804 12054 17191 8717 828 49 -319 C ATOM 11041 C SER A 804 -33.484 17.918 -53.658 1.00101.31 C ANISOU11041 C SER A 804 12154 17488 8853 853 -101 -344 C ATOM 11042 O SER A 804 -33.835 17.088 -54.497 1.00109.90 O ANISOU11042 O SER A 804 13172 18749 9838 847 -207 -531 O ATOM 11043 CB SER A 804 -31.375 17.486 -52.382 1.00102.35 C ANISOU11043 CB SER A 804 12392 17289 9208 796 84 -497 C ATOM 11044 OG SER A 804 -32.005 17.752 -51.140 1.00101.08 O ANISOU11044 OG SER A 804 12254 16966 9187 815 85 -397 O ATOM 11045 H SER A 804 -31.344 19.895 -52.567 1.00115.58 H ATOM 11046 HA SER A 804 -31.562 18.053 -54.339 1.00119.89 H ATOM 11047 HB2 SER A 804 -31.467 16.542 -52.585 1.00122.82 H ATOM 11048 HB3 SER A 804 -30.436 17.719 -52.314 1.00122.82 H ATOM 11049 HG SER A 804 -32.820 17.554 -51.183 1.00121.30 H ATOM 11050 N GLY A 805 -34.342 18.525 -52.844 1.00 93.72 N ANISOU11050 N GLY A 805 11198 16434 7977 880 -112 -160 N ATOM 11051 CA GLY A 805 -35.745 18.150 -52.796 1.00 94.73 C ANISOU11051 CA GLY A 805 11246 16653 8095 901 -256 -179 C ATOM 11052 C GLY A 805 -36.597 18.747 -53.900 1.00 97.59 C ANISOU11052 C GLY A 805 11547 17238 8294 942 -332 -34 C ATOM 11053 O GLY A 805 -37.509 19.531 -53.632 1.00103.05 O ANISOU11053 O GLY A 805 12224 17918 9011 985 -353 193 O ATOM 11054 N GLY A 806 -36.309 18.362 -55.142 1.00 74.83 N ANISOU11054 N GLY A 806 8628 14559 5247 938 -374 -166 N ATOM 11055 CA GLY A 806 -37.019 18.884 -56.297 1.00 74.85 C ANISOU11055 CA GLY A 806 8572 14799 5069 989 -444 -45 C ATOM 11056 C GLY A 806 -36.983 20.402 -56.354 1.00 80.40 C ANISOU11056 C GLY A 806 9330 15465 5755 1041 -334 309 C ATOM 11057 O GLY A 806 -38.005 21.051 -56.591 1.00 75.39 O ANISOU11057 O GLY A 806 8651 14915 5081 1095 -389 500 O ATOM 11058 N ARG A 807 -35.803 20.975 -56.138 1.00118.40 N ANISOU11058 N ARG A 807 14233 20144 10611 1024 -177 394 N ATOM 11059 CA ARG A 807 -35.679 22.421 -56.023 1.00119.14 C ANISOU11059 CA ARG A 807 14383 20150 10736 1062 -54 714 C ATOM 11060 C ARG A 807 -34.937 23.031 -57.206 1.00125.14 C ANISOU11060 C ARG A 807 15162 21056 11329 1090 28 809 C ATOM 11061 O ARG A 807 -33.831 22.617 -57.544 1.00126.79 O ANISOU11061 O ARG A 807 15401 21282 11491 1055 88 667 O ATOM 11062 CB ARG A 807 -34.967 22.780 -54.722 1.00112.13 C ANISOU11062 CB ARG A 807 13580 18970 10055 1022 71 765 C ATOM 11063 CG ARG A 807 -35.650 22.247 -53.472 1.00112.22 C ANISOU11063 CG ARG A 807 13582 18825 10231 1009 9 696 C ATOM 11064 CD ARG A 807 -36.891 23.055 -53.139 1.00121.81 C ANISOU11064 CD ARG A 807 14772 20007 11504 1064 -23 941 C ATOM 11065 NE ARG A 807 -37.471 22.671 -51.854 1.00122.78 N ANISOU11065 NE ARG A 807 14897 19961 11795 1061 -57 912 N ATOM 11066 CZ ARG A 807 -38.635 22.039 -51.716 1.00124.25 C ANISOU11066 CZ ARG A 807 15001 20224 11984 1079 -196 856 C ATOM 11067 NH1 ARG A 807 -39.357 21.720 -52.788 1.00117.35 N ANISOU11067 NH1 ARG A 807 14034 19596 10958 1097 -325 805 N ATOM 11068 NH2 ARG A 807 -39.083 21.729 -50.504 1.00120.46 N ANISOU11068 NH2 ARG A 807 14529 19582 11659 1084 -208 849 N ATOM 11069 N ASP A 808 -35.557 24.019 -57.838 1.00128.89 N ANISOU11069 N ASP A 808 15617 21638 11718 1161 36 1058 N ATOM 11070 CA ASP A 808 -34.902 24.773 -58.896 1.00134.22 C ANISOU11070 CA ASP A 808 16316 22439 12244 1202 135 1202 C ATOM 11071 C ASP A 808 -34.219 25.970 -58.262 1.00127.89 C ANISOU11071 C ASP A 808 15596 21404 11592 1190 313 1432 C ATOM 11072 O ASP A 808 -33.000 26.124 -58.326 1.00125.45 O ANISOU11072 O ASP A 808 15342 21033 11290 1152 437 1409 O ATOM 11073 CB ASP A 808 -35.925 25.262 -59.928 1.00142.96 C ANISOU11073 CB ASP A 808 17354 23784 13181 1296 58 1364 C ATOM 11074 CG ASP A 808 -36.661 24.126 -60.614 1.00145.89 C ANISOU11074 CG ASP A 808 17633 24403 13398 1309 -127 1127 C ATOM 11075 OD1 ASP A 808 -36.468 22.956 -60.217 1.00146.44 O ANISOU11075 OD1 ASP A 808 17689 24435 13516 1241 -197 842 O ATOM 11076 OD2 ASP A 808 -37.442 24.410 -61.547 1.00145.02 O ANISOU11076 OD2 ASP A 808 17457 24521 13122 1388 -203 1224 O HETATM11077 N MSE A 809 -35.035 26.799 -57.621 1.00140.08 N ANISOU11077 N MSE A 809 17143 22814 13267 1221 325 1645 N HETATM11078 CA MSE A 809 -34.620 28.095 -57.101 1.00142.80 C ANISOU11078 CA MSE A 809 17553 22942 13760 1223 488 1891 C HETATM11079 C MSE A 809 -33.761 28.012 -55.841 1.00144.04 C ANISOU11079 C MSE A 809 17781 22828 14120 1141 578 1800 C HETATM11080 O MSE A 809 -33.484 29.036 -55.213 1.00146.68 O ANISOU11080 O MSE A 809 18168 22955 14610 1133 704 1975 O HETATM11081 CB MSE A 809 -35.865 28.934 -56.806 1.00142.62 C ANISOU11081 CB MSE A 809 17503 22857 13827 1289 461 2127 C HETATM11082 CG MSE A 809 -37.140 28.103 -56.666 1.00133.09 C ANISOU11082 CG MSE A 809 16217 21755 12594 1310 278 2020 C HETATM11083 SE MSE A 809 -38.696 29.141 -56.107 1.00164.74 SE ANISOU11083 SE MSE A 809 20190 25647 16758 1389 255 2312 SE HETATM11084 CE MSE A 809 -37.962 30.942 -56.354 1.00122.21 C ANISOU11084 CE MSE A 809 14877 20109 11448 1427 482 2640 C HETATM11085 HA MSE A 809 -34.114 28.554 -57.789 1.00171.36 H ATOM 11086 N LEU A 810 -33.332 26.805 -55.478 1.00113.65 N ANISOU11086 N LEU A 810 13930 18980 10272 1083 516 1522 N ATOM 11087 CA LEU A 810 -32.499 26.613 -54.294 1.00107.78 C ANISOU11087 CA LEU A 810 13244 18001 9705 1014 591 1414 C ATOM 11088 C LEU A 810 -31.050 26.276 -54.660 1.00110.52 C ANISOU11088 C LEU A 810 13620 18374 9998 962 679 1269 C ATOM 11089 O LEU A 810 -30.207 26.122 -53.777 1.00111.35 O ANISOU11089 O LEU A 810 13767 18306 10236 906 749 1170 O ATOM 11090 CB LEU A 810 -33.092 25.532 -53.383 1.00104.60 C ANISOU11090 CB LEU A 810 12821 17536 9389 995 471 1220 C ATOM 11091 CG LEU A 810 -34.524 25.756 -52.876 1.00100.27 C ANISOU11091 CG LEU A 810 12239 16947 8914 1044 386 1346 C ATOM 11092 CD1 LEU A 810 -34.819 24.866 -51.668 1.00 95.74 C ANISOU11092 CD1 LEU A 810 11667 16237 8474 1019 324 1183 C ATOM 11093 CD2 LEU A 810 -34.796 27.221 -52.545 1.00 92.31 C ANISOU11093 CD2 LEU A 810 11268 15787 8019 1079 492 1644 C ATOM 11094 H LEU A 810 -33.510 26.079 -55.903 1.00136.38 H ATOM 11095 HA LEU A 810 -32.486 27.442 -53.790 1.00129.33 H ATOM 11096 N GLU A 811 -30.755 26.174 -55.955 1.00105.24 N ANISOU11096 N GLU A 811 12926 17926 9135 986 678 1260 N ATOM 11097 CA GLU A 811 -29.371 25.993 -56.400 1.00105.72 C ANISOU11097 CA GLU A 811 13012 18017 9142 945 780 1160 C ATOM 11098 C GLU A 811 -28.566 27.308 -56.358 1.00101.68 C ANISOU11098 C GLU A 811 12548 17387 8697 933 969 1384 C ATOM 11099 O GLU A 811 -27.344 27.271 -56.222 1.00 94.78 O ANISOU11099 O GLU A 811 11701 16448 7864 879 1079 1306 O ATOM 11100 CB GLU A 811 -29.297 25.325 -57.791 1.00112.72 C ANISOU11100 CB GLU A 811 13853 19183 9791 978 715 1049 C ATOM 11101 CG GLU A 811 -29.532 26.242 -58.997 1.00122.25 C ANISOU11101 CG GLU A 811 15048 20574 10827 1053 763 1285 C ATOM 11102 CD GLU A 811 -29.161 25.592 -60.325 1.00128.18 C ANISOU11102 CD GLU A 811 15766 21594 11342 1084 729 1158 C ATOM 11103 OE1 GLU A 811 -29.126 26.310 -61.348 1.00128.09 O ANISOU11103 OE1 GLU A 811 15751 21741 11177 1148 790 1342 O ATOM 11104 OE2 GLU A 811 -28.908 24.368 -60.349 1.00129.74 O ANISOU11104 OE2 GLU A 811 15943 21843 11511 1049 647 875 O ATOM 11105 H GLU A 811 -31.332 26.205 -56.592 1.00126.29 H ATOM 11106 HA GLU A 811 -28.941 25.386 -55.778 1.00126.87 H ATOM 11107 HB2 GLU A 811 -28.415 24.935 -57.894 1.00135.26 H ATOM 11108 HB3 GLU A 811 -29.965 24.624 -57.827 1.00135.26 H ATOM 11109 HG2 GLU A 811 -30.472 26.480 -59.033 1.00146.70 H ATOM 11110 HG3 GLU A 811 -28.992 27.042 -58.894 1.00146.70 H ATOM 11111 N PRO A 812 -29.242 28.473 -56.466 1.00100.29 N ANISOU11111 N PRO A 812 12378 17179 8549 982 1014 1662 N ATOM 11112 CA PRO A 812 -28.509 29.739 -56.311 1.00 97.37 C ANISOU11112 CA PRO A 812 12051 16663 8284 963 1204 1870 C ATOM 11113 C PRO A 812 -28.023 30.042 -54.887 1.00 99.44 C ANISOU11113 C PRO A 812 12354 16644 8785 893 1284 1840 C ATOM 11114 O PRO A 812 -27.093 30.834 -54.736 1.00 96.93 O ANISOU11114 O PRO A 812 12062 16212 8554 851 1450 1930 O ATOM 11115 CB PRO A 812 -29.549 30.792 -56.717 1.00 97.08 C ANISOU11115 CB PRO A 812 12001 16648 8236 1043 1207 2158 C ATOM 11116 CG PRO A 812 -30.518 30.076 -57.564 1.00104.07 C ANISOU11116 CG PRO A 812 12829 17784 8928 1112 1040 2100 C ATOM 11117 CD PRO A 812 -30.610 28.717 -56.962 1.00104.07 C ANISOU11117 CD PRO A 812 12813 17783 8945 1064 907 1803 C ATOM 11118 HA PRO A 812 -27.758 29.773 -56.924 1.00116.85 H ATOM 11119 HB2 PRO A 812 -29.983 31.146 -55.924 1.00116.49 H ATOM 11120 HB3 PRO A 812 -29.117 31.502 -57.217 1.00116.49 H ATOM 11121 HG2 PRO A 812 -31.377 30.525 -57.533 1.00124.88 H ATOM 11122 HG3 PRO A 812 -30.186 30.028 -58.474 1.00124.88 H ATOM 11123 HD2 PRO A 812 -31.242 28.714 -56.226 1.00124.88 H ATOM 11124 HD3 PRO A 812 -30.847 28.062 -57.638 1.00124.88 H ATOM 11125 N LEU A 813 -28.636 29.434 -53.872 1.00100.49 N ANISOU11125 N LEU A 813 12488 16674 9020 884 1176 1717 N ATOM 11126 CA LEU A 813 -28.373 29.796 -52.473 1.00 91.42 C ANISOU11126 CA LEU A 813 11377 15268 8091 839 1242 1710 C ATOM 11127 C LEU A 813 -27.306 28.937 -51.795 1.00 82.92 C ANISOU11127 C LEU A 813 10310 14129 7068 772 1257 1452 C ATOM 11128 O LEU A 813 -26.752 29.332 -50.768 1.00 76.53 O ANISOU11128 O LEU A 813 9526 13132 6421 732 1346 1439 O ATOM 11129 CB LEU A 813 -29.665 29.707 -51.658 1.00 86.87 C ANISOU11129 CB LEU A 813 10799 14600 7608 880 1131 1745 C ATOM 11130 CG LEU A 813 -30.715 30.777 -51.952 1.00 87.01 C ANISOU11130 CG LEU A 813 10809 14599 7651 946 1140 2021 C ATOM 11131 CD1 LEU A 813 -32.034 30.403 -51.286 1.00 85.31 C ANISOU11131 CD1 LEU A 813 10575 14340 7499 990 1007 2015 C ATOM 11132 CD2 LEU A 813 -30.235 32.156 -51.494 1.00 83.22 C ANISOU11132 CD2 LEU A 813 10371 13912 7339 927 1316 2216 C ATOM 11133 H LEU A 813 -29.214 28.803 -53.965 1.00120.59 H ATOM 11134 HA LEU A 813 -28.070 30.717 -52.444 1.00109.70 H ATOM 11135 HB2 LEU A 813 -30.075 28.845 -51.829 1.00104.24 H ATOM 11136 HB3 LEU A 813 -29.438 29.775 -50.718 1.00104.24 H ATOM 11137 HG LEU A 813 -30.865 30.816 -52.909 1.00104.41 H ATOM 11138 HD11 LEU A 813 -32.691 31.090 -51.479 1.00102.37 H ATOM 11139 HD12 LEU A 813 -32.334 29.550 -51.636 1.00102.37 H ATOM 11140 HD13 LEU A 813 -31.896 30.337 -50.328 1.00102.37 H ATOM 11141 HD21 LEU A 813 -30.922 32.811 -51.693 1.00 99.87 H ATOM 11142 HD22 LEU A 813 -30.069 32.131 -50.538 1.00 99.87 H ATOM 11143 HD23 LEU A 813 -29.418 32.378 -51.966 1.00 99.87 H ATOM 11144 N VAL A 814 -27.041 27.767 -52.370 1.00 74.12 N ANISOU11144 N VAL A 814 9167 13172 5823 767 1169 1242 N ATOM 11145 CA VAL A 814 -26.063 26.815 -51.839 1.00 69.32 C ANISOU11145 CA VAL A 814 8559 12517 5263 716 1168 982 C ATOM 11146 C VAL A 814 -24.767 27.469 -51.363 1.00 70.95 C ANISOU11146 C VAL A 814 8783 12596 5580 658 1336 994 C ATOM 11147 O VAL A 814 -24.205 28.329 -52.042 1.00 72.30 O ANISOU11147 O VAL A 814 8954 12805 5713 645 1468 1143 O ATOM 11148 CB VAL A 814 -25.708 25.751 -52.900 1.00 68.24 C ANISOU11148 CB VAL A 814 8388 12584 4957 719 1100 802 C ATOM 11149 CG1 VAL A 814 -24.582 24.831 -52.417 1.00 63.88 C ANISOU11149 CG1 VAL A 814 7832 11969 4471 671 1116 547 C ATOM 11150 CG2 VAL A 814 -26.937 24.928 -53.261 1.00 74.08 C ANISOU11150 CG2 VAL A 814 9094 13452 5603 765 926 732 C ATOM 11151 H VAL A 814 -27.426 27.493 -53.089 1.00 88.94 H ATOM 11152 HA VAL A 814 -26.457 26.356 -51.081 1.00 83.19 H ATOM 11153 HB VAL A 814 -25.402 26.199 -53.704 1.00 81.89 H ATOM 11154 HG11 VAL A 814 -24.388 24.179 -53.109 1.00 76.66 H ATOM 11155 HG12 VAL A 814 -23.793 25.366 -52.236 1.00 76.66 H ATOM 11156 HG13 VAL A 814 -24.869 24.380 -51.608 1.00 76.66 H ATOM 11157 HG21 VAL A 814 -26.690 24.268 -53.928 1.00 88.90 H ATOM 11158 HG22 VAL A 814 -27.265 24.486 -52.463 1.00 88.90 H ATOM 11159 HG23 VAL A 814 -27.619 25.519 -53.617 1.00 88.90 H ATOM 11160 N TYR A 815 -24.302 27.030 -50.196 1.00 82.18 N ANISOU11160 N TYR A 815 10212 13873 7139 628 1334 833 N ATOM 11161 CA TYR A 815 -23.100 27.563 -49.568 1.00 78.80 C ANISOU11161 CA TYR A 815 9783 13325 6833 573 1481 808 C ATOM 11162 C TYR A 815 -22.152 26.416 -49.259 1.00 78.95 C ANISOU11162 C TYR A 815 9778 13348 6870 548 1445 531 C ATOM 11163 O TYR A 815 -22.553 25.425 -48.646 1.00 78.65 O ANISOU11163 O TYR A 815 9743 13271 6868 572 1319 369 O ATOM 11164 CB TYR A 815 -23.468 28.261 -48.257 1.00 70.45 C ANISOU11164 CB TYR A 815 8750 12070 5947 576 1515 885 C ATOM 11165 CG TYR A 815 -22.347 29.061 -47.616 1.00 69.47 C ANISOU11165 CG TYR A 815 8610 11828 5958 519 1684 892 C ATOM 11166 CD1 TYR A 815 -21.469 28.466 -46.720 1.00 71.66 C ANISOU11166 CD1 TYR A 815 8864 12042 6321 496 1685 667 C ATOM 11167 CD2 TYR A 815 -22.179 30.414 -47.893 1.00 77.43 C ANISOU11167 CD2 TYR A 815 9615 12782 7021 492 1844 1120 C ATOM 11168 CE1 TYR A 815 -20.449 29.194 -46.122 1.00 74.03 C ANISOU11168 CE1 TYR A 815 9127 12253 6747 445 1837 654 C ATOM 11169 CE2 TYR A 815 -21.167 31.150 -47.297 1.00 72.24 C ANISOU11169 CE2 TYR A 815 8924 12017 6509 432 2010 1116 C ATOM 11170 CZ TYR A 815 -20.305 30.538 -46.414 1.00 71.77 C ANISOU11170 CZ TYR A 815 8829 11920 6521 408 2005 876 C ATOM 11171 OH TYR A 815 -19.298 31.286 -45.836 1.00 71.47 O ANISOU11171 OH TYR A 815 8731 11793 6631 348 2172 860 O ATOM 11172 H TYR A 815 -24.678 26.406 -49.739 1.00 98.62 H ATOM 11173 HA TYR A 815 -22.661 28.195 -50.158 1.00 94.56 H ATOM 11174 HB2 TYR A 815 -24.201 28.872 -48.429 1.00 84.54 H ATOM 11175 HB3 TYR A 815 -23.749 27.588 -47.618 1.00 84.54 H ATOM 11176 HD1 TYR A 815 -21.564 27.563 -46.519 1.00 85.99 H ATOM 11177 HD2 TYR A 815 -22.760 30.834 -48.486 1.00 92.91 H ATOM 11178 HE1 TYR A 815 -19.868 28.780 -45.526 1.00 88.83 H ATOM 11179 HE2 TYR A 815 -21.067 32.053 -47.496 1.00 86.69 H ATOM 11180 HH TYR A 815 -18.839 30.803 -45.324 1.00 85.76 H ATOM 11181 N THR A 816 -20.902 26.544 -49.693 1.00 83.99 N ANISOU11181 N THR A 816 10389 14027 7496 505 1561 483 N ATOM 11182 CA THR A 816 -19.861 25.614 -49.276 1.00 85.34 C ANISOU11182 CA THR A 816 10531 14174 7722 483 1548 236 C ATOM 11183 C THR A 816 -18.794 26.406 -48.524 1.00 86.13 C ANISOU11183 C THR A 816 10601 14162 7964 433 1701 241 C ATOM 11184 O THR A 816 -18.269 27.390 -49.050 1.00 84.85 O ANISOU11184 O THR A 816 10418 14025 7795 394 1858 388 O ATOM 11185 CB THR A 816 -19.226 24.873 -50.463 1.00 88.07 C ANISOU11185 CB THR A 816 10851 14681 7931 481 1544 134 C ATOM 11186 OG1 THR A 816 -20.215 24.646 -51.478 1.00 93.04 O ANISOU11186 OG1 THR A 816 11496 15456 8398 522 1454 208 O ATOM 11187 CG2 THR A 816 -18.651 23.537 -49.994 1.00 84.68 C ANISOU11187 CG2 THR A 816 10399 14215 7561 485 1456 -135 C ATOM 11188 H THR A 816 -20.632 27.160 -50.228 1.00100.79 H ATOM 11189 HA THR A 816 -20.238 24.957 -48.671 1.00102.41 H ATOM 11190 HB THR A 816 -18.504 25.407 -50.829 1.00105.69 H ATOM 11191 HG1 THR A 816 -19.871 24.240 -52.128 1.00111.65 H ATOM 11192 HG21 THR A 816 -18.250 23.068 -50.742 1.00101.62 H ATOM 11193 HG22 THR A 816 -17.973 23.688 -49.317 1.00101.62 H ATOM 11194 HG23 THR A 816 -19.356 22.987 -49.618 1.00101.62 H ATOM 11195 N PRO A 817 -18.468 25.982 -47.291 1.00 69.66 N ANISOU11195 N PRO A 817 8503 11952 6012 435 1659 77 N ATOM 11196 CA PRO A 817 -17.555 26.797 -46.484 1.00 63.47 C ANISOU11196 CA PRO A 817 7674 11073 5370 391 1797 70 C ATOM 11197 C PRO A 817 -16.141 26.820 -47.049 1.00 62.18 C ANISOU11197 C PRO A 817 7440 10978 5206 341 1919 -2 C ATOM 11198 O PRO A 817 -15.713 25.853 -47.684 1.00 54.66 O ANISOU11198 O PRO A 817 6480 10115 4175 353 1861 -128 O ATOM 11199 CB PRO A 817 -17.557 26.102 -45.115 1.00 58.07 C ANISOU11199 CB PRO A 817 6992 10269 4802 427 1689 -119 C ATOM 11200 CG PRO A 817 -18.505 24.954 -45.218 1.00 59.36 C ANISOU11200 CG PRO A 817 7205 10449 4900 483 1512 -186 C ATOM 11201 CD PRO A 817 -18.758 24.687 -46.653 1.00 64.44 C ANISOU11201 CD PRO A 817 7854 11245 5384 477 1498 -122 C ATOM 11202 HA PRO A 817 -17.889 27.704 -46.394 1.00 76.17 H ATOM 11203 HB2 PRO A 817 -16.663 25.785 -44.912 1.00 69.68 H ATOM 11204 HB3 PRO A 817 -17.856 26.727 -44.436 1.00 69.68 H ATOM 11205 HG2 PRO A 817 -18.106 24.175 -44.799 1.00 71.23 H ATOM 11206 HG3 PRO A 817 -19.334 25.186 -44.771 1.00 71.23 H ATOM 11207 HD2 PRO A 817 -18.154 24.004 -46.982 1.00 77.33 H ATOM 11208 HD3 PRO A 817 -19.686 24.441 -46.793 1.00 77.33 H ATOM 11209 N ASP A 818 -15.428 27.918 -46.812 1.00102.03 N ANISOU11209 N ASP A 818 12430 15980 10358 283 2096 77 N ATOM 11210 CA ASP A 818 -14.033 28.028 -47.220 1.00103.80 C ANISOU11210 CA ASP A 818 12566 16256 10616 228 2232 10 C ATOM 11211 C ASP A 818 -13.235 26.941 -46.510 1.00107.43 C ANISOU11211 C ASP A 818 12982 16696 11141 249 2131 -266 C ATOM 11212 O ASP A 818 -13.649 26.441 -45.463 1.00105.76 O ANISOU11212 O ASP A 818 12796 16396 10991 292 1999 -382 O ATOM 11213 CB ASP A 818 -13.449 29.401 -46.854 1.00 99.20 C ANISOU11213 CB ASP A 818 11902 15599 10189 152 2442 123 C ATOM 11214 CG ASP A 818 -14.441 30.538 -47.033 1.00112.82 C ANISOU11214 CG ASP A 818 13678 17265 11922 145 2517 399 C ATOM 11215 OD1 ASP A 818 -15.361 30.410 -47.868 1.00122.11 O ANISOU11215 OD1 ASP A 818 14940 18505 12951 189 2444 539 O ATOM 11216 OD2 ASP A 818 -14.297 31.565 -46.333 1.00113.05 O ANISOU11216 OD2 ASP A 818 13653 17182 12121 98 2645 474 O ATOM 11217 H ASP A 818 -15.733 28.617 -46.414 1.00122.44 H ATOM 11218 HA ASP A 818 -13.958 27.899 -48.178 1.00124.55 H ATOM 11219 HB2 ASP A 818 -13.173 29.389 -45.924 1.00119.04 H ATOM 11220 HB3 ASP A 818 -12.684 29.579 -47.423 1.00119.04 H ATOM 11221 N SER A 819 -12.091 26.574 -47.078 1.00 94.84 N ANISOU11221 N SER A 819 11321 15177 9535 225 2194 -360 N ATOM 11222 CA SER A 819 -11.177 25.652 -46.413 1.00 92.31 C ANISOU11222 CA SER A 819 10944 14832 9299 243 2115 -603 C ATOM 11223 C SER A 819 -10.726 26.266 -45.091 1.00 89.76 C ANISOU11223 C SER A 819 10545 14402 9159 216 2151 -686 C ATOM 11224 O SER A 819 -10.451 25.556 -44.122 1.00 80.72 O ANISOU11224 O SER A 819 9384 13194 8093 258 2027 -870 O ATOM 11225 CB SER A 819 -9.965 25.364 -47.299 1.00 91.49 C ANISOU11225 CB SER A 819 10767 14831 9163 218 2210 -659 C ATOM 11226 OG SER A 819 -9.344 26.569 -47.709 1.00101.94 O ANISOU11226 OG SER A 819 12013 16178 10540 143 2428 -524 O ATOM 11227 H SER A 819 -11.820 26.845 -47.848 1.00113.80 H ATOM 11228 HA SER A 819 -11.633 24.816 -46.228 1.00110.77 H ATOM 11229 HB2 SER A 819 -9.326 24.834 -46.798 1.00109.78 H ATOM 11230 HB3 SER A 819 -10.258 24.876 -48.085 1.00109.78 H ATOM 11231 HG SER A 819 -8.681 26.399 -48.195 1.00122.32 H ATOM 11232 N SER A 820 -10.661 27.595 -45.063 1.00 89.80 N ANISOU11232 N SER A 820 10497 14383 9239 148 2323 -545 N ATOM 11233 CA SER A 820 -10.303 28.330 -43.856 1.00 88.78 C ANISOU11233 CA SER A 820 10279 14159 9295 108 2374 -630 C ATOM 11234 C SER A 820 -11.361 28.124 -42.783 1.00 88.46 C ANISOU11234 C SER A 820 10325 14021 9263 178 2222 -666 C ATOM 11235 O SER A 820 -11.038 27.837 -41.629 1.00 86.06 O ANISOU11235 O SER A 820 9987 13649 9063 207 2133 -857 O ATOM 11236 CB SER A 820 -10.165 29.827 -44.153 1.00 89.76 C ANISOU11236 CB SER A 820 10327 14262 9517 6 2607 -443 C ATOM 11237 OG SER A 820 -11.424 30.479 -44.122 1.00 87.50 O ANISOU11237 OG SER A 820 10132 13922 9190 25 2617 -234 O ATOM 11238 H SER A 820 -10.822 28.099 -45.740 1.00107.76 H ATOM 11239 HA SER A 820 -9.454 28.004 -43.518 1.00106.54 H ATOM 11240 HB2 SER A 820 -9.587 30.228 -43.485 1.00107.72 H ATOM 11241 HB3 SER A 820 -9.776 29.937 -45.035 1.00107.72 H ATOM 11242 HG SER A 820 -11.328 31.297 -44.287 1.00105.00 H ATOM 11243 N LEU A 821 -12.626 28.277 -43.164 1.00 85.85 N ANISOU11243 N LEU A 821 10108 13685 8826 212 2190 -479 N ATOM 11244 CA LEU A 821 -13.720 28.128 -42.213 1.00 76.36 C ANISOU11244 CA LEU A 821 8991 12391 7633 282 2062 -484 C ATOM 11245 C LEU A 821 -13.829 26.682 -41.748 1.00 72.43 C ANISOU11245 C LEU A 821 8547 11867 7106 364 1855 -663 C ATOM 11246 O LEU A 821 -14.105 26.427 -40.580 1.00 71.32 O ANISOU11246 O LEU A 821 8430 11629 7039 422 1755 -763 O ATOM 11247 CB LEU A 821 -15.050 28.602 -42.810 1.00 72.10 C ANISOU11247 CB LEU A 821 8548 11853 6992 301 2070 -229 C ATOM 11248 CG LEU A 821 -16.254 28.586 -41.855 1.00 68.04 C ANISOU11248 CG LEU A 821 8116 11239 6497 376 1961 -199 C ATOM 11249 CD1 LEU A 821 -15.982 29.405 -40.601 1.00 67.10 C ANISOU11249 CD1 LEU A 821 7965 10948 6584 361 1997 -261 C ATOM 11250 CD2 LEU A 821 -17.514 29.099 -42.542 1.00 69.40 C ANISOU11250 CD2 LEU A 821 8369 11416 6583 392 1970 67 C ATOM 11251 H LEU A 821 -12.876 28.467 -43.965 1.00103.02 H ATOM 11252 HA LEU A 821 -13.534 28.676 -41.434 1.00 91.64 H ATOM 11253 HB2 LEU A 821 -14.939 29.515 -43.120 1.00 86.51 H ATOM 11254 HB3 LEU A 821 -15.269 28.030 -43.562 1.00 86.51 H ATOM 11255 HG LEU A 821 -16.420 27.671 -41.580 1.00 81.65 H ATOM 11256 HD11 LEU A 821 -16.763 29.370 -40.026 1.00 80.52 H ATOM 11257 HD12 LEU A 821 -15.215 29.032 -40.140 1.00 80.52 H ATOM 11258 HD13 LEU A 821 -15.801 30.323 -40.857 1.00 80.52 H ATOM 11259 HD21 LEU A 821 -18.250 29.073 -41.910 1.00 83.28 H ATOM 11260 HD22 LEU A 821 -17.363 30.010 -42.838 1.00 83.28 H ATOM 11261 HD23 LEU A 821 -17.712 28.531 -43.303 1.00 83.28 H ATOM 11262 N GLN A 822 -13.598 25.738 -42.657 1.00 79.59 N ANISOU11262 N GLN A 822 9470 12853 7917 372 1799 -696 N ATOM 11263 CA GLN A 822 -13.639 24.324 -42.302 1.00 75.02 C ANISOU11263 CA GLN A 822 8926 12240 7338 438 1626 -850 C ATOM 11264 C GLN A 822 -12.671 24.016 -41.162 1.00 76.56 C ANISOU11264 C GLN A 822 9056 12365 7671 462 1583 -1039 C ATOM 11265 O GLN A 822 -12.986 23.238 -40.262 1.00 76.97 O ANISOU11265 O GLN A 822 9148 12324 7773 532 1447 -1122 O ATOM 11266 CB GLN A 822 -13.302 23.449 -43.508 1.00 72.23 C ANISOU11266 CB GLN A 822 8571 11994 6881 432 1608 -877 C ATOM 11267 CG GLN A 822 -14.443 23.259 -44.483 1.00 77.14 C ANISOU11267 CG GLN A 822 9268 12681 7360 442 1567 -748 C ATOM 11268 CD GLN A 822 -14.160 22.153 -45.477 1.00 83.51 C ANISOU11268 CD GLN A 822 10072 13583 8076 452 1515 -832 C ATOM 11269 OE1 GLN A 822 -13.798 21.038 -45.097 1.00 75.85 O ANISOU11269 OE1 GLN A 822 9090 12569 7162 487 1422 -990 O ATOM 11270 NE2 GLN A 822 -14.306 22.460 -46.760 1.00 89.87 N ANISOU11270 NE2 GLN A 822 10887 14519 8742 427 1580 -723 N ATOM 11271 H GLN A 822 -13.417 25.891 -43.483 1.00 95.51 H ATOM 11272 HA GLN A 822 -14.534 24.097 -42.006 1.00 90.02 H ATOM 11273 HB2 GLN A 822 -12.567 23.858 -43.991 1.00 86.68 H ATOM 11274 HB3 GLN A 822 -13.037 22.572 -43.190 1.00 86.68 H ATOM 11275 HG2 GLN A 822 -15.246 23.026 -43.991 1.00 92.56 H ATOM 11276 HG3 GLN A 822 -14.581 24.082 -44.977 1.00 92.56 H ATOM 11277 HE21 GLN A 822 -14.551 23.252 -46.987 1.00107.85 H ATOM 11278 HE22 GLN A 822 -14.157 21.866 -47.364 1.00107.85 H ATOM 11279 N SER A 823 -11.493 24.629 -41.209 1.00 83.73 N ANISOU11279 N SER A 823 9853 13317 8643 403 1701 -1098 N ATOM 11280 CA SER A 823 -10.484 24.430 -40.176 1.00 84.62 C ANISOU11280 CA SER A 823 9881 13384 8886 420 1658 -1285 C ATOM 11281 C SER A 823 -10.815 25.249 -38.930 1.00 79.30 C ANISOU11281 C SER A 823 9202 12615 8315 436 1653 -1315 C ATOM 11282 O SER A 823 -10.482 24.854 -37.813 1.00 77.20 O ANISOU11282 O SER A 823 8920 12280 8133 494 1543 -1455 O ATOM 11283 CB SER A 823 -9.097 24.802 -40.706 1.00 85.98 C ANISOU11283 CB SER A 823 9916 13647 9107 344 1788 -1352 C ATOM 11284 OG SER A 823 -9.053 26.154 -41.127 1.00 87.04 O ANISOU11284 OG SER A 823 9991 13810 9269 251 1978 -1237 O ATOM 11285 H SER A 823 -11.252 25.169 -41.834 1.00100.48 H ATOM 11286 HA SER A 823 -10.469 23.493 -39.925 1.00101.54 H ATOM 11287 HB2 SER A 823 -8.445 24.671 -40.000 1.00103.18 H ATOM 11288 HB3 SER A 823 -8.885 24.231 -41.461 1.00103.18 H ATOM 11289 HG SER A 823 -9.233 26.661 -40.482 1.00104.44 H ATOM 11290 N GLU A 824 -11.465 26.393 -39.129 1.00 70.33 N ANISOU11290 N GLU A 824 8078 11474 7170 387 1775 -1174 N ATOM 11291 CA GLU A 824 -11.926 27.217 -38.016 1.00 69.22 C ANISOU11291 CA GLU A 824 7939 11240 7122 404 1784 -1196 C ATOM 11292 C GLU A 824 -12.927 26.450 -37.161 1.00 69.55 C ANISOU11292 C GLU A 824 8108 11185 7134 523 1606 -1199 C ATOM 11293 O GLU A 824 -12.882 26.513 -35.932 1.00 71.44 O ANISOU11293 O GLU A 824 8347 11337 7461 581 1531 -1313 O ATOM 11294 CB GLU A 824 -12.582 28.499 -38.530 1.00 73.80 C ANISOU11294 CB GLU A 824 8542 11771 7728 328 1926 -975 C ATOM 11295 CG GLU A 824 -11.624 29.645 -38.787 1.00 81.29 C ANISOU11295 CG GLU A 824 9376 12659 8852 198 2085 -957 C ATOM 11296 CD GLU A 824 -11.846 30.812 -37.840 1.00 83.46 C ANISOU11296 CD GLU A 824 9659 12707 9346 161 2098 -942 C ATOM 11297 OE1 GLU A 824 -11.946 31.961 -38.325 1.00 79.52 O ANISOU11297 OE1 GLU A 824 9148 12108 8960 69 2243 -766 O ATOM 11298 OE2 GLU A 824 -11.917 30.582 -36.611 1.00 81.58 O ANISOU11298 OE2 GLU A 824 9438 12390 9167 231 1969 -1106 O ATOM 11299 H GLU A 824 -11.653 26.715 -39.904 1.00 84.39 H ATOM 11300 HA GLU A 824 -11.169 27.461 -37.460 1.00 83.07 H ATOM 11301 HB2 GLU A 824 -13.034 28.302 -39.365 1.00 88.56 H ATOM 11302 HB3 GLU A 824 -13.229 28.800 -37.873 1.00 88.56 H ATOM 11303 HG2 GLU A 824 -10.714 29.330 -38.669 1.00 97.55 H ATOM 11304 HG3 GLU A 824 -11.750 29.966 -39.694 1.00 97.55 H ATOM 11305 N LEU A 825 -13.834 25.733 -37.821 1.00 56.43 N ANISOU11305 N LEU A 825 6547 9536 5359 555 1540 -1075 N ATOM 11306 CA LEU A 825 -14.861 24.967 -37.121 1.00 45.45 C ANISOU11306 CA LEU A 825 5263 8049 3959 651 1392 -1058 C ATOM 11307 C LEU A 825 -14.265 23.772 -36.382 1.00 48.44 C ANISOU11307 C LEU A 825 5634 8374 4398 714 1254 -1210 C ATOM 11308 O LEU A 825 -14.805 23.339 -35.364 1.00 48.69 O ANISOU11308 O LEU A 825 5723 8303 4474 796 1151 -1225 O ATOM 11309 CB LEU A 825 -15.944 24.481 -38.089 1.00 44.25 C ANISOU11309 CB LEU A 825 5190 7934 3690 652 1360 -910 C ATOM 11310 CG LEU A 825 -16.744 25.539 -38.856 1.00 47.79 C ANISOU11310 CG LEU A 825 5662 8435 4060 608 1471 -706 C ATOM 11311 CD1 LEU A 825 -17.823 24.877 -39.702 1.00 48.78 C ANISOU11311 CD1 LEU A 825 5858 8602 4075 624 1394 -595 C ATOM 11312 CD2 LEU A 825 -17.347 26.579 -37.924 1.00 50.33 C ANISOU11312 CD2 LEU A 825 6006 8673 4444 641 1521 -637 C ATOM 11313 H LEU A 825 -13.876 25.673 -38.677 1.00 67.72 H ATOM 11314 HA LEU A 825 -15.286 25.541 -36.464 1.00 54.55 H ATOM 11315 HB2 LEU A 825 -15.519 23.913 -38.751 1.00 53.10 H ATOM 11316 HB3 LEU A 825 -16.582 23.955 -37.583 1.00 53.10 H ATOM 11317 HG LEU A 825 -16.143 26.002 -39.460 1.00 57.34 H ATOM 11318 HD11 LEU A 825 -18.316 25.564 -40.178 1.00 58.54 H ATOM 11319 HD12 LEU A 825 -17.402 24.274 -40.334 1.00 58.54 H ATOM 11320 HD13 LEU A 825 -18.421 24.382 -39.120 1.00 58.54 H ATOM 11321 HD21 LEU A 825 -17.842 27.225 -38.451 1.00 60.40 H ATOM 11322 HD22 LEU A 825 -17.941 26.135 -37.299 1.00 60.40 H ATOM 11323 HD23 LEU A 825 -16.631 27.022 -37.442 1.00 60.40 H ATOM 11324 N LEU A 826 -13.158 23.236 -36.891 1.00 53.88 N ANISOU11324 N LEU A 826 6248 9133 5090 682 1260 -1304 N ATOM 11325 CA LEU A 826 -12.507 22.101 -36.242 1.00 50.71 C ANISOU11325 CA LEU A 826 5827 8694 4748 743 1143 -1427 C ATOM 11326 C LEU A 826 -11.701 22.559 -35.031 1.00 48.94 C ANISOU11326 C LEU A 826 5534 8434 4626 772 1118 -1552 C ATOM 11327 O LEU A 826 -11.750 21.930 -33.977 1.00 48.27 O ANISOU11327 O LEU A 826 5477 8274 4590 857 1003 -1595 O ATOM 11328 CB LEU A 826 -11.601 21.346 -37.220 1.00 48.67 C ANISOU11328 CB LEU A 826 5507 8528 4455 708 1160 -1484 C ATOM 11329 CG LEU A 826 -10.908 20.106 -36.635 1.00 51.96 C ANISOU11329 CG LEU A 826 5897 8914 4932 775 1053 -1594 C ATOM 11330 CD1 LEU A 826 -11.926 19.089 -36.122 1.00 52.55 C ANISOU11330 CD1 LEU A 826 6066 8887 5014 855 946 -1545 C ATOM 11331 CD2 LEU A 826 -9.984 19.454 -37.656 1.00 52.48 C ANISOU11331 CD2 LEU A 826 5898 9077 4964 741 1088 -1654 C ATOM 11332 H LEU A 826 -12.767 23.509 -37.607 1.00 64.65 H ATOM 11333 HA LEU A 826 -13.188 21.485 -35.931 1.00 60.85 H ATOM 11334 HB2 LEU A 826 -12.136 21.053 -37.974 1.00 58.40 H ATOM 11335 HB3 LEU A 826 -10.908 21.950 -37.528 1.00 58.40 H ATOM 11336 HG LEU A 826 -10.364 20.383 -35.881 1.00 62.35 H ATOM 11337 HD11 LEU A 826 -11.452 18.323 -35.762 1.00 63.06 H ATOM 11338 HD12 LEU A 826 -12.462 19.503 -35.428 1.00 63.06 H ATOM 11339 HD13 LEU A 826 -12.493 18.812 -36.858 1.00 63.06 H ATOM 11340 HD21 LEU A 826 -9.566 18.678 -37.252 1.00 62.97 H ATOM 11341 HD22 LEU A 826 -10.506 19.185 -38.428 1.00 62.97 H ATOM 11342 HD23 LEU A 826 -9.306 20.095 -37.922 1.00 62.97 H ATOM 11343 N SER A 827 -10.962 23.654 -35.195 1.00 55.79 N ANISOU11343 N SER A 827 6305 9363 5531 698 1231 -1610 N ATOM 11344 CA SER A 827 -10.164 24.232 -34.115 1.00 59.84 C ANISOU11344 CA SER A 827 6728 9856 6151 709 1213 -1760 C ATOM 11345 C SER A 827 -11.018 24.439 -32.868 1.00 60.58 C ANISOU11345 C SER A 827 6909 9835 6275 796 1126 -1746 C ATOM 11346 O SER A 827 -10.570 24.209 -31.745 1.00 57.36 O ANISOU11346 O SER A 827 6476 9392 5925 864 1021 -1853 O ATOM 11347 CB SER A 827 -9.565 25.569 -34.562 1.00 65.35 C ANISOU11347 CB SER A 827 7306 10615 6908 593 1385 -1806 C ATOM 11348 OG SER A 827 -9.511 26.496 -33.490 1.00 70.57 O ANISOU11348 OG SER A 827 7924 11213 7677 598 1388 -1914 O ATOM 11349 H SER A 827 -10.904 24.088 -35.936 1.00 66.95 H ATOM 11350 HA SER A 827 -9.437 23.629 -33.892 1.00 71.80 H ATOM 11351 HB2 SER A 827 -8.665 25.416 -34.891 1.00 78.42 H ATOM 11352 HB3 SER A 827 -10.116 25.939 -35.270 1.00 78.42 H ATOM 11353 HG SER A 827 -9.180 27.222 -33.754 1.00 84.68 H ATOM 11354 N PHE A 828 -12.258 24.864 -33.088 1.00 60.38 N ANISOU11354 N PHE A 828 6983 9760 6200 799 1170 -1603 N ATOM 11355 CA PHE A 828 -13.212 25.098 -32.010 1.00 57.07 C ANISOU11355 CA PHE A 828 6656 9229 5799 884 1106 -1564 C ATOM 11356 C PHE A 828 -13.538 23.804 -31.268 1.00 54.35 C ANISOU11356 C PHE A 828 6384 8817 5450 987 953 -1544 C ATOM 11357 O PHE A 828 -13.496 23.758 -30.038 1.00 56.13 O ANISOU11357 O PHE A 828 6624 8981 5722 1065 868 -1597 O ATOM 11358 CB PHE A 828 -14.497 25.712 -32.574 1.00 58.99 C ANISOU11358 CB PHE A 828 6982 9452 5981 868 1193 -1393 C ATOM 11359 CG PHE A 828 -15.586 25.893 -31.550 1.00 57.17 C ANISOU11359 CG PHE A 828 6852 9105 5765 962 1135 -1334 C ATOM 11360 CD1 PHE A 828 -16.508 24.883 -31.311 1.00 54.10 C ANISOU11360 CD1 PHE A 828 6560 8654 5343 1034 1033 -1237 C ATOM 11361 CD2 PHE A 828 -15.690 27.072 -30.828 1.00 59.41 C ANISOU11361 CD2 PHE A 828 7123 9337 6111 977 1192 -1385 C ATOM 11362 CE1 PHE A 828 -17.510 25.045 -30.368 1.00 58.11 C ANISOU11362 CE1 PHE A 828 7152 9057 5870 1121 990 -1172 C ATOM 11363 CE2 PHE A 828 -16.691 27.239 -29.884 1.00 60.75 C ANISOU11363 CE2 PHE A 828 7393 9397 6293 1075 1141 -1326 C ATOM 11364 CZ PHE A 828 -17.603 26.225 -29.657 1.00 60.11 C ANISOU11364 CZ PHE A 828 7408 9260 6169 1146 1042 -1210 C ATOM 11365 H PHE A 828 -12.577 25.028 -33.870 1.00 72.46 H ATOM 11366 HA PHE A 828 -12.829 25.724 -31.375 1.00 68.48 H ATOM 11367 HB2 PHE A 828 -14.290 26.584 -32.944 1.00 70.79 H ATOM 11368 HB3 PHE A 828 -14.840 25.132 -33.271 1.00 70.79 H ATOM 11369 HD1 PHE A 828 -16.450 24.087 -31.788 1.00 64.92 H ATOM 11370 HD2 PHE A 828 -15.079 27.758 -30.977 1.00 71.29 H ATOM 11371 HE1 PHE A 828 -18.122 24.361 -30.218 1.00 69.73 H ATOM 11372 HE2 PHE A 828 -16.751 28.034 -29.405 1.00 72.90 H ATOM 11373 HZ PHE A 828 -18.275 26.336 -29.024 1.00 72.13 H ATOM 11374 N ILE A 829 -13.882 22.763 -32.023 1.00 47.12 N ANISOU11374 N ILE A 829 5506 7917 4480 985 927 -1465 N ATOM 11375 CA ILE A 829 -14.197 21.453 -31.454 1.00 45.19 C ANISOU11375 CA ILE A 829 5311 7612 4248 1069 813 -1442 C ATOM 11376 C ILE A 829 -13.061 20.921 -30.586 1.00 53.82 C ANISOU11376 C ILE A 829 6334 8721 5395 1123 733 -1563 C ATOM 11377 O ILE A 829 -13.289 20.432 -29.480 1.00 55.34 O ANISOU11377 O ILE A 829 6560 8853 5615 1217 648 -1553 O ATOM 11378 CB ILE A 829 -14.478 20.420 -32.568 1.00 41.06 C ANISOU11378 CB ILE A 829 4805 7123 3675 1041 814 -1390 C ATOM 11379 CG1 ILE A 829 -15.765 20.777 -33.316 1.00 43.46 C ANISOU11379 CG1 ILE A 829 5179 7421 3913 1008 862 -1259 C ATOM 11380 CG2 ILE A 829 -14.566 18.998 -32.002 1.00 40.74 C ANISOU11380 CG2 ILE A 829 4785 7027 3669 1123 720 -1395 C ATOM 11381 CD1 ILE A 829 -17.049 20.586 -32.509 1.00 36.79 C ANISOU11381 CD1 ILE A 829 4419 6472 3086 1086 810 -1167 C ATOM 11382 H ILE A 829 -13.940 22.790 -32.880 1.00 56.54 H ATOM 11383 HA ILE A 829 -14.991 21.527 -30.902 1.00 54.23 H ATOM 11384 HB ILE A 829 -13.743 20.449 -33.200 1.00 49.28 H ATOM 11385 HG12 ILE A 829 -15.721 21.710 -33.580 1.00 52.15 H ATOM 11386 HG13 ILE A 829 -15.829 20.218 -34.106 1.00 52.15 H ATOM 11387 HG21 ILE A 829 -14.743 18.380 -32.728 1.00 48.89 H ATOM 11388 HG22 ILE A 829 -13.724 18.776 -31.575 1.00 48.89 H ATOM 11389 HG23 ILE A 829 -15.286 18.962 -31.353 1.00 48.89 H ATOM 11390 HD11 ILE A 829 -17.808 20.835 -33.060 1.00 44.14 H ATOM 11391 HD12 ILE A 829 -17.121 19.654 -32.248 1.00 44.14 H ATOM 11392 HD13 ILE A 829 -17.013 21.149 -31.720 1.00 44.14 H ATOM 11393 N LEU A 830 -11.837 21.007 -31.098 1.00 59.50 N ANISOU11393 N LEU A 830 6948 9535 6124 1068 765 -1671 N ATOM 11394 CA LEU A 830 -10.673 20.485 -30.392 1.00 54.37 C ANISOU11394 CA LEU A 830 6211 8928 5518 1119 689 -1791 C ATOM 11395 C LEU A 830 -10.431 21.237 -29.089 1.00 58.88 C ANISOU11395 C LEU A 830 6755 9482 6133 1171 635 -1871 C ATOM 11396 O LEU A 830 -10.143 20.631 -28.056 1.00 60.45 O ANISOU11396 O LEU A 830 6945 9677 6346 1269 533 -1902 O ATOM 11397 CB LEU A 830 -9.437 20.568 -31.286 1.00 55.56 C ANISOU11397 CB LEU A 830 6241 9195 5676 1040 749 -1894 C ATOM 11398 CG LEU A 830 -9.555 19.805 -32.609 1.00 55.73 C ANISOU11398 CG LEU A 830 6282 9248 5643 994 799 -1833 C ATOM 11399 CD1 LEU A 830 -8.360 20.081 -33.508 1.00 56.94 C ANISOU11399 CD1 LEU A 830 6315 9521 5798 911 881 -1926 C ATOM 11400 CD2 LEU A 830 -9.701 18.311 -32.369 1.00 48.08 C ANISOU11400 CD2 LEU A 830 5354 8237 4676 1078 713 -1807 C ATOM 11401 H LEU A 830 -11.653 21.366 -31.857 1.00 71.40 H ATOM 11402 HA LEU A 830 -10.826 19.551 -30.176 1.00 65.24 H ATOM 11403 HB2 LEU A 830 -9.270 21.500 -31.498 1.00 66.67 H ATOM 11404 HB3 LEU A 830 -8.679 20.203 -30.802 1.00 66.67 H ATOM 11405 HG LEU A 830 -10.351 20.109 -33.073 1.00 66.87 H ATOM 11406 HD11 LEU A 830 -8.466 19.584 -34.334 1.00 68.32 H ATOM 11407 HD12 LEU A 830 -8.320 21.032 -33.696 1.00 68.32 H ATOM 11408 HD13 LEU A 830 -7.552 19.799 -33.053 1.00 68.32 H ATOM 11409 HD21 LEU A 830 -9.773 17.860 -33.224 1.00 57.69 H ATOM 11410 HD22 LEU A 830 -8.921 17.991 -31.890 1.00 57.69 H ATOM 11411 HD23 LEU A 830 -10.500 18.153 -31.842 1.00 57.69 H ATOM 11412 N ASP A 831 -10.563 22.559 -29.140 1.00 71.73 N ANISOU11412 N ASP A 831 8368 11106 7781 1110 710 -1906 N ATOM 11413 CA ASP A 831 -10.409 23.389 -27.951 1.00 69.31 C ANISOU11413 CA ASP A 831 8037 10775 7521 1151 665 -2004 C ATOM 11414 C ASP A 831 -11.560 23.179 -26.965 1.00 68.77 C ANISOU11414 C ASP A 831 8099 10601 7430 1253 597 -1892 C ATOM 11415 O ASP A 831 -11.335 23.042 -25.766 1.00 77.87 O ANISOU11415 O ASP A 831 9243 11752 8592 1343 498 -1945 O ATOM 11416 CB ASP A 831 -10.335 24.876 -28.330 1.00 72.08 C ANISOU11416 CB ASP A 831 8335 11132 7922 1051 788 -2078 C ATOM 11417 CG ASP A 831 -9.087 25.225 -29.128 1.00 73.82 C ANISOU11417 CG ASP A 831 8395 11462 8192 942 872 -2212 C ATOM 11418 OD1 ASP A 831 -8.092 24.471 -29.060 1.00 77.03 O ANISOU11418 OD1 ASP A 831 8715 11946 8605 961 803 -2295 O ATOM 11419 OD2 ASP A 831 -9.101 26.269 -29.816 1.00 66.14 O ANISOU11419 OD2 ASP A 831 7372 10499 7261 836 1021 -2229 O ATOM 11420 H ASP A 831 -10.742 23.001 -29.856 1.00 86.08 H ATOM 11421 HA ASP A 831 -9.583 23.151 -27.503 1.00 83.17 H ATOM 11422 HB2 ASP A 831 -11.108 25.103 -28.869 1.00 86.50 H ATOM 11423 HB3 ASP A 831 -10.329 25.408 -27.518 1.00 86.50 H ATOM 11424 N HIS A 832 -12.789 23.134 -27.475 1.00 57.88 N ANISOU11424 N HIS A 832 6829 9148 6014 1243 650 -1737 N ATOM 11425 CA HIS A 832 -13.977 23.263 -26.626 1.00 57.63 C ANISOU11425 CA HIS A 832 6908 9013 5974 1320 619 -1635 C ATOM 11426 C HIS A 832 -14.764 21.973 -26.371 1.00 55.95 C ANISOU11426 C HIS A 832 6772 8751 5737 1399 555 -1504 C ATOM 11427 O HIS A 832 -15.713 21.979 -25.586 1.00 61.82 O ANISOU11427 O HIS A 832 7594 9417 6477 1471 527 -1419 O ATOM 11428 CB HIS A 832 -14.909 24.331 -27.208 1.00 59.91 C ANISOU11428 CB HIS A 832 7253 9256 6255 1266 730 -1562 C ATOM 11429 CG HIS A 832 -14.356 25.719 -27.120 1.00 69.92 C ANISOU11429 CG HIS A 832 8453 10540 7572 1212 804 -1693 C ATOM 11430 ND1 HIS A 832 -14.535 26.522 -26.015 1.00 75.98 N ANISOU11430 ND1 HIS A 832 9241 11244 8383 1265 779 -1762 N ATOM 11431 CD2 HIS A 832 -13.613 26.442 -27.994 1.00 70.68 C ANISOU11431 CD2 HIS A 832 8447 10710 7698 1105 912 -1780 C ATOM 11432 CE1 HIS A 832 -13.934 27.682 -26.213 1.00 76.31 C ANISOU11432 CE1 HIS A 832 9194 11306 8495 1190 866 -1904 C ATOM 11433 NE2 HIS A 832 -13.367 27.658 -27.406 1.00 68.79 N ANISOU11433 NE2 HIS A 832 8158 10438 7540 1088 956 -1913 N ATOM 11434 H HIS A 832 -12.964 23.030 -28.310 1.00 69.45 H ATOM 11435 HA HIS A 832 -13.685 23.587 -25.759 1.00 69.15 H ATOM 11436 HB2 HIS A 832 -15.067 24.132 -28.144 1.00 71.89 H ATOM 11437 HB3 HIS A 832 -15.748 24.314 -26.721 1.00 71.89 H ATOM 11438 HD1 HIS A 832 -14.972 26.304 -25.308 1.00 91.17 H ATOM 11439 HD2 HIS A 832 -13.327 26.167 -28.834 1.00 84.81 H ATOM 11440 HE1 HIS A 832 -13.913 28.393 -25.614 1.00 91.57 H ATOM 11441 HE2 HIS A 832 -12.917 28.301 -27.758 1.00 82.54 H ATOM 11442 N VAL A 833 -14.384 20.878 -27.023 1.00 61.39 N ANISOU11442 N VAL A 833 7431 9481 6415 1386 540 -1495 N ATOM 11443 CA VAL A 833 -15.024 19.584 -26.776 1.00 58.48 C ANISOU11443 CA VAL A 833 7115 9063 6041 1460 490 -1398 C ATOM 11444 C VAL A 833 -14.032 18.577 -26.206 1.00 60.23 C ANISOU11444 C VAL A 833 7276 9335 6273 1533 414 -1464 C ATOM 11445 O VAL A 833 -14.415 17.678 -25.455 1.00 60.62 O ANISOU11445 O VAL A 833 7364 9348 6323 1633 362 -1401 O ATOM 11446 CB VAL A 833 -15.656 19.001 -28.048 1.00 48.06 C ANISOU11446 CB VAL A 833 5824 7736 4701 1398 542 -1324 C ATOM 11447 CG1 VAL A 833 -16.381 17.705 -27.729 1.00 49.70 C ANISOU11447 CG1 VAL A 833 6078 7885 4921 1477 500 -1244 C ATOM 11448 CG2 VAL A 833 -16.626 20.002 -28.655 1.00 53.26 C ANISOU11448 CG2 VAL A 833 6533 8371 5331 1337 615 -1249 C ATOM 11449 H VAL A 833 -13.758 20.855 -27.613 1.00 73.67 H ATOM 11450 HA VAL A 833 -15.731 19.706 -26.123 1.00 70.17 H ATOM 11451 HB VAL A 833 -14.961 18.814 -28.698 1.00 57.67 H ATOM 11452 HG11 VAL A 833 -16.772 17.354 -28.544 1.00 59.64 H ATOM 11453 HG12 VAL A 833 -15.744 17.069 -27.367 1.00 59.64 H ATOM 11454 HG13 VAL A 833 -17.077 17.885 -27.078 1.00 59.64 H ATOM 11455 HG21 VAL A 833 -17.015 19.618 -29.456 1.00 63.91 H ATOM 11456 HG22 VAL A 833 -17.323 20.197 -28.009 1.00 63.91 H ATOM 11457 HG23 VAL A 833 -16.143 20.813 -28.877 1.00 63.91 H ATOM 11458 N PHE A 834 -12.760 18.738 -26.558 1.00 54.70 N ANISOU11458 N PHE A 834 6477 8727 5579 1489 415 -1588 N ATOM 11459 CA PHE A 834 -11.725 17.795 -26.145 1.00 61.06 C ANISOU11459 CA PHE A 834 7210 9600 6390 1559 347 -1657 C ATOM 11460 C PHE A 834 -10.687 18.399 -25.191 1.00 70.53 C ANISOU11460 C PHE A 834 8321 10885 7594 1605 280 -1789 C ATOM 11461 O PHE A 834 -9.626 18.857 -25.616 1.00 72.07 O ANISOU11461 O PHE A 834 8409 11168 7807 1542 295 -1918 O ATOM 11462 CB PHE A 834 -11.043 17.205 -27.382 1.00 61.55 C ANISOU11462 CB PHE A 834 7214 9717 6456 1486 392 -1702 C ATOM 11463 CG PHE A 834 -11.973 16.413 -28.263 1.00 58.82 C ANISOU11463 CG PHE A 834 6942 9305 6101 1457 438 -1600 C ATOM 11464 CD1 PHE A 834 -12.518 15.215 -27.825 1.00 51.77 C ANISOU11464 CD1 PHE A 834 6100 8352 5219 1546 403 -1531 C ATOM 11465 CD2 PHE A 834 -12.295 16.865 -29.532 1.00 57.88 C ANISOU11465 CD2 PHE A 834 6834 9198 5959 1346 518 -1583 C ATOM 11466 CE1 PHE A 834 -13.372 14.488 -28.635 1.00 49.06 C ANISOU11466 CE1 PHE A 834 5809 7953 4877 1517 444 -1466 C ATOM 11467 CE2 PHE A 834 -13.149 16.143 -30.345 1.00 52.78 C ANISOU11467 CE2 PHE A 834 6244 8512 5296 1324 547 -1511 C ATOM 11468 CZ PHE A 834 -13.686 14.953 -29.897 1.00 52.08 C ANISOU11468 CZ PHE A 834 6198 8358 5232 1406 508 -1463 C ATOM 11469 H PHE A 834 -12.468 19.389 -27.038 1.00 65.64 H ATOM 11470 HA PHE A 834 -12.153 17.062 -25.676 1.00 73.27 H ATOM 11471 HB2 PHE A 834 -10.676 17.930 -27.912 1.00 73.86 H ATOM 11472 HB3 PHE A 834 -10.330 16.614 -27.094 1.00 73.86 H ATOM 11473 HD1 PHE A 834 -12.310 14.899 -26.976 1.00 62.13 H ATOM 11474 HD2 PHE A 834 -11.937 17.666 -29.839 1.00 69.45 H ATOM 11475 HE1 PHE A 834 -13.733 13.687 -28.331 1.00 58.87 H ATOM 11476 HE2 PHE A 834 -13.358 16.457 -31.195 1.00 63.33 H ATOM 11477 HZ PHE A 834 -14.259 14.465 -30.444 1.00 62.50 H ATOM 11478 N ILE A 835 -11.023 18.395 -23.902 1.00122.25 N ANISOU11478 N ILE A 835 14908 17417 14123 1717 206 -1761 N ATOM 11479 CA ILE A 835 -10.091 18.728 -22.823 1.00125.16 C ANISOU11479 CA ILE A 835 15191 17885 14479 1797 114 -1888 C ATOM 11480 C ILE A 835 -10.323 17.742 -21.672 1.00125.15 C ANISOU11480 C ILE A 835 15233 17893 14427 1964 27 -1811 C ATOM 11481 O ILE A 835 -11.409 17.168 -21.569 1.00127.39 O ANISOU11481 O ILE A 835 15623 18079 14699 2003 51 -1662 O ATOM 11482 CB ILE A 835 -10.290 20.182 -22.314 1.00130.43 C ANISOU11482 CB ILE A 835 15859 18538 15159 1764 119 -1960 C ATOM 11483 CG1 ILE A 835 -10.062 21.189 -23.446 1.00132.00 C ANISOU11483 CG1 ILE A 835 16016 18731 15409 1606 223 -2033 C ATOM 11484 CG2 ILE A 835 -9.345 20.497 -21.140 1.00126.90 C ANISOU11484 CG2 ILE A 835 15313 18208 14695 1855 8 -2114 C ATOM 11485 CD1 ILE A 835 -10.240 22.651 -23.024 1.00132.52 C ANISOU11485 CD1 ILE A 835 16079 18769 15506 1566 247 -2122 C ATOM 11486 H ILE A 835 -11.811 18.197 -23.618 1.00146.69 H ATOM 11487 HA ILE A 835 -9.178 18.631 -23.138 1.00150.19 H ATOM 11488 HB ILE A 835 -11.204 20.274 -22.004 1.00156.51 H ATOM 11489 HG12 ILE A 835 -9.156 21.085 -23.778 1.00158.41 H ATOM 11490 HG13 ILE A 835 -10.695 21.007 -24.157 1.00158.41 H ATOM 11491 HG21 ILE A 835 -8.427 20.392 -21.437 1.00152.28 H ATOM 11492 HG22 ILE A 835 -9.497 21.410 -20.850 1.00152.28 H ATOM 11493 HG23 ILE A 835 -9.530 19.883 -20.413 1.00152.28 H ATOM 11494 HD11 ILE A 835 -11.145 22.778 -22.701 1.00159.03 H ATOM 11495 HD12 ILE A 835 -10.079 23.222 -23.792 1.00159.03 H ATOM 11496 HD13 ILE A 835 -9.605 22.856 -22.320 1.00159.03 H ATOM 11497 N GLU A 836 -9.303 17.558 -20.829 1.00 76.80 N ANISOU11497 N GLU A 836 9016 11896 8269 2065 -71 -1919 N ATOM 11498 CA GLU A 836 -9.322 16.663 -19.656 1.00 75.09 C ANISOU11498 CA GLU A 836 8824 11726 7979 2248 -162 -1862 C ATOM 11499 C GLU A 836 -10.439 15.611 -19.601 1.00 68.80 C ANISOU11499 C GLU A 836 8157 10818 7165 2309 -123 -1669 C ATOM 11500 O GLU A 836 -10.223 14.434 -19.904 1.00 63.37 O ANISOU11500 O GLU A 836 7470 10129 6478 2349 -111 -1625 O ATOM 11501 CB GLU A 836 -9.310 17.479 -18.358 1.00 79.83 C ANISOU11501 CB GLU A 836 9413 12393 8526 2344 -248 -1925 C ATOM 11502 CG GLU A 836 -9.139 16.631 -17.103 1.00 85.21 C ANISOU11502 CG GLU A 836 10103 13169 9103 2555 -353 -1884 C ATOM 11503 CD GLU A 836 -9.153 17.457 -15.818 1.00 93.64 C ANISOU11503 CD GLU A 836 11157 14317 10103 2661 -444 -1954 C ATOM 11504 OE1 GLU A 836 -8.810 16.896 -14.754 1.00 96.38 O ANISOU11504 OE1 GLU A 836 11489 14788 10344 2849 -545 -1953 O ATOM 11505 OE2 GLU A 836 -9.510 18.659 -15.866 1.00 91.10 O ANISOU11505 OE2 GLU A 836 10844 13940 9828 2565 -411 -2013 O ATOM 11506 N SER A 853 -24.439 21.558 -12.749 1.00 98.64 N ANISOU11506 N SER A 853 13052 13683 10744 2770 227 -430 N ATOM 11507 CA SER A 853 -23.254 20.861 -12.266 1.00 99.75 C ANISOU11507 CA SER A 853 13137 13948 10817 2846 139 -514 C ATOM 11508 C SER A 853 -22.271 20.598 -13.404 1.00103.32 C ANISOU11508 C SER A 853 13495 14423 11341 2723 129 -624 C ATOM 11509 O SER A 853 -21.828 21.527 -14.084 1.00 97.19 O ANISOU11509 O SER A 853 12666 13631 10630 2600 147 -755 O ATOM 11510 CB SER A 853 -23.647 19.538 -11.607 1.00 97.63 C ANISOU11510 CB SER A 853 12931 13705 10460 2986 134 -348 C ATOM 11511 OG SER A 853 -24.252 18.662 -12.544 1.00 90.49 O ANISOU11511 OG SER A 853 12045 12715 9622 2911 204 -229 O ATOM 11512 N LYS A 854 -21.931 19.326 -13.601 1.00 96.57 N ANISOU11512 N LYS A 854 12624 13602 10467 2759 110 -570 N ATOM 11513 CA LYS A 854 -21.043 18.926 -14.688 1.00 90.23 C ANISOU11513 CA LYS A 854 11736 12820 9726 2651 107 -662 C ATOM 11514 C LYS A 854 -21.748 18.035 -15.713 1.00 85.47 C ANISOU11514 C LYS A 854 11158 12130 9188 2583 176 -545 C ATOM 11515 O LYS A 854 -21.242 17.839 -16.820 1.00 86.84 O ANISOU11515 O LYS A 854 11269 12302 9423 2473 193 -613 O ATOM 11516 CB LYS A 854 -19.778 18.253 -14.147 1.00 86.64 C ANISOU11516 CB LYS A 854 11218 12498 9203 2745 19 -748 C ATOM 11517 CG LYS A 854 -18.652 19.225 -13.820 1.00 85.30 C ANISOU11517 CG LYS A 854 10962 12430 9019 2733 -50 -948 C ATOM 11518 CD LYS A 854 -17.508 18.513 -13.116 1.00 89.11 C ANISOU11518 CD LYS A 854 11381 13064 9413 2864 -150 -1017 C ATOM 11519 CE LYS A 854 -17.930 18.047 -11.730 1.00 90.49 C ANISOU11519 CE LYS A 854 11629 13299 9455 3072 -197 -910 C ATOM 11520 NZ LYS A 854 -17.092 16.920 -11.244 1.00 83.01 N ANISOU11520 NZ LYS A 854 10650 12478 8411 3217 -267 -902 N ATOM 11521 N ILE A 855 -22.905 17.490 -15.341 1.00 87.26 N ANISOU11521 N ILE A 855 11470 12288 9397 2649 221 -376 N ATOM 11522 CA ILE A 855 -23.795 16.881 -16.327 1.00 83.82 C ANISOU11522 CA ILE A 855 11056 11757 9037 2574 296 -276 C ATOM 11523 C ILE A 855 -24.299 18.008 -17.223 1.00 86.68 C ANISOU11523 C ILE A 855 11408 12063 9465 2455 338 -304 C ATOM 11524 O ILE A 855 -24.586 17.802 -18.402 1.00 85.40 O ANISOU11524 O ILE A 855 11222 11862 9366 2360 380 -298 O ATOM 11525 CB ILE A 855 -24.978 16.116 -15.671 1.00 87.23 C ANISOU11525 CB ILE A 855 11580 12125 9439 2665 352 -90 C ATOM 11526 CG1 ILE A 855 -24.471 14.793 -15.081 1.00 89.22 C ANISOU11526 CG1 ILE A 855 11841 12422 9637 2766 342 -55 C ATOM 11527 CG2 ILE A 855 -26.118 15.871 -16.688 1.00 84.73 C ANISOU11527 CG2 ILE A 855 11278 11702 9213 2577 434 -1 C ATOM 11528 CD1 ILE A 855 -25.551 13.810 -14.643 1.00 75.83 C ANISOU11528 CD1 ILE A 855 10224 10653 7934 2826 432 121 C ATOM 11529 HA ILE A 855 -23.292 16.257 -16.873 1.00100.59 H ATOM 11530 HB ILE A 855 -25.327 16.658 -14.946 1.00104.68 H ATOM 11531 HG12 ILE A 855 -23.927 14.348 -15.750 1.00107.07 H ATOM 11532 HG13 ILE A 855 -23.927 14.993 -14.303 1.00107.07 H ATOM 11533 HG21 ILE A 855 -26.837 15.393 -16.246 1.00101.68 H ATOM 11534 HG22 ILE A 855 -26.439 16.727 -17.013 1.00101.68 H ATOM 11535 HG23 ILE A 855 -25.774 15.344 -17.426 1.00101.68 H ATOM 11536 HD11 ILE A 855 -25.127 13.013 -14.288 1.00 90.99 H ATOM 11537 HD12 ILE A 855 -26.098 14.227 -13.959 1.00 90.99 H ATOM 11538 HD13 ILE A 855 -26.098 13.580 -15.410 1.00 90.99 H ATOM 11539 N GLU A 856 -24.398 19.204 -16.648 1.00 86.07 N ANISOU11539 N GLU A 856 11351 11988 9365 2468 329 -339 N ATOM 11540 CA GLU A 856 -24.746 20.399 -17.405 1.00 85.27 C ANISOU11540 CA GLU A 856 11243 11838 9316 2365 377 -376 C ATOM 11541 C GLU A 856 -23.757 20.636 -18.544 1.00 79.00 C ANISOU11541 C GLU A 856 10366 11087 8563 2240 380 -515 C ATOM 11542 O GLU A 856 -24.132 20.658 -19.718 1.00 67.48 O ANISOU11542 O GLU A 856 8896 9599 7146 2153 431 -489 O ATOM 11543 CB GLU A 856 -24.743 21.625 -16.488 1.00 89.71 C ANISOU11543 CB GLU A 856 11833 12403 9851 2404 367 -432 C ATOM 11544 CG GLU A 856 -25.925 21.721 -15.535 1.00 94.01 C ANISOU11544 CG GLU A 856 12470 12893 10358 2508 391 -288 C ATOM 11545 CD GLU A 856 -27.200 22.213 -16.206 1.00 92.81 C ANISOU11545 CD GLU A 856 12364 12638 10260 2460 475 -168 C ATOM 11546 OE1 GLU A 856 -27.128 22.723 -17.347 1.00 87.72 O ANISOU11546 OE1 GLU A 856 11683 11971 9674 2355 513 -211 O ATOM 11547 OE2 GLU A 856 -28.278 22.094 -15.583 1.00 89.82 O ANISOU11547 OE2 GLU A 856 12060 12209 9857 2534 509 -23 O ATOM 11548 H GLU A 856 -24.267 19.349 -15.811 1.00103.29 H ATOM 11549 HA GLU A 856 -25.634 20.298 -17.783 1.00102.32 H ATOM 11550 HB2 GLU A 856 -23.935 21.605 -15.950 1.00107.66 H ATOM 11551 HB3 GLU A 856 -24.746 22.423 -17.039 1.00107.66 H ATOM 11552 HG2 GLU A 856 -26.103 20.841 -15.166 1.00112.81 H ATOM 11553 HG3 GLU A 856 -25.705 22.340 -14.822 1.00112.81 H ATOM 11554 N ALA A 857 -22.490 20.811 -18.174 1.00 87.74 N ANISOU11554 N ALA A 857 11413 12277 9647 2240 325 -661 N ATOM 11555 CA ALA A 857 -21.420 21.150 -19.111 1.00 80.18 C ANISOU11555 CA ALA A 857 10375 11370 8719 2124 332 -805 C ATOM 11556 C ALA A 857 -21.275 20.139 -20.245 1.00 75.67 C ANISOU11556 C ALA A 857 9768 10809 8173 2062 350 -781 C ATOM 11557 O ALA A 857 -20.962 20.512 -21.377 1.00 75.00 O ANISOU11557 O ALA A 857 9645 10738 8114 1948 395 -839 O ATOM 11558 CB ALA A 857 -20.095 21.281 -18.358 1.00 82.30 C ANISOU11558 CB ALA A 857 10579 11737 8954 2162 258 -956 C ATOM 11559 H ALA A 857 -22.219 20.737 -17.361 1.00105.29 H ATOM 11560 HA ALA A 857 -21.618 22.012 -19.509 1.00 96.22 H ATOM 11561 HB1 ALA A 857 -19.394 21.506 -18.989 1.00 98.76 H ATOM 11562 HB2 ALA A 857 -20.179 21.982 -17.692 1.00 98.76 H ATOM 11563 HB3 ALA A 857 -19.894 20.436 -17.925 1.00 98.76 H ATOM 11564 N LEU A 858 -21.499 18.864 -19.941 1.00 50.41 N ANISOU11564 N LEU A 858 6586 7605 4962 2140 324 -699 N ATOM 11565 CA LEU A 858 -21.313 17.801 -20.924 1.00 47.36 C ANISOU11565 CA LEU A 858 6165 7225 4604 2091 341 -697 C ATOM 11566 C LEU A 858 -22.365 17.871 -22.027 1.00 46.33 C ANISOU11566 C LEU A 858 6060 7036 4509 2017 408 -622 C ATOM 11567 O LEU A 858 -22.035 17.765 -23.208 1.00 47.66 O ANISOU11567 O LEU A 858 6183 7234 4691 1921 435 -679 O ATOM 11568 CB LEU A 858 -21.375 16.426 -20.259 1.00 49.44 C ANISOU11568 CB LEU A 858 6449 7483 4851 2203 314 -626 C ATOM 11569 CG LEU A 858 -20.874 15.288 -21.153 1.00 46.36 C ANISOU11569 CG LEU A 858 6011 7109 4496 2161 327 -667 C ATOM 11570 CD1 LEU A 858 -19.354 15.354 -21.282 1.00 48.91 C ANISOU11570 CD1 LEU A 858 6251 7528 4803 2132 283 -812 C ATOM 11571 CD2 LEU A 858 -21.327 13.924 -20.638 1.00 40.77 C ANISOU11571 CD2 LEU A 858 5342 6356 3793 2262 338 -568 C ATOM 11572 H LEU A 858 -21.760 18.587 -19.170 1.00 60.49 H ATOM 11573 HA LEU A 858 -20.440 17.899 -21.334 1.00 56.83 H ATOM 11574 HB2 LEU A 858 -20.826 16.439 -19.459 1.00 59.32 H ATOM 11575 HB3 LEU A 858 -22.296 16.234 -20.023 1.00 59.32 H ATOM 11576 HG LEU A 858 -21.248 15.404 -22.040 1.00 55.63 H ATOM 11577 HD11 LEU A 858 -19.054 14.628 -21.850 1.00 58.69 H ATOM 11578 HD12 LEU A 858 -19.108 16.206 -21.676 1.00 58.69 H ATOM 11579 HD13 LEU A 858 -18.959 15.271 -20.400 1.00 58.69 H ATOM 11580 HD21 LEU A 858 -20.989 13.235 -21.231 1.00 48.92 H ATOM 11581 HD22 LEU A 858 -20.977 13.792 -19.743 1.00 48.92 H ATOM 11582 HD23 LEU A 858 -22.297 13.900 -20.621 1.00 48.92 H ATOM 11583 N HIS A 859 -23.626 18.042 -21.631 1.00 57.12 N ANISOU11583 N HIS A 859 7496 8329 5878 2071 434 -493 N ATOM 11584 CA HIS A 859 -24.740 18.098 -22.578 1.00 55.01 C ANISOU11584 CA HIS A 859 7250 8014 5635 2027 493 -407 C ATOM 11585 C HIS A 859 -24.485 19.147 -23.655 1.00 49.72 C ANISOU11585 C HIS A 859 6548 7384 4957 1915 530 -473 C ATOM 11586 O HIS A 859 -24.823 18.950 -24.823 1.00 50.94 O ANISOU11586 O HIS A 859 6685 7561 5111 1851 565 -461 O ATOM 11587 CB HIS A 859 -26.058 18.411 -21.855 1.00 57.64 C ANISOU11587 CB HIS A 859 7662 8268 5972 2107 519 -259 C ATOM 11588 CG HIS A 859 -27.256 18.432 -22.758 1.00 59.33 C ANISOU11588 CG HIS A 859 7893 8440 6210 2082 578 -160 C ATOM 11589 ND1 HIS A 859 -27.891 19.599 -23.129 1.00 54.20 N ANISOU11589 ND1 HIS A 859 7266 7772 5555 2057 621 -110 N ATOM 11590 CD2 HIS A 859 -27.936 17.427 -23.361 1.00 62.64 C ANISOU11590 CD2 HIS A 859 8303 8836 6660 2086 604 -105 C ATOM 11591 CE1 HIS A 859 -28.908 19.312 -23.922 1.00 58.96 C ANISOU11591 CE1 HIS A 859 7872 8356 6174 2053 665 -18 C ATOM 11592 NE2 HIS A 859 -28.959 18.002 -24.078 1.00 68.01 N ANISOU11592 NE2 HIS A 859 8995 9500 7345 2068 654 -23 N ATOM 11593 H HIS A 859 -23.865 18.128 -20.809 1.00 68.54 H ATOM 11594 HA HIS A 859 -24.832 17.236 -23.012 1.00 66.01 H ATOM 11595 HB2 HIS A 859 -26.210 17.734 -21.177 1.00 69.17 H ATOM 11596 HB3 HIS A 859 -25.986 19.283 -21.438 1.00 69.17 H ATOM 11597 HD1 HIS A 859 -27.660 20.390 -22.883 1.00 65.04 H ATOM 11598 HD2 HIS A 859 -27.747 16.519 -23.300 1.00 75.16 H ATOM 11599 HE1 HIS A 859 -29.490 19.929 -24.304 1.00 70.75 H ATOM 11600 HE2 HIS A 859 -29.537 17.577 -24.553 1.00 81.61 H ATOM 11601 N LYS A 860 -23.889 20.263 -23.251 1.00 46.66 N ANISOU11601 N LYS A 860 6157 7016 4558 1895 528 -546 N ATOM 11602 CA LYS A 860 -23.536 21.328 -24.180 1.00 51.85 C ANISOU11602 CA LYS A 860 6786 7710 5203 1792 580 -609 C ATOM 11603 C LYS A 860 -22.502 20.842 -25.195 1.00 55.98 C ANISOU11603 C LYS A 860 7237 8317 5715 1699 580 -712 C ATOM 11604 O LYS A 860 -22.592 21.148 -26.384 1.00 55.02 O ANISOU11604 O LYS A 860 7099 8238 5569 1615 632 -707 O ATOM 11605 CB LYS A 860 -22.997 22.535 -23.406 1.00 52.05 C ANISOU11605 CB LYS A 860 6815 7730 5231 1797 585 -693 C ATOM 11606 CG LYS A 860 -22.310 23.591 -24.253 1.00 52.18 C ANISOU11606 CG LYS A 860 6791 7792 5243 1694 650 -790 C ATOM 11607 CD LYS A 860 -21.721 24.682 -23.374 1.00 62.98 C ANISOU11607 CD LYS A 860 8154 9145 6630 1709 653 -905 C ATOM 11608 CE LYS A 860 -20.343 24.293 -22.835 1.00 70.42 C ANISOU11608 CE LYS A 860 9026 10156 7575 1708 579 -1057 C ATOM 11609 NZ LYS A 860 -19.702 25.394 -22.060 1.00 75.67 N ANISOU11609 NZ LYS A 860 9670 10821 8261 1715 578 -1201 N ATOM 11610 H LYS A 860 -23.677 20.429 -22.434 1.00 56.00 H ATOM 11611 HA LYS A 860 -24.329 21.607 -24.664 1.00 62.22 H ATOM 11612 HB2 LYS A 860 -23.738 22.964 -22.949 1.00 62.46 H ATOM 11613 HB3 LYS A 860 -22.353 22.219 -22.753 1.00 62.46 H ATOM 11614 HG2 LYS A 860 -21.590 23.182 -24.758 1.00 62.62 H ATOM 11615 HG3 LYS A 860 -22.957 23.995 -24.853 1.00 62.62 H ATOM 11616 HD2 LYS A 860 -21.624 25.495 -23.895 1.00 75.58 H ATOM 11617 HD3 LYS A 860 -22.310 24.837 -22.619 1.00 75.58 H ATOM 11618 HE2 LYS A 860 -20.437 23.527 -22.247 1.00 84.50 H ATOM 11619 HE3 LYS A 860 -19.762 24.071 -23.579 1.00 84.50 H ATOM 11620 HZ1 LYS A 860 -18.905 25.132 -21.763 1.00 90.81 H ATOM 11621 HZ2 LYS A 860 -19.596 26.109 -22.578 1.00 90.81 H ATOM 11622 HZ3 LYS A 860 -20.212 25.613 -21.364 1.00 90.81 H ATOM 11623 N ARG A 861 -21.520 20.083 -24.717 1.00 53.19 N ANISOU11623 N ARG A 861 6842 7996 5371 1722 522 -795 N ATOM 11624 CA ARG A 861 -20.418 19.636 -25.562 1.00 44.04 C ANISOU11624 CA ARG A 861 5612 6914 4207 1645 522 -899 C ATOM 11625 C ARG A 861 -20.829 18.533 -26.534 1.00 41.22 C ANISOU11625 C ARG A 861 5248 6565 3848 1619 533 -859 C ATOM 11626 O ARG A 861 -20.405 18.545 -27.691 1.00 46.72 O ANISOU11626 O ARG A 861 5906 7325 4522 1527 566 -910 O ATOM 11627 CB ARG A 861 -19.220 19.203 -24.711 1.00 40.89 C ANISOU11627 CB ARG A 861 5166 6556 3817 1695 456 -996 C ATOM 11628 CG ARG A 861 -18.441 20.388 -24.134 1.00 46.70 C ANISOU11628 CG ARG A 861 5872 7323 4548 1683 450 -1100 C ATOM 11629 CD ARG A 861 -17.108 19.976 -23.509 1.00 52.74 C ANISOU11629 CD ARG A 861 6564 8164 5311 1724 380 -1216 C ATOM 11630 NE ARG A 861 -17.268 18.947 -22.485 1.00 58.17 N ANISOU11630 NE ARG A 861 7275 8843 5982 1853 310 -1157 N ATOM 11631 CZ ARG A 861 -17.403 19.179 -21.182 1.00 54.46 C ANISOU11631 CZ ARG A 861 6834 8373 5486 1959 256 -1144 C ATOM 11632 NH1 ARG A 861 -17.402 20.419 -20.699 1.00 55.18 N ANISOU11632 NH1 ARG A 861 6932 8461 5574 1948 260 -1203 N ATOM 11633 NH2 ARG A 861 -17.544 18.153 -20.355 1.00 48.16 N ANISOU11633 NH2 ARG A 861 6061 7581 4658 2082 205 -1075 N ATOM 11634 H ARG A 861 -21.470 19.811 -23.903 1.00 63.82 H ATOM 11635 HA ARG A 861 -20.127 20.391 -26.098 1.00 52.85 H ATOM 11636 HB2 ARG A 861 -19.537 18.664 -23.970 1.00 49.07 H ATOM 11637 HB3 ARG A 861 -18.612 18.685 -25.262 1.00 49.07 H ATOM 11638 HG2 ARG A 861 -18.255 21.020 -24.846 1.00 56.04 H ATOM 11639 HG3 ARG A 861 -18.976 20.813 -23.445 1.00 56.04 H ATOM 11640 HD2 ARG A 861 -16.528 19.624 -24.202 1.00 63.29 H ATOM 11641 HD3 ARG A 861 -16.699 20.752 -23.094 1.00 63.29 H ATOM 11642 HE ARG A 861 -17.276 18.128 -22.745 1.00 69.80 H ATOM 11643 HH11 ARG A 861 -17.312 21.087 -21.232 1.00 66.22 H ATOM 11644 HH12 ARG A 861 -17.491 20.551 -19.854 1.00 66.22 H ATOM 11645 HH21 ARG A 861 -17.545 17.350 -20.662 1.00 57.80 H ATOM 11646 HH22 ARG A 861 -17.631 18.291 -19.510 1.00 57.80 H ATOM 11647 N ARG A 862 -21.649 17.587 -26.081 1.00 29.02 N ANISOU11647 N ARG A 862 3740 4961 2325 1702 512 -775 N ATOM 11648 CA ARG A 862 -22.146 16.547 -26.979 1.00 28.86 C ANISOU11648 CA ARG A 862 3711 4941 2312 1683 529 -756 C ATOM 11649 C ARG A 862 -22.925 17.206 -28.113 1.00 33.51 C ANISOU11649 C ARG A 862 4310 5562 2861 1609 578 -714 C ATOM 11650 O ARG A 862 -22.833 16.797 -29.272 1.00 36.27 O ANISOU11650 O ARG A 862 4626 5973 3181 1539 595 -757 O ATOM 11651 CB ARG A 862 -23.052 15.551 -26.253 1.00 28.60 C ANISOU11651 CB ARG A 862 3721 4828 2319 1790 519 -664 C ATOM 11652 CG ARG A 862 -22.498 15.007 -24.958 1.00 34.51 C ANISOU11652 CG ARG A 862 4478 5551 3083 1888 476 -661 C ATOM 11653 CD ARG A 862 -23.345 13.853 -24.453 1.00 35.94 C ANISOU11653 CD ARG A 862 4698 5654 3304 1981 491 -567 C ATOM 11654 NE ARG A 862 -22.979 12.591 -25.095 1.00 30.48 N ANISOU11654 NE ARG A 862 3965 4964 2650 1966 507 -631 N ATOM 11655 CZ ARG A 862 -23.830 11.746 -25.677 1.00 35.15 C ANISOU11655 CZ ARG A 862 4559 5505 3293 1967 552 -607 C ATOM 11656 NH1 ARG A 862 -25.133 11.996 -25.724 1.00 30.54 N ANISOU11656 NH1 ARG A 862 4011 4868 2724 1985 584 -509 N ATOM 11657 NH2 ARG A 862 -23.371 10.632 -26.223 1.00 40.32 N ANISOU11657 NH2 ARG A 862 5172 6158 3990 1954 570 -689 N ATOM 11658 H ARG A 862 -21.929 17.525 -25.270 1.00 34.82 H ATOM 11659 HA ARG A 862 -21.397 16.062 -27.360 1.00 34.63 H ATOM 11660 HB2 ARG A 862 -23.892 15.990 -26.049 1.00 34.32 H ATOM 11661 HB3 ARG A 862 -23.213 14.796 -26.840 1.00 34.32 H ATOM 11662 HG2 ARG A 862 -21.595 14.684 -25.104 1.00 41.41 H ATOM 11663 HG3 ARG A 862 -22.503 15.707 -24.286 1.00 41.41 H ATOM 11664 HD2 ARG A 862 -23.215 13.756 -23.497 1.00 43.13 H ATOM 11665 HD3 ARG A 862 -24.278 14.033 -24.648 1.00 43.13 H ATOM 11666 HE ARG A 862 -22.147 12.376 -25.097 1.00 36.57 H ATOM 11667 HH11 ARG A 862 -25.445 12.717 -25.373 1.00 36.64 H ATOM 11668 HH12 ARG A 862 -25.664 11.438 -26.105 1.00 36.64 H ATOM 11669 HH21 ARG A 862 -22.529 10.457 -26.200 1.00 48.38 H ATOM 11670 HH22 ARG A 862 -23.914 10.083 -26.601 1.00 48.38 H ATOM 11671 N ASN A 863 -23.684 18.240 -27.766 1.00 42.46 N ANISOU11671 N ASN A 863 5489 6662 3983 1630 601 -628 N ATOM 11672 CA ASN A 863 -24.509 18.946 -28.735 1.00 41.17 C ANISOU11672 CA ASN A 863 5339 6535 3771 1580 651 -557 C ATOM 11673 C ASN A 863 -23.642 19.601 -29.803 1.00 46.12 C ANISOU11673 C ASN A 863 5922 7262 4340 1464 685 -631 C ATOM 11674 O ASN A 863 -23.965 19.555 -30.991 1.00 46.81 O ANISOU11674 O ASN A 863 5992 7427 4366 1401 710 -608 O ATOM 11675 CB ASN A 863 -25.365 20.001 -28.030 1.00 37.42 C ANISOU11675 CB ASN A 863 4924 5993 3303 1639 678 -447 C ATOM 11676 CG ASN A 863 -26.381 20.643 -28.954 1.00 37.08 C ANISOU11676 CG ASN A 863 4898 5984 3208 1612 734 -334 C ATOM 11677 OD1 ASN A 863 -27.240 19.966 -29.516 1.00 44.14 O ANISOU11677 OD1 ASN A 863 5787 6896 4087 1627 733 -274 O ATOM 11678 ND2 ASN A 863 -26.298 21.961 -29.100 1.00 40.02 N ANISOU11678 ND2 ASN A 863 5286 6369 3553 1579 789 -301 N ATOM 11679 H ASN A 863 -23.738 18.555 -26.968 1.00 50.96 H ATOM 11680 HA ASN A 863 -25.103 18.314 -29.170 1.00 49.41 H ATOM 11681 HB2 ASN A 863 -25.847 19.581 -27.300 1.00 44.91 H ATOM 11682 HB3 ASN A 863 -24.787 20.700 -27.688 1.00 44.91 H ATOM 11683 HD21 ASN A 863 -26.852 22.372 -29.614 1.00 48.03 H ATOM 11684 HD22 ASN A 863 -25.691 22.403 -28.682 1.00 48.03 H ATOM 11685 N LEU A 864 -22.539 20.206 -29.369 1.00 45.49 N ANISOU11685 N LEU A 864 5819 7191 4275 1439 688 -717 N ATOM 11686 CA LEU A 864 -21.592 20.840 -30.284 1.00 45.96 C ANISOU11686 CA LEU A 864 5830 7343 4290 1335 736 -790 C ATOM 11687 C LEU A 864 -20.922 19.809 -31.183 1.00 47.97 C ANISOU11687 C LEU A 864 6033 7668 4527 1280 718 -866 C ATOM 11688 O LEU A 864 -20.715 20.052 -32.373 1.00 47.00 O ANISOU11688 O LEU A 864 5882 7636 4339 1196 763 -870 O ATOM 11689 CB LEU A 864 -20.514 21.599 -29.507 1.00 48.16 C ANISOU11689 CB LEU A 864 6082 7613 4605 1334 742 -890 C ATOM 11690 CG LEU A 864 -20.986 22.809 -28.698 1.00 47.09 C ANISOU11690 CG LEU A 864 5990 7414 4486 1377 776 -851 C ATOM 11691 CD1 LEU A 864 -20.055 23.077 -27.531 1.00 46.53 C ANISOU11691 CD1 LEU A 864 5895 7318 4464 1415 734 -971 C ATOM 11692 CD2 LEU A 864 -21.083 24.048 -29.572 1.00 49.05 C ANISOU11692 CD2 LEU A 864 6232 7714 4689 1308 885 -811 C ATOM 11693 H LEU A 864 -22.314 20.265 -28.541 1.00 54.59 H ATOM 11694 HA LEU A 864 -22.065 21.473 -30.846 1.00 55.15 H ATOM 11695 HB2 LEU A 864 -20.096 20.982 -28.885 1.00 57.80 H ATOM 11696 HB3 LEU A 864 -19.850 21.916 -30.139 1.00 57.80 H ATOM 11697 HG LEU A 864 -21.869 22.625 -28.341 1.00 56.50 H ATOM 11698 HD11 LEU A 864 -20.380 23.848 -27.039 1.00 55.83 H ATOM 11699 HD12 LEU A 864 -20.041 22.298 -26.953 1.00 55.83 H ATOM 11700 HD13 LEU A 864 -19.164 23.253 -27.871 1.00 55.83 H ATOM 11701 HD21 LEU A 864 -21.384 24.793 -29.030 1.00 58.86 H ATOM 11702 HD22 LEU A 864 -20.209 24.240 -29.944 1.00 58.86 H ATOM 11703 HD23 LEU A 864 -21.718 23.880 -30.286 1.00 58.86 H ATOM 11704 N LEU A 865 -20.581 18.656 -30.616 1.00 38.21 N ANISOU11704 N LEU A 865 4784 6392 3342 1335 660 -918 N ATOM 11705 CA LEU A 865 -19.886 17.628 -31.378 1.00 33.05 C ANISOU11705 CA LEU A 865 4083 5792 2682 1297 648 -999 C ATOM 11706 C LEU A 865 -20.792 17.081 -32.470 1.00 37.46 C ANISOU11706 C LEU A 865 4650 6389 3192 1266 659 -960 C ATOM 11707 O LEU A 865 -20.366 16.910 -33.611 1.00 50.03 O ANISOU11707 O LEU A 865 6208 8071 4731 1191 679 -1010 O ATOM 11708 CB LEU A 865 -19.426 16.492 -30.466 1.00 32.78 C ANISOU11708 CB LEU A 865 4037 5702 2714 1379 593 -1043 C ATOM 11709 CG LEU A 865 -18.468 15.476 -31.096 1.00 31.48 C ANISOU11709 CG LEU A 865 3818 5586 2556 1353 587 -1141 C ATOM 11710 CD1 LEU A 865 -17.178 16.153 -31.533 1.00 33.86 C ANISOU11710 CD1 LEU A 865 4061 5971 2834 1282 610 -1224 C ATOM 11711 CD2 LEU A 865 -18.166 14.335 -30.128 1.00 31.03 C ANISOU11711 CD2 LEU A 865 3757 5470 2561 1453 543 -1158 C ATOM 11712 H LEU A 865 -20.740 18.447 -29.797 1.00 45.85 H ATOM 11713 HA LEU A 865 -19.103 18.016 -31.799 1.00 39.66 H ATOM 11714 HB2 LEU A 865 -18.973 16.879 -29.700 1.00 39.33 H ATOM 11715 HB3 LEU A 865 -20.209 16.005 -30.166 1.00 39.33 H ATOM 11716 HG LEU A 865 -18.887 15.096 -31.884 1.00 37.77 H ATOM 11717 HD11 LEU A 865 -16.591 15.488 -31.928 1.00 40.63 H ATOM 11718 HD12 LEU A 865 -17.387 16.839 -32.185 1.00 40.63 H ATOM 11719 HD13 LEU A 865 -16.752 16.551 -30.757 1.00 40.63 H ATOM 11720 HD21 LEU A 865 -17.559 13.711 -30.555 1.00 37.23 H ATOM 11721 HD22 LEU A 865 -17.756 14.700 -29.328 1.00 37.23 H ATOM 11722 HD23 LEU A 865 -18.996 13.887 -29.900 1.00 37.23 H ATOM 11723 N ALA A 866 -22.045 16.811 -32.119 1.00 34.05 N ANISOU11723 N ALA A 866 4262 5901 2775 1329 645 -875 N ATOM 11724 CA ALA A 866 -22.996 16.288 -33.091 1.00 34.21 C ANISOU11724 CA ALA A 866 4282 5970 2746 1310 648 -850 C ATOM 11725 C ALA A 866 -23.265 17.315 -34.184 1.00 35.67 C ANISOU11725 C ALA A 866 4462 6263 2826 1226 686 -795 C ATOM 11726 O ALA A 866 -23.530 16.955 -35.329 1.00 41.75 O ANISOU11726 O ALA A 866 5208 7130 3523 1174 683 -814 O ATOM 11727 CB ALA A 866 -24.288 15.889 -32.414 1.00 40.49 C ANISOU11727 CB ALA A 866 5116 6684 3583 1407 637 -764 C ATOM 11728 H ALA A 866 -22.368 16.921 -31.330 1.00 40.86 H ATOM 11729 HA ALA A 866 -22.619 15.498 -33.508 1.00 41.05 H ATOM 11730 HB1 ALA A 866 -24.902 15.545 -33.082 1.00 48.58 H ATOM 11731 HB2 ALA A 866 -24.100 15.203 -31.754 1.00 48.58 H ATOM 11732 HB3 ALA A 866 -24.672 16.668 -31.982 1.00 48.58 H ATOM 11733 N ALA A 867 -23.187 18.594 -33.829 1.00 45.20 N ANISOU11733 N ALA A 867 5692 7460 4023 1216 723 -727 N ATOM 11734 CA ALA A 867 -23.362 19.665 -34.802 1.00 45.22 C ANISOU11734 CA ALA A 867 5691 7561 3929 1142 778 -650 C ATOM 11735 C ALA A 867 -22.288 19.584 -35.881 1.00 49.57 C ANISOU11735 C ALA A 867 6191 8221 4423 1048 802 -734 C ATOM 11736 O ALA A 867 -22.558 19.844 -37.053 1.00 52.89 O ANISOU11736 O ALA A 867 6598 8755 4743 988 826 -682 O ATOM 11737 CB ALA A 867 -23.322 21.012 -34.119 1.00 44.42 C ANISOU11737 CB ALA A 867 5619 7412 3847 1156 832 -579 C ATOM 11738 H ALA A 867 -23.034 18.868 -33.028 1.00 54.24 H ATOM 11739 HA ALA A 867 -24.227 19.569 -35.229 1.00 54.26 H ATOM 11740 HB1 ALA A 867 -23.440 21.707 -34.785 1.00 53.31 H ATOM 11741 HB2 ALA A 867 -24.037 21.056 -33.465 1.00 53.31 H ATOM 11742 HB3 ALA A 867 -22.464 21.117 -33.679 1.00 53.31 H ATOM 11743 N PHE A 868 -21.071 19.220 -35.479 1.00 52.05 N ANISOU11743 N PHE A 868 6473 8507 4796 1044 796 -853 N ATOM 11744 CA PHE A 868 -19.957 19.095 -36.416 1.00 46.92 C ANISOU11744 CA PHE A 868 5770 7952 4104 969 826 -935 C ATOM 11745 C PHE A 868 -19.996 17.775 -37.178 1.00 48.06 C ANISOU11745 C PHE A 868 5895 8140 4227 963 782 -1007 C ATOM 11746 O PHE A 868 -19.663 17.725 -38.359 1.00 57.77 O ANISOU11746 O PHE A 868 7095 9481 5375 900 807 -1029 O ATOM 11747 CB PHE A 868 -18.619 19.218 -35.682 1.00 50.61 C ANISOU11747 CB PHE A 868 6199 8384 4646 976 835 -1036 C ATOM 11748 CG PHE A 868 -17.430 19.302 -36.601 1.00 56.96 C ANISOU11748 CG PHE A 868 6939 9291 5411 903 886 -1108 C ATOM 11749 CD1 PHE A 868 -17.106 20.496 -37.229 1.00 55.12 C ANISOU11749 CD1 PHE A 868 6682 9141 5119 834 981 -1062 C ATOM 11750 CD2 PHE A 868 -16.641 18.189 -36.842 1.00 57.62 C ANISOU11750 CD2 PHE A 868 6984 9391 5519 910 852 -1213 C ATOM 11751 CE1 PHE A 868 -16.018 20.578 -38.078 1.00 55.70 C ANISOU11751 CE1 PHE A 868 6692 9315 5158 772 1042 -1120 C ATOM 11752 CE2 PHE A 868 -15.548 18.266 -37.688 1.00 57.27 C ANISOU11752 CE2 PHE A 868 6877 9445 5437 851 904 -1276 C ATOM 11753 CZ PHE A 868 -15.236 19.462 -38.305 1.00 64.26 C ANISOU11753 CZ PHE A 868 7737 10415 6262 782 999 -1230 C ATOM 11754 H PHE A 868 -20.865 19.040 -34.664 1.00 62.46 H ATOM 11755 HA PHE A 868 -20.009 19.815 -37.064 1.00 56.30 H ATOM 11756 HB2 PHE A 868 -18.632 20.022 -35.140 1.00 60.73 H ATOM 11757 HB3 PHE A 868 -18.501 18.440 -35.114 1.00 60.73 H ATOM 11758 HD1 PHE A 868 -17.628 21.251 -37.078 1.00 66.14 H ATOM 11759 HD2 PHE A 868 -16.846 17.382 -36.428 1.00 69.15 H ATOM 11760 HE1 PHE A 868 -15.809 21.385 -38.491 1.00 66.84 H ATOM 11761 HE2 PHE A 868 -15.024 17.513 -37.842 1.00 68.72 H ATOM 11762 HZ PHE A 868 -14.504 19.515 -38.875 1.00 77.11 H ATOM 11763 N CYS A 869 -20.398 16.707 -36.500 1.00 37.30 N ANISOU11763 N CYS A 869 4546 6691 2937 1033 724 -1045 N ATOM 11764 CA CYS A 869 -20.426 15.388 -37.117 1.00 34.15 C ANISOU11764 CA CYS A 869 4122 6317 2535 1036 692 -1133 C ATOM 11765 C CYS A 869 -21.511 15.287 -38.183 1.00 42.93 C ANISOU11765 C CYS A 869 5238 7525 3549 1005 681 -1099 C ATOM 11766 O CYS A 869 -21.387 14.506 -39.126 1.00 52.88 O ANISOU11766 O CYS A 869 6467 8860 4763 975 667 -1185 O ATOM 11767 CB CYS A 869 -20.601 14.312 -36.046 1.00 36.40 C ANISOU11767 CB CYS A 869 4419 6479 2931 1128 653 -1169 C ATOM 11768 SG CYS A 869 -19.116 14.093 -35.018 1.00 39.22 S ANISOU11768 SG CYS A 869 4751 6770 3380 1167 648 -1235 S ATOM 11769 H CYS A 869 -20.660 16.720 -35.681 1.00 44.76 H ATOM 11770 HA CYS A 869 -19.573 15.232 -37.552 1.00 40.97 H ATOM 11771 HB2 CYS A 869 -21.334 14.563 -35.463 1.00 43.67 H ATOM 11772 HB3 CYS A 869 -20.794 13.465 -36.477 1.00 43.67 H ATOM 11773 HG CYS A 869 -18.198 13.772 -35.722 1.00 47.06 H ATOM 11774 N LYS A 870 -22.564 16.086 -38.051 1.00 45.39 N ANISOU11774 N LYS A 870 5582 7842 3821 1016 684 -976 N ATOM 11775 CA LYS A 870 -23.600 16.123 -39.077 1.00 40.51 C ANISOU11775 CA LYS A 870 4958 7340 3092 988 666 -928 C ATOM 11776 C LYS A 870 -23.012 16.700 -40.358 1.00 46.25 C ANISOU11776 C LYS A 870 5660 8212 3700 901 699 -918 C ATOM 11777 O LYS A 870 -23.343 16.251 -41.457 1.00 48.83 O ANISOU11777 O LYS A 870 5961 8661 3932 870 671 -956 O ATOM 11778 CB LYS A 870 -24.807 16.941 -38.618 1.00 33.84 C ANISOU11778 CB LYS A 870 4150 6474 2232 1028 668 -773 C ATOM 11779 CG LYS A 870 -25.700 16.201 -37.627 1.00 40.28 C ANISOU11779 CG LYS A 870 4985 7180 3138 1126 636 -774 C ATOM 11780 CD LYS A 870 -26.864 17.055 -37.135 1.00 35.62 C ANISOU11780 CD LYS A 870 4433 6564 2537 1179 649 -605 C ATOM 11781 CE LYS A 870 -26.383 18.275 -36.367 1.00 36.42 C ANISOU11781 CE LYS A 870 4575 6586 2678 1183 699 -515 C ATOM 11782 NZ LYS A 870 -26.839 18.289 -34.952 1.00 40.70 N ANISOU11782 NZ LYS A 870 5160 6976 3326 1289 702 -464 N ATOM 11783 H LYS A 870 -22.702 16.612 -37.385 1.00 54.47 H ATOM 11784 HA LYS A 870 -23.899 15.218 -39.260 1.00 48.61 H ATOM 11785 HB2 LYS A 870 -24.491 17.751 -38.188 1.00 40.61 H ATOM 11786 HB3 LYS A 870 -25.345 17.168 -39.393 1.00 40.61 H ATOM 11787 HG2 LYS A 870 -26.067 15.413 -38.058 1.00 48.33 H ATOM 11788 HG3 LYS A 870 -25.171 15.942 -36.856 1.00 48.33 H ATOM 11789 HD2 LYS A 870 -27.380 17.361 -37.897 1.00 42.74 H ATOM 11790 HD3 LYS A 870 -27.421 16.525 -36.544 1.00 42.74 H ATOM 11791 HE2 LYS A 870 -25.413 18.286 -36.368 1.00 43.71 H ATOM 11792 HE3 LYS A 870 -26.724 19.074 -36.799 1.00 43.71 H ATOM 11793 HZ1 LYS A 870 -26.536 19.019 -34.543 1.00 48.84 H ATOM 11794 HZ2 LYS A 870 -27.728 18.288 -34.920 1.00 48.84 H ATOM 11795 HZ3 LYS A 870 -26.533 17.570 -34.527 1.00 48.84 H ATOM 11796 N LEU A 871 -22.128 17.684 -40.213 1.00 53.70 N ANISOU11796 N LEU A 871 6607 9149 4648 868 764 -875 N ATOM 11797 CA LEU A 871 -21.452 18.269 -41.365 1.00 50.66 C ANISOU11797 CA LEU A 871 6197 8894 4158 795 820 -855 C ATOM 11798 C LEU A 871 -20.599 17.210 -42.054 1.00 54.08 C ANISOU11798 C LEU A 871 6589 9380 4580 775 804 -1007 C ATOM 11799 O LEU A 871 -20.424 17.242 -43.271 1.00 65.76 O ANISOU11799 O LEU A 871 8047 10996 5944 730 823 -1009 O ATOM 11800 CB LEU A 871 -20.582 19.459 -40.950 1.00 49.15 C ANISOU11800 CB LEU A 871 6004 8674 3996 769 908 -803 C ATOM 11801 CG LEU A 871 -21.300 20.594 -40.213 1.00 44.97 C ANISOU11801 CG LEU A 871 5515 8083 3490 791 941 -659 C ATOM 11802 CD1 LEU A 871 -20.344 21.734 -39.886 1.00 44.12 C ANISOU11802 CD1 LEU A 871 5389 7960 3414 758 1043 -639 C ATOM 11803 CD2 LEU A 871 -22.471 21.100 -41.036 1.00 42.71 C ANISOU11803 CD2 LEU A 871 5248 7888 3093 780 940 -500 C ATOM 11804 H LEU A 871 -21.903 18.030 -39.459 1.00 64.44 H ATOM 11805 HA LEU A 871 -22.115 18.584 -41.999 1.00 60.80 H ATOM 11806 HB2 LEU A 871 -19.880 19.134 -40.365 1.00 58.98 H ATOM 11807 HB3 LEU A 871 -20.184 19.840 -41.749 1.00 58.98 H ATOM 11808 HG LEU A 871 -21.651 20.252 -39.376 1.00 53.97 H ATOM 11809 HD11 LEU A 871 -20.833 22.432 -39.422 1.00 52.94 H ATOM 11810 HD12 LEU A 871 -19.632 21.396 -39.321 1.00 52.94 H ATOM 11811 HD13 LEU A 871 -19.974 22.083 -40.712 1.00 52.94 H ATOM 11812 HD21 LEU A 871 -22.911 21.816 -40.552 1.00 51.26 H ATOM 11813 HD22 LEU A 871 -22.140 21.428 -41.886 1.00 51.26 H ATOM 11814 HD23 LEU A 871 -23.092 20.369 -41.182 1.00 51.26 H ATOM 11815 N ILE A 872 -20.076 16.274 -41.264 1.00 47.48 N ANISOU11815 N ILE A 872 5743 8437 3859 816 774 -1122 N ATOM 11816 CA ILE A 872 -19.265 15.175 -41.787 1.00 45.42 C ANISOU11816 CA ILE A 872 5443 8205 3608 810 763 -1265 C ATOM 11817 C ILE A 872 -20.127 14.153 -42.522 1.00 50.02 C ANISOU11817 C ILE A 872 6018 8847 4141 817 705 -1333 C ATOM 11818 O ILE A 872 -19.920 13.906 -43.707 1.00 59.67 O ANISOU11818 O ILE A 872 7214 10196 5263 778 710 -1386 O ATOM 11819 CB ILE A 872 -18.460 14.472 -40.652 1.00 47.55 C ANISOU11819 CB ILE A 872 5703 8341 4022 864 750 -1349 C ATOM 11820 CG1 ILE A 872 -17.276 15.340 -40.218 1.00 50.00 C ANISOU11820 CG1 ILE A 872 5992 8643 4365 845 804 -1337 C ATOM 11821 CG2 ILE A 872 -17.939 13.092 -41.089 1.00 50.84 C ANISOU11821 CG2 ILE A 872 6086 8767 4465 878 729 -1490 C ATOM 11822 CD1 ILE A 872 -16.613 14.892 -38.909 1.00 43.09 C ANISOU11822 CD1 ILE A 872 5106 7645 3620 909 777 -1391 C ATOM 11823 H ILE A 872 -20.178 16.252 -40.411 1.00 56.97 H ATOM 11824 HA ILE A 872 -18.627 15.535 -42.423 1.00 54.50 H ATOM 11825 HB ILE A 872 -19.047 14.351 -39.889 1.00 57.06 H ATOM 11826 HG12 ILE A 872 -16.600 15.316 -40.914 1.00 60.01 H ATOM 11827 HG13 ILE A 872 -17.586 16.251 -40.095 1.00 60.01 H ATOM 11828 HG21 ILE A 872 -17.447 12.694 -40.355 1.00 61.01 H ATOM 11829 HG22 ILE A 872 -18.694 12.531 -41.325 1.00 61.01 H ATOM 11830 HG23 ILE A 872 -17.357 13.203 -41.857 1.00 61.01 H ATOM 11831 HD11 ILE A 872 -15.877 15.491 -38.707 1.00 51.71 H ATOM 11832 HD12 ILE A 872 -17.270 14.923 -38.196 1.00 51.71 H ATOM 11833 HD13 ILE A 872 -16.283 13.987 -39.016 1.00 51.71 H ATOM 11834 N VAL A 873 -21.100 13.568 -41.830 1.00 49.70 N ANISOU11834 N VAL A 873 5996 8722 4167 870 655 -1340 N ATOM 11835 CA VAL A 873 -21.846 12.447 -42.399 1.00 54.89 C ANISOU11835 CA VAL A 873 6630 9422 4803 881 603 -1446 C ATOM 11836 C VAL A 873 -22.755 12.859 -43.561 1.00 56.22 C ANISOU11836 C VAL A 873 6786 9760 4815 838 574 -1404 C ATOM 11837 O VAL A 873 -23.246 12.005 -44.301 1.00 58.31 O ANISOU11837 O VAL A 873 7017 10104 5034 831 526 -1517 O ATOM 11838 CB VAL A 873 -22.682 11.718 -41.332 1.00 51.18 C ANISOU11838 CB VAL A 873 6175 8820 4451 956 571 -1465 C ATOM 11839 CG1 VAL A 873 -21.794 11.269 -40.177 1.00 48.16 C ANISOU11839 CG1 VAL A 873 5804 8281 4212 1011 595 -1492 C ATOM 11840 CG2 VAL A 873 -23.800 12.609 -40.830 1.00 58.10 C ANISOU11840 CG2 VAL A 873 7084 9687 5304 980 562 -1318 C ATOM 11841 H VAL A 873 -21.347 13.797 -41.039 1.00 59.64 H ATOM 11842 HA VAL A 873 -21.207 11.807 -42.749 1.00 65.86 H ATOM 11843 HB VAL A 873 -23.082 10.928 -41.728 1.00 61.42 H ATOM 11844 HG11 VAL A 873 -22.340 10.813 -39.518 1.00 57.79 H ATOM 11845 HG12 VAL A 873 -21.114 10.666 -40.518 1.00 57.79 H ATOM 11846 HG13 VAL A 873 -21.376 12.048 -39.779 1.00 57.79 H ATOM 11847 HG21 VAL A 873 -24.310 12.127 -40.160 1.00 69.72 H ATOM 11848 HG22 VAL A 873 -23.415 13.409 -40.441 1.00 69.72 H ATOM 11849 HG23 VAL A 873 -24.373 12.846 -41.576 1.00 69.72 H ATOM 11850 N TYR A 874 -22.985 14.162 -43.707 1.00 55.64 N ANISOU11850 N TYR A 874 6736 9743 4663 813 601 -1243 N ATOM 11851 CA TYR A 874 -23.709 14.698 -44.858 1.00 57.48 C ANISOU11851 CA TYR A 874 6958 10151 4733 777 580 -1168 C ATOM 11852 C TYR A 874 -22.753 15.486 -45.758 1.00 58.69 C ANISOU11852 C TYR A 874 7106 10408 4784 726 648 -1114 C ATOM 11853 O TYR A 874 -23.177 16.248 -46.629 1.00 64.13 O ANISOU11853 O TYR A 874 7796 11235 5337 703 656 -1000 O ATOM 11854 CB TYR A 874 -24.897 15.548 -44.397 1.00 53.50 C ANISOU11854 CB TYR A 874 6480 9638 4210 801 565 -1000 C ATOM 11855 CG TYR A 874 -25.935 14.736 -43.647 1.00 51.08 C ANISOU11855 CG TYR A 874 6169 9257 3983 859 504 -1055 C ATOM 11856 CD1 TYR A 874 -26.673 13.753 -44.296 1.00 56.42 C ANISOU11856 CD1 TYR A 874 6798 10029 4611 859 431 -1183 C ATOM 11857 CD2 TYR A 874 -26.170 14.944 -42.294 1.00 53.58 C ANISOU11857 CD2 TYR A 874 6524 9413 4422 919 526 -989 C ATOM 11858 CE1 TYR A 874 -27.615 13.000 -43.620 1.00 55.79 C ANISOU11858 CE1 TYR A 874 6704 9885 4608 914 389 -1247 C ATOM 11859 CE2 TYR A 874 -27.113 14.197 -41.609 1.00 56.98 C ANISOU11859 CE2 TYR A 874 6949 9777 4924 986 489 -1030 C ATOM 11860 CZ TYR A 874 -27.831 13.225 -42.278 1.00 59.89 C ANISOU11860 CZ TYR A 874 7265 10241 5247 982 426 -1161 C ATOM 11861 OH TYR A 874 -28.771 12.476 -41.606 1.00 60.22 O ANISOU11861 OH TYR A 874 7293 10219 5369 1054 404 -1217 O ATOM 11862 H TYR A 874 -22.730 14.763 -43.147 1.00 66.77 H ATOM 11863 HA TYR A 874 -24.060 13.957 -45.377 1.00 68.98 H ATOM 11864 HB2 TYR A 874 -24.576 16.246 -43.805 1.00 64.20 H ATOM 11865 HB3 TYR A 874 -25.326 15.941 -45.173 1.00 64.20 H ATOM 11866 HD1 TYR A 874 -26.528 13.597 -45.201 1.00 67.71 H ATOM 11867 HD2 TYR A 874 -25.686 15.596 -41.841 1.00 64.30 H ATOM 11868 HE1 TYR A 874 -28.100 12.347 -44.070 1.00 66.94 H ATOM 11869 HE2 TYR A 874 -27.260 14.347 -40.703 1.00 68.38 H ATOM 11870 HH TYR A 874 -28.804 12.711 -40.800 1.00 72.26 H ATOM 11871 N THR A 875 -21.459 15.280 -45.521 1.00 57.01 N ANISOU11871 N THR A 875 6886 10133 4642 717 700 -1191 N ATOM 11872 CA THR A 875 -20.379 15.741 -46.398 1.00 59.78 C ANISOU11872 CA THR A 875 7220 10585 4909 675 774 -1184 C ATOM 11873 C THR A 875 -20.458 17.219 -46.786 1.00 57.76 C ANISOU11873 C THR A 875 6982 10405 4558 645 845 -995 C ATOM 11874 O THR A 875 -20.267 17.586 -47.946 1.00 64.98 O ANISOU11874 O THR A 875 7885 11471 5333 618 883 -949 O ATOM 11875 CB THR A 875 -20.261 14.849 -47.662 1.00 65.48 C ANISOU11875 CB THR A 875 7906 11449 5523 663 745 -1310 C ATOM 11876 OG1 THR A 875 -21.537 14.740 -48.307 1.00 70.77 O ANISOU11876 OG1 THR A 875 8573 12231 6086 667 671 -1285 O ATOM 11877 CG2 THR A 875 -19.759 13.454 -47.280 1.00 66.02 C ANISOU11877 CG2 THR A 875 7952 11426 5708 688 713 -1500 C ATOM 11878 H THR A 875 -21.169 14.858 -44.829 1.00 68.41 H ATOM 11879 HA THR A 875 -19.548 15.634 -45.910 1.00 71.74 H ATOM 11880 HB THR A 875 -19.623 15.245 -48.276 1.00 78.57 H ATOM 11881 HG1 THR A 875 -21.472 14.257 -48.991 1.00 84.93 H ATOM 11882 HG21 THR A 875 -19.687 12.900 -48.073 1.00 79.23 H ATOM 11883 HG22 THR A 875 -18.888 13.519 -46.860 1.00 79.23 H ATOM 11884 HG23 THR A 875 -20.378 13.038 -46.660 1.00 79.23 H ATOM 11885 N VAL A 876 -20.727 18.058 -45.795 1.00 56.47 N ANISOU11885 N VAL A 876 6850 10134 4473 655 870 -883 N ATOM 11886 CA VAL A 876 -20.614 19.502 -45.948 1.00 54.58 C ANISOU11886 CA VAL A 876 6626 9928 4186 626 963 -707 C ATOM 11887 C VAL A 876 -19.156 19.891 -45.726 1.00 56.14 C ANISOU11887 C VAL A 876 6798 10092 4441 596 1064 -751 C ATOM 11888 O VAL A 876 -18.689 20.925 -46.212 1.00 63.08 O ANISOU11888 O VAL A 876 7668 11035 5265 559 1171 -641 O ATOM 11889 CB VAL A 876 -21.506 20.240 -44.927 1.00 52.14 C ANISOU11889 CB VAL A 876 6355 9510 3947 653 956 -579 C ATOM 11890 CG1 VAL A 876 -21.352 21.751 -45.061 1.00 49.12 C ANISOU11890 CG1 VAL A 876 5984 9147 3533 623 1070 -393 C ATOM 11891 CG2 VAL A 876 -22.967 19.824 -45.103 1.00 53.84 C ANISOU11891 CG2 VAL A 876 6582 9763 4112 688 857 -536 C ATOM 11892 H VAL A 876 -20.982 17.812 -45.011 1.00 67.77 H ATOM 11893 HA VAL A 876 -20.878 19.763 -46.845 1.00 65.50 H ATOM 11894 HB VAL A 876 -21.230 19.990 -44.031 1.00 62.57 H ATOM 11895 HG11 VAL A 876 -21.923 22.186 -44.408 1.00 58.95 H ATOM 11896 HG12 VAL A 876 -20.425 21.989 -44.902 1.00 58.95 H ATOM 11897 HG13 VAL A 876 -21.612 22.016 -45.957 1.00 58.95 H ATOM 11898 HG21 VAL A 876 -23.510 20.298 -44.453 1.00 64.61 H ATOM 11899 HG22 VAL A 876 -23.253 20.051 -46.002 1.00 64.61 H ATOM 11900 HG23 VAL A 876 -23.042 18.867 -44.963 1.00 64.61 H ATOM 11901 N VAL A 877 -18.450 19.036 -44.990 1.00 59.28 N ANISOU11901 N VAL A 877 7176 10392 4954 616 1032 -908 N ATOM 11902 CA VAL A 877 -17.055 19.246 -44.634 1.00 63.93 C ANISOU11902 CA VAL A 877 7726 10948 5617 597 1107 -976 C ATOM 11903 C VAL A 877 -16.288 17.989 -45.051 1.00 62.78 C ANISOU11903 C VAL A 877 7544 10830 5480 608 1073 -1141 C ATOM 11904 O VAL A 877 -16.864 16.899 -45.066 1.00 58.58 O ANISOU11904 O VAL A 877 7024 10275 4960 640 983 -1220 O ATOM 11905 CB VAL A 877 -16.921 19.509 -43.113 1.00 57.10 C ANISOU11905 CB VAL A 877 6868 9926 4900 628 1094 -995 C ATOM 11906 CG1 VAL A 877 -17.180 18.239 -42.302 1.00 60.06 C ANISOU11906 CG1 VAL A 877 7256 10191 5373 689 986 -1108 C ATOM 11907 CG2 VAL A 877 -15.566 20.080 -42.784 1.00 69.13 C ANISOU11907 CG2 VAL A 877 8336 11444 6485 601 1183 -1043 C ATOM 11908 H VAL A 877 -18.772 18.302 -44.678 1.00 71.13 H ATOM 11909 HA VAL A 877 -16.700 20.008 -45.118 1.00 76.72 H ATOM 11910 HB VAL A 877 -17.587 20.165 -42.852 1.00 68.52 H ATOM 11911 HG11 VAL A 877 -17.088 18.442 -41.358 1.00 72.07 H ATOM 11912 HG12 VAL A 877 -18.079 17.924 -42.487 1.00 72.07 H ATOM 11913 HG13 VAL A 877 -16.533 17.563 -42.560 1.00 72.07 H ATOM 11914 HG21 VAL A 877 -15.512 20.234 -41.828 1.00 82.95 H ATOM 11915 HG22 VAL A 877 -14.883 19.448 -43.057 1.00 82.95 H ATOM 11916 HG23 VAL A 877 -15.452 20.917 -43.261 1.00 82.95 H ATOM 11917 N GLU A 878 -15.010 18.135 -45.406 1.00 66.04 N ANISOU11917 N GLU A 878 7907 11294 5890 581 1153 -1192 N ATOM 11918 CA GLU A 878 -14.223 16.999 -45.897 1.00 71.93 C ANISOU11918 CA GLU A 878 8615 12078 6636 593 1135 -1338 C ATOM 11919 C GLU A 878 -14.154 15.910 -44.831 1.00 66.71 C ANISOU11919 C GLU A 878 7952 11277 6116 647 1047 -1453 C ATOM 11920 O GLU A 878 -14.122 16.206 -43.638 1.00 68.93 O ANISOU11920 O GLU A 878 8240 11443 6508 671 1029 -1437 O ATOM 11921 CB GLU A 878 -12.806 17.430 -46.331 1.00 81.61 C ANISOU11921 CB GLU A 878 9778 13379 7849 560 1248 -1364 C ATOM 11922 CG GLU A 878 -11.885 17.908 -45.188 1.00 89.49 C ANISOU11922 CG GLU A 878 10729 14286 8987 560 1284 -1397 C ATOM 11923 CD GLU A 878 -10.394 17.902 -45.540 1.00 94.38 C ANISOU11923 CD GLU A 878 11264 14974 9622 539 1372 -1477 C ATOM 11924 OE1 GLU A 878 -9.572 18.115 -44.619 1.00 84.23 O ANISOU11924 OE1 GLU A 878 9920 13629 8454 544 1384 -1536 O ATOM 11925 OE2 GLU A 878 -10.039 17.687 -46.721 1.00102.00 O ANISOU11925 OE2 GLU A 878 12214 16060 10481 521 1428 -1485 O ATOM 11926 H GLU A 878 -14.576 18.877 -45.371 1.00 79.25 H ATOM 11927 HA GLU A 878 -14.668 16.625 -46.673 1.00 86.31 H ATOM 11928 HB2 GLU A 878 -12.372 16.675 -46.759 1.00 97.93 H ATOM 11929 HB3 GLU A 878 -12.886 18.160 -46.965 1.00 97.93 H ATOM 11930 HG2 GLU A 878 -12.129 18.816 -44.951 1.00107.38 H ATOM 11931 HG3 GLU A 878 -12.010 17.324 -44.423 1.00107.38 H HETATM11932 N MSE A 879 -14.142 14.651 -45.259 1.00 73.71 N ANISOU11932 N MSE A 879 8830 12176 7000 672 997 -1566 N HETATM11933 CA MSE A 879 -14.133 13.535 -44.319 1.00 77.41 C ANISOU11933 CA MSE A 879 9299 12513 7600 729 927 -1660 C HETATM11934 C MSE A 879 -12.797 13.409 -43.583 1.00 79.16 C ANISOU11934 C MSE A 879 9471 12679 7927 752 953 -1723 C HETATM11935 O MSE A 879 -12.713 12.754 -42.544 1.00 78.62 O ANISOU11935 O MSE A 879 9404 12493 7975 808 904 -1763 O HETATM11936 CB MSE A 879 -14.455 12.223 -45.033 1.00 74.52 C ANISOU11936 CB MSE A 879 8930 12179 7207 747 883 -1773 C HETATM11937 CG MSE A 879 -14.837 11.116 -44.067 1.00 73.73 C ANISOU11937 CG MSE A 879 8842 11935 7238 809 819 -1839 C HETATM11938 SE MSE A 879 -15.129 9.376 -44.886 1.00113.97 SE ANISOU11938 SE MSE A 879 13921 17053 12329 832 781 -2014 SE HETATM11939 CE MSE A 879 -16.814 9.711 -45.811 1.00 84.85 C ANISOU11939 CE MSE A 879 10260 13479 8501 793 730 -1973 C HETATM11940 H MSE A 879 -14.140 14.417 -46.086 1.00 88.45 H HETATM11941 HA MSE A 879 -14.830 13.685 -43.661 1.00 92.89 H HETATM11942 HB2 MSE A 879 -15.200 12.366 -45.638 1.00 89.43 H HETATM11943 HB3 MSE A 879 -13.674 11.933 -45.530 1.00 89.43 H HETATM11944 HG2 MSE A 879 -14.126 11.017 -43.415 1.00 88.48 H HETATM11945 HG3 MSE A 879 -15.658 11.369 -43.617 1.00 88.48 H HETATM11946 HE1 MSE A 879 -17.085 8.903 -46.275 1.00101.82 H HETATM11947 HE2 MSE A 879 -17.487 9.960 -45.158 1.00101.82 H HETATM11948 HE3 MSE A 879 -16.686 10.432 -46.447 1.00101.82 H ATOM 11949 N ASN A 880 -11.757 14.035 -44.122 1.00 78.81 N ANISOU11949 N ASN A 880 9377 12729 7837 712 1035 -1727 N ATOM 11950 CA ASN A 880 -10.437 14.003 -43.499 1.00 81.55 C ANISOU11950 CA ASN A 880 9658 13051 8275 729 1062 -1794 C ATOM 11951 C ASN A 880 -10.401 14.761 -42.174 1.00 78.84 C ANISOU11951 C ASN A 880 9312 12616 8028 745 1043 -1749 C ATOM 11952 O ASN A 880 -9.481 14.584 -41.376 1.00 82.52 O ANISOU11952 O ASN A 880 9723 13045 8585 779 1031 -1815 O ATOM 11953 CB ASN A 880 -9.381 14.575 -44.448 1.00 88.68 C ANISOU11953 CB ASN A 880 10498 14090 9104 678 1169 -1808 C ATOM 11954 CG ASN A 880 -9.046 13.633 -45.595 1.00 96.36 C ANISOU11954 CG ASN A 880 11458 15154 10002 682 1187 -1891 C ATOM 11955 OD1 ASN A 880 -8.234 12.719 -45.443 1.00 93.81 O ANISOU11955 OD1 ASN A 880 11091 14810 9741 720 1175 -1999 O ATOM 11956 ND2 ASN A 880 -9.653 13.867 -46.756 1.00100.67 N ANISOU11956 ND2 ASN A 880 12038 15806 10407 648 1217 -1841 N ATOM 11957 H ASN A 880 -11.788 14.487 -44.852 1.00 94.57 H ATOM 11958 HA ASN A 880 -10.201 13.080 -43.317 1.00 97.86 H ATOM 11959 HB2 ASN A 880 -9.713 15.403 -44.827 1.00106.41 H ATOM 11960 HB3 ASN A 880 -8.566 14.742 -43.949 1.00106.41 H ATOM 11961 HD21 ASN A 880 -9.495 13.361 -47.433 1.00120.81 H ATOM 11962 HD22 ASN A 880 -10.203 14.523 -46.829 1.00120.81 H ATOM 11963 N THR A 881 -11.394 15.618 -41.948 1.00 64.70 N ANISOU11963 N THR A 881 7575 10798 6209 726 1041 -1642 N ATOM 11964 CA THR A 881 -11.523 16.315 -40.671 1.00 60.87 C ANISOU11964 CA THR A 881 7098 10220 5809 749 1019 -1604 C ATOM 11965 C THR A 881 -11.872 15.334 -39.557 1.00 56.82 C ANISOU11965 C THR A 881 6615 9579 5394 832 921 -1638 C ATOM 11966 O THR A 881 -11.546 15.563 -38.393 1.00 58.18 O ANISOU11966 O THR A 881 6772 9684 5648 874 890 -1651 O ATOM 11967 CB THR A 881 -12.617 17.410 -40.709 1.00 57.97 C ANISOU11967 CB THR A 881 6788 9848 5388 718 1045 -1475 C ATOM 11968 OG1 THR A 881 -13.833 16.868 -41.238 1.00 60.34 O ANISOU11968 OG1 THR A 881 7154 10149 5625 727 998 -1425 O ATOM 11969 CG2 THR A 881 -12.177 18.595 -41.556 1.00 58.47 C ANISOU11969 CG2 THR A 881 6816 10027 5373 642 1167 -1416 C ATOM 11970 H THR A 881 -12.007 15.813 -42.519 1.00 77.64 H ATOM 11971 HA THR A 881 -10.678 16.737 -40.451 1.00 73.04 H ATOM 11972 HB THR A 881 -12.778 17.729 -39.807 1.00 69.56 H ATOM 11973 HG1 THR A 881 -13.705 16.583 -42.018 1.00 72.41 H ATOM 11974 HG21 THR A 881 -12.874 19.270 -41.568 1.00 70.16 H ATOM 11975 HG22 THR A 881 -11.368 18.983 -41.188 1.00 70.16 H ATOM 11976 HG23 THR A 881 -12.003 18.305 -42.465 1.00 70.16 H ATOM 11977 N ALA A 882 -12.535 14.241 -39.922 1.00 49.30 N ANISOU11977 N ALA A 882 5700 8602 4429 859 877 -1655 N ATOM 11978 CA ALA A 882 -12.988 13.251 -38.950 1.00 47.33 C ANISOU11978 CA ALA A 882 5481 8232 4269 939 805 -1672 C ATOM 11979 C ALA A 882 -11.823 12.497 -38.310 1.00 55.19 C ANISOU11979 C ALA A 882 6423 9200 5348 996 787 -1759 C ATOM 11980 O ALA A 882 -12.001 11.821 -37.296 1.00 54.31 O ANISOU11980 O ALA A 882 6329 8991 5315 1074 737 -1759 O ATOM 11981 CB ALA A 882 -13.948 12.271 -39.611 1.00 45.94 C ANISOU11981 CB ALA A 882 5343 8050 4063 946 779 -1688 C ATOM 11982 H ALA A 882 -12.736 14.047 -40.735 1.00 59.16 H ATOM 11983 HA ALA A 882 -13.471 13.707 -38.242 1.00 56.79 H ATOM 11984 HB1 ALA A 882 -14.239 11.622 -38.952 1.00 55.13 H ATOM 11985 HB2 ALA A 882 -14.712 12.761 -39.954 1.00 55.13 H ATOM 11986 HB3 ALA A 882 -13.489 11.823 -40.338 1.00 55.13 H ATOM 11987 N ALA A 883 -10.638 12.610 -38.903 1.00 66.80 N ANISOU11987 N ALA A 883 7822 10763 6796 963 833 -1828 N ATOM 11988 CA ALA A 883 -9.459 11.932 -38.376 1.00 65.42 C ANISOU11988 CA ALA A 883 7582 10583 6692 1018 818 -1914 C ATOM 11989 C ALA A 883 -9.129 12.446 -36.978 1.00 68.10 C ANISOU11989 C ALA A 883 7901 10873 7100 1068 774 -1898 C ATOM 11990 O ALA A 883 -8.739 11.680 -36.097 1.00 70.50 O ANISOU11990 O ALA A 883 8188 11127 7470 1152 725 -1930 O ATOM 11991 CB ALA A 883 -8.272 12.130 -39.302 1.00 64.81 C ANISOU11991 CB ALA A 883 7423 10628 6572 968 885 -1987 C ATOM 11992 H ALA A 883 -10.490 13.074 -39.612 1.00 80.16 H ATOM 11993 HA ALA A 883 -9.639 10.981 -38.314 1.00 78.51 H ATOM 11994 HB1 ALA A 883 -7.503 11.671 -38.930 1.00 77.77 H ATOM 11995 HB2 ALA A 883 -8.488 11.764 -40.173 1.00 77.77 H ATOM 11996 HB3 ALA A 883 -8.087 13.079 -39.378 1.00 77.77 H ATOM 11997 N ASP A 884 -9.286 13.751 -36.787 1.00 75.39 N ANISOU11997 N ASP A 884 8824 11818 8004 1021 795 -1852 N ATOM 11998 CA ASP A 884 -9.031 14.380 -35.495 1.00 75.59 C ANISOU11998 CA ASP A 884 8828 11808 8084 1064 752 -1852 C ATOM 11999 C ASP A 884 -10.113 14.040 -34.465 1.00 72.12 C ANISOU11999 C ASP A 884 8474 11250 7679 1139 686 -1775 C ATOM 12000 O ASP A 884 -9.965 14.344 -33.279 1.00 73.94 O ANISOU12000 O ASP A 884 8697 11448 7950 1199 636 -1774 O ATOM 12001 CB ASP A 884 -8.928 15.900 -35.665 1.00 77.09 C ANISOU12001 CB ASP A 884 8990 12052 8247 986 812 -1838 C ATOM 12002 CG ASP A 884 -7.793 16.308 -36.586 1.00 85.37 C ANISOU12002 CG ASP A 884 9940 13224 9271 913 895 -1912 C ATOM 12003 OD1 ASP A 884 -7.955 16.192 -37.819 1.00 89.86 O ANISOU12003 OD1 ASP A 884 10525 13849 9770 858 959 -1885 O ATOM 12004 OD2 ASP A 884 -6.739 16.747 -36.077 1.00 89.22 O ANISOU12004 OD2 ASP A 884 10328 13763 9809 914 898 -2000 O ATOM 12005 H ASP A 884 -9.543 14.301 -37.396 1.00 90.47 H ATOM 12006 HA ASP A 884 -8.182 14.060 -35.152 1.00 90.71 H ATOM 12007 HB2 ASP A 884 -9.757 16.233 -36.043 1.00 92.50 H ATOM 12008 HB3 ASP A 884 -8.772 16.305 -34.797 1.00 92.50 H ATOM 12009 N ILE A 885 -11.189 13.407 -34.928 1.00 49.48 N ANISOU12009 N ILE A 885 5681 8329 4792 1140 687 -1718 N ATOM 12010 CA ILE A 885 -12.329 13.052 -34.086 1.00 43.04 C ANISOU12010 CA ILE A 885 4942 7404 4008 1206 642 -1640 C ATOM 12011 C ILE A 885 -12.339 11.553 -33.795 1.00 49.11 C ANISOU12011 C ILE A 885 5719 8114 4827 1286 615 -1667 C ATOM 12012 O ILE A 885 -12.634 11.133 -32.677 1.00 50.95 O ANISOU12012 O ILE A 885 5980 8271 5109 1376 574 -1628 O ATOM 12013 CB ILE A 885 -13.651 13.472 -34.768 1.00 41.71 C ANISOU12013 CB ILE A 885 4841 7222 3786 1151 667 -1561 C ATOM 12014 CG1 ILE A 885 -13.829 14.988 -34.668 1.00 44.12 C ANISOU12014 CG1 ILE A 885 5154 7553 4056 1101 696 -1508 C ATOM 12015 CG2 ILE A 885 -14.863 12.785 -34.134 1.00 39.50 C ANISOU12015 CG2 ILE A 885 4628 6838 3544 1220 631 -1497 C ATOM 12016 CD1 ILE A 885 -14.823 15.569 -35.657 1.00 43.75 C ANISOU12016 CD1 ILE A 885 5150 7543 3929 1033 738 -1435 C ATOM 12017 H ILE A 885 -11.283 13.166 -35.748 1.00 59.38 H ATOM 12018 HA ILE A 885 -12.260 13.524 -33.241 1.00 51.65 H ATOM 12019 HB ILE A 885 -13.610 13.225 -35.705 1.00 50.05 H ATOM 12020 HG12 ILE A 885 -14.139 15.206 -33.775 1.00 52.95 H ATOM 12021 HG13 ILE A 885 -12.971 15.412 -34.829 1.00 52.95 H ATOM 12022 HG21 ILE A 885 -15.667 13.077 -34.591 1.00 47.40 H ATOM 12023 HG22 ILE A 885 -14.762 11.824 -34.221 1.00 47.40 H ATOM 12024 HG23 ILE A 885 -14.908 13.029 -33.196 1.00 47.40 H ATOM 12025 HD11 ILE A 885 -14.874 16.529 -35.526 1.00 52.50 H ATOM 12026 HD12 ILE A 885 -14.523 15.374 -36.558 1.00 52.50 H ATOM 12027 HD13 ILE A 885 -15.692 15.167 -35.503 1.00 52.50 H ATOM 12028 N PHE A 886 -12.012 10.750 -34.803 1.00 55.75 N ANISOU12028 N PHE A 886 6535 8993 5653 1259 645 -1733 N ATOM 12029 CA PHE A 886 -12.035 9.299 -34.657 1.00 54.64 C ANISOU12029 CA PHE A 886 6403 8792 5568 1331 638 -1771 C ATOM 12030 C PHE A 886 -11.010 8.833 -33.631 1.00 51.44 C ANISOU12030 C PHE A 886 5953 8375 5218 1423 609 -1801 C ATOM 12031 O PHE A 886 -11.224 7.836 -32.942 1.00 53.45 O ANISOU12031 O PHE A 886 6231 8549 5529 1515 598 -1787 O ATOM 12032 CB PHE A 886 -11.757 8.614 -36.000 1.00 54.49 C ANISOU12032 CB PHE A 886 6358 8828 5516 1280 680 -1858 C ATOM 12033 CG PHE A 886 -12.914 8.650 -36.970 1.00 56.68 C ANISOU12033 CG PHE A 886 6680 9118 5737 1218 694 -1843 C ATOM 12034 CD1 PHE A 886 -14.210 8.910 -36.550 1.00 56.72 C ANISOU12034 CD1 PHE A 886 6746 9059 5747 1229 673 -1761 C ATOM 12035 CD2 PHE A 886 -12.693 8.417 -38.317 1.00 60.99 C ANISOU12035 CD2 PHE A 886 7202 9754 6218 1155 727 -1917 C ATOM 12036 CE1 PHE A 886 -15.257 8.942 -37.456 1.00 59.11 C ANISOU12036 CE1 PHE A 886 7074 9393 5989 1177 678 -1757 C ATOM 12037 CE2 PHE A 886 -13.733 8.446 -39.224 1.00 63.90 C ANISOU12037 CE2 PHE A 886 7601 10159 6518 1104 728 -1914 C ATOM 12038 CZ PHE A 886 -15.016 8.709 -38.794 1.00 63.05 C ANISOU12038 CZ PHE A 886 7546 9994 6415 1114 700 -1837 C ATOM 12039 H PHE A 886 -11.772 11.021 -35.584 1.00 66.89 H ATOM 12040 HA PHE A 886 -12.914 9.024 -34.353 1.00 65.57 H ATOM 12041 HB2 PHE A 886 -11.004 9.055 -36.423 1.00 65.39 H ATOM 12042 HB3 PHE A 886 -11.540 7.683 -35.834 1.00 65.39 H ATOM 12043 HD1 PHE A 886 -14.377 9.070 -35.649 1.00 68.07 H ATOM 12044 HD2 PHE A 886 -11.830 8.240 -38.615 1.00 73.19 H ATOM 12045 HE1 PHE A 886 -16.122 9.118 -37.162 1.00 70.93 H ATOM 12046 HE2 PHE A 886 -13.568 8.288 -40.125 1.00 76.68 H ATOM 12047 HZ PHE A 886 -15.717 8.727 -39.404 1.00 75.66 H ATOM 12048 N LYS A 887 -9.901 9.556 -33.526 1.00 44.67 N ANISOU12048 N LYS A 887 5024 7605 4342 1404 601 -1845 N ATOM 12049 CA LYS A 887 -8.829 9.168 -32.621 1.00 46.43 C ANISOU12049 CA LYS A 887 5187 7850 4603 1493 563 -1890 C ATOM 12050 C LYS A 887 -9.214 9.340 -31.151 1.00 55.76 C ANISOU12050 C LYS A 887 6403 8979 5806 1588 501 -1819 C ATOM 12051 O LYS A 887 -8.501 8.870 -30.264 1.00 62.81 O ANISOU12051 O LYS A 887 7257 9889 6718 1688 459 -1841 O ATOM 12052 CB LYS A 887 -7.560 9.962 -32.935 1.00 49.35 C ANISOU12052 CB LYS A 887 5456 8345 4950 1443 570 -1972 C ATOM 12053 CG LYS A 887 -7.675 11.460 -32.706 1.00 51.28 C ANISOU12053 CG LYS A 887 5690 8627 5167 1382 564 -1951 C ATOM 12054 CD LYS A 887 -6.408 12.169 -33.157 1.00 53.08 C ANISOU12054 CD LYS A 887 5804 8979 5385 1322 593 -2050 C ATOM 12055 CE LYS A 887 -6.424 13.645 -32.797 1.00 59.46 C ANISOU12055 CE LYS A 887 6588 9820 6184 1269 596 -2050 C ATOM 12056 NZ LYS A 887 -5.383 14.410 -33.539 1.00 65.13 N ANISOU12056 NZ LYS A 887 7197 10656 6895 1182 661 -2141 N ATOM 12057 H LYS A 887 -9.745 10.277 -33.969 1.00 53.60 H ATOM 12058 HA LYS A 887 -8.630 8.229 -32.763 1.00 55.71 H ATOM 12059 HB2 LYS A 887 -6.842 9.634 -32.372 1.00 59.22 H ATOM 12060 HB3 LYS A 887 -7.332 9.825 -33.867 1.00 59.22 H ATOM 12061 HG2 LYS A 887 -8.421 11.809 -33.219 1.00 61.53 H ATOM 12062 HG3 LYS A 887 -7.803 11.633 -31.760 1.00 61.53 H ATOM 12063 HD2 LYS A 887 -5.643 11.760 -32.724 1.00 63.69 H ATOM 12064 HD3 LYS A 887 -6.327 12.093 -34.121 1.00 63.69 H ATOM 12065 HE2 LYS A 887 -7.291 14.019 -33.020 1.00 71.35 H ATOM 12066 HE3 LYS A 887 -6.252 13.744 -31.847 1.00 71.35 H ATOM 12067 HZ1 LYS A 887 -5.415 15.269 -33.310 1.00 78.16 H ATOM 12068 HZ2 LYS A 887 -4.575 14.089 -33.348 1.00 78.16 H ATOM 12069 HZ3 LYS A 887 -5.521 14.340 -34.416 1.00 78.16 H ATOM 12070 N GLN A 888 -10.341 10.002 -30.895 1.00 54.92 N ANISOU12070 N GLN A 888 6366 8815 5685 1564 496 -1733 N ATOM 12071 CA GLN A 888 -10.798 10.233 -29.525 1.00 50.54 C ANISOU12071 CA GLN A 888 5850 8213 5139 1654 442 -1661 C ATOM 12072 C GLN A 888 -11.896 9.255 -29.117 1.00 49.33 C ANISOU12072 C GLN A 888 5777 7946 5022 1726 452 -1576 C ATOM 12073 O GLN A 888 -12.391 9.319 -27.993 1.00 54.87 O ANISOU12073 O GLN A 888 6521 8603 5725 1811 416 -1500 O ATOM 12074 CB GLN A 888 -11.329 11.659 -29.353 1.00 44.20 C ANISOU12074 CB GLN A 888 5073 7417 4306 1595 435 -1619 C ATOM 12075 CG GLN A 888 -10.572 12.747 -30.105 1.00 50.77 C ANISOU12075 CG GLN A 888 5838 8342 5111 1489 463 -1693 C ATOM 12076 CD GLN A 888 -9.318 13.217 -29.396 1.00 50.86 C ANISOU12076 CD GLN A 888 5755 8443 5126 1525 417 -1784 C ATOM 12077 OE1 GLN A 888 -8.919 12.672 -28.364 1.00 46.16 O ANISOU12077 OE1 GLN A 888 5141 7857 4541 1638 352 -1795 O ATOM 12078 NE2 GLN A 888 -8.689 14.246 -29.953 1.00 52.17 N ANISOU12078 NE2 GLN A 888 5855 8687 5281 1434 452 -1854 N ATOM 12079 H GLN A 888 -10.860 10.329 -31.498 1.00 65.90 H ATOM 12080 HA GLN A 888 -10.050 10.115 -28.919 1.00 60.65 H ATOM 12081 HB2 GLN A 888 -12.249 11.682 -29.661 1.00 53.04 H ATOM 12082 HB3 GLN A 888 -11.298 11.885 -28.410 1.00 53.04 H ATOM 12083 HG2 GLN A 888 -10.310 12.403 -30.974 1.00 60.93 H ATOM 12084 HG3 GLN A 888 -11.155 13.514 -30.217 1.00 60.93 H ATOM 12085 HE21 GLN A 888 -8.999 14.602 -30.672 1.00 62.61 H ATOM 12086 HE22 GLN A 888 -7.972 14.557 -29.595 1.00 62.61 H ATOM 12087 N TYR A 889 -12.270 8.352 -30.024 1.00 55.79 N ANISOU12087 N TYR A 889 6612 8721 5867 1696 504 -1597 N ATOM 12088 CA TYR A 889 -13.332 7.374 -29.768 1.00 56.43 C ANISOU12088 CA TYR A 889 6755 8687 6000 1755 532 -1537 C ATOM 12089 C TYR A 889 -13.105 6.615 -28.467 1.00 59.44 C ANISOU12089 C TYR A 889 7145 9020 6419 1897 512 -1489 C ATOM 12090 O TYR A 889 -14.041 6.093 -27.860 1.00 61.07 O ANISOU12090 O TYR A 889 7407 9129 6669 1964 530 -1406 O ATOM 12091 CB TYR A 889 -13.406 6.368 -30.919 1.00 58.88 C ANISOU12091 CB TYR A 889 7055 8974 6342 1714 590 -1612 C ATOM 12092 CG TYR A 889 -14.269 5.156 -30.627 1.00 59.36 C ANISOU12092 CG TYR A 889 7158 8908 6487 1788 634 -1581 C ATOM 12093 CD1 TYR A 889 -15.650 5.268 -30.522 1.00 60.24 C ANISOU12093 CD1 TYR A 889 7325 8947 6618 1783 646 -1510 C ATOM 12094 CD2 TYR A 889 -13.700 3.899 -30.456 1.00 62.84 C ANISOU12094 CD2 TYR A 889 7578 9297 7003 1865 673 -1624 C ATOM 12095 CE1 TYR A 889 -16.439 4.164 -30.252 1.00 64.72 C ANISOU12095 CE1 TYR A 889 7918 9389 7285 1851 699 -1487 C ATOM 12096 CE2 TYR A 889 -14.480 2.790 -30.186 1.00 66.13 C ANISOU12096 CE2 TYR A 889 8025 9579 7523 1932 733 -1597 C ATOM 12097 CZ TYR A 889 -15.849 2.928 -30.087 1.00 69.14 C ANISOU12097 CZ TYR A 889 8453 9885 7931 1922 747 -1531 C ATOM 12098 OH TYR A 889 -16.634 1.830 -29.820 1.00 75.55 O ANISOU12098 OH TYR A 889 9282 10552 8871 1987 818 -1508 O ATOM 12099 H TYR A 889 -11.918 8.283 -30.806 1.00 66.95 H ATOM 12100 HA TYR A 889 -14.184 7.834 -29.708 1.00 67.72 H ATOM 12101 HB2 TYR A 889 -13.775 6.813 -31.698 1.00 70.65 H ATOM 12102 HB3 TYR A 889 -12.510 6.053 -31.115 1.00 70.65 H ATOM 12103 HD1 TYR A 889 -16.051 6.100 -30.632 1.00 72.29 H ATOM 12104 HD2 TYR A 889 -12.777 3.803 -30.522 1.00 75.41 H ATOM 12105 HE1 TYR A 889 -17.362 4.255 -30.185 1.00 77.67 H ATOM 12106 HE2 TYR A 889 -14.085 1.956 -30.074 1.00 79.36 H ATOM 12107 HH TYR A 889 -16.153 1.145 -29.742 1.00 90.66 H HETATM12108 N MSE A 890 -11.847 6.565 -28.048 1.00104.41 N ANISOU12108 N MSE A 890 12781 14794 12098 1948 476 -1541 N HETATM12109 CA MSE A 890 -11.440 5.779 -26.896 1.00108.25 C ANISOU12109 CA MSE A 890 13265 15263 12601 2095 454 -1505 C HETATM12110 C MSE A 890 -11.186 6.656 -25.672 1.00107.24 C ANISOU12110 C MSE A 890 13135 15206 12403 2167 369 -1463 C HETATM12111 O MSE A 890 -11.733 6.422 -24.593 1.00102.56 O ANISOU12111 O MSE A 890 12597 14571 11800 2273 351 -1366 O HETATM12112 CB MSE A 890 -10.159 5.030 -27.249 1.00117.35 C ANISOU12112 CB MSE A 890 14345 16471 13774 2124 467 -1602 C HETATM12113 CG MSE A 890 -9.875 3.842 -26.372 1.00121.82 C ANISOU12113 CG MSE A 890 14916 16989 14383 2275 482 -1564 C HETATM12114 SE MSE A 890 -11.251 2.475 -26.525 1.00148.70 SE ANISOU12114 SE MSE A 890 18397 20186 17918 2303 596 -1488 SE HETATM12115 CE MSE A 890 -10.083 0.950 -26.229 1.00120.68 C ANISOU12115 CE MSE A 890 14793 16613 14449 2439 649 -1528 C HETATM12116 H MSE A 890 -11.198 6.986 -28.424 1.00125.30 H HETATM12117 HA MSE A 890 -12.129 5.128 -26.689 1.00129.90 H HETATM12118 HB2 MSE A 890 -10.227 4.712 -28.163 1.00140.83 H HETATM12119 HB3 MSE A 890 -9.410 5.641 -27.170 1.00140.83 H HETATM12120 HG2 MSE A 890 -9.028 3.448 -26.635 1.00146.19 H HETATM12121 HG3 MSE A 890 -9.837 4.130 -25.447 1.00146.19 H HETATM12122 HE1 MSE A 890 -10.609 0.137 -26.270 1.00144.82 H HETATM12123 HE2 MSE A 890 -9.400 0.938 -26.919 1.00144.82 H HETATM12124 HE3 MSE A 890 -9.669 1.035 -25.356 1.00144.82 H ATOM 12125 N LYS A 891 -10.343 7.665 -25.864 1.00 50.91 N ANISOU12125 N LYS A 891 5935 8185 5222 2109 322 -1543 N ATOM 12126 CA LYS A 891 -9.941 8.591 -24.812 1.00 39.43 C ANISOU12126 CA LYS A 891 4457 6820 3706 2166 237 -1546 C ATOM 12127 C LYS A 891 -11.135 9.337 -24.203 1.00 43.75 C ANISOU12127 C LYS A 891 5086 7306 4230 2168 225 -1445 C ATOM 12128 O LYS A 891 -11.053 9.859 -23.090 1.00 47.54 O ANISOU12128 O LYS A 891 5571 7835 4656 2254 157 -1425 O ATOM 12129 CB LYS A 891 -8.942 9.584 -25.409 1.00 42.92 C ANISOU12129 CB LYS A 891 4802 7373 4131 2069 218 -1668 C ATOM 12130 CG LYS A 891 -8.277 10.524 -24.418 1.00 44.67 C ANISOU12130 CG LYS A 891 4966 7706 4302 2123 129 -1723 C ATOM 12131 CD LYS A 891 -7.298 11.453 -25.132 1.00 43.36 C ANISOU12131 CD LYS A 891 4691 7640 4144 2012 132 -1856 C ATOM 12132 CE LYS A 891 -6.702 12.491 -24.200 1.00 42.61 C ANISOU12132 CE LYS A 891 4524 7652 4015 2051 48 -1939 C ATOM 12133 NZ LYS A 891 -5.562 13.189 -24.859 1.00 51.41 N ANISOU12133 NZ LYS A 891 5507 8875 5152 1956 58 -2089 N ATOM 12134 H LYS A 891 -9.979 7.839 -26.623 1.00 61.09 H ATOM 12135 HA LYS A 891 -9.496 8.100 -24.104 1.00 47.32 H ATOM 12136 HB2 LYS A 891 -8.239 9.082 -25.851 1.00 51.50 H ATOM 12137 HB3 LYS A 891 -9.407 10.131 -26.061 1.00 51.50 H ATOM 12138 HG2 LYS A 891 -8.953 11.066 -23.983 1.00 53.61 H ATOM 12139 HG3 LYS A 891 -7.785 10.006 -23.762 1.00 53.61 H ATOM 12140 HD2 LYS A 891 -6.572 10.926 -25.501 1.00 52.03 H ATOM 12141 HD3 LYS A 891 -7.765 11.920 -25.843 1.00 52.03 H ATOM 12142 HE2 LYS A 891 -7.377 13.150 -23.974 1.00 51.13 H ATOM 12143 HE3 LYS A 891 -6.373 12.054 -23.398 1.00 51.13 H ATOM 12144 HZ1 LYS A 891 -5.217 13.796 -24.307 1.00 61.70 H ATOM 12145 HZ2 LYS A 891 -4.929 12.601 -25.075 1.00 61.70 H ATOM 12146 HZ3 LYS A 891 -5.842 13.597 -25.599 1.00 61.70 H ATOM 12147 N TYR A 892 -12.235 9.385 -24.953 1.00 49.77 N ANISOU12147 N TYR A 892 5908 7972 5031 2079 288 -1391 N ATOM 12148 CA TYR A 892 -13.482 10.009 -24.509 1.00 44.01 C ANISOU12148 CA TYR A 892 5258 7174 4291 2078 290 -1289 C ATOM 12149 C TYR A 892 -14.672 9.084 -24.770 1.00 45.08 C ANISOU12149 C TYR A 892 5462 7187 4480 2089 354 -1201 C ATOM 12150 O TYR A 892 -15.714 9.532 -25.252 1.00 40.12 O ANISOU12150 O TYR A 892 4875 6504 3863 2019 386 -1155 O ATOM 12151 CB TYR A 892 -13.723 11.314 -25.274 1.00 37.13 C ANISOU12151 CB TYR A 892 4378 6320 3410 1942 307 -1320 C ATOM 12152 CG TYR A 892 -12.751 12.429 -24.975 1.00 42.91 C ANISOU12152 CG TYR A 892 5044 7152 4108 1920 260 -1407 C ATOM 12153 CD1 TYR A 892 -11.442 12.383 -25.431 1.00 49.75 C ANISOU12153 CD1 TYR A 892 5814 8114 4975 1889 250 -1525 C ATOM 12154 CD2 TYR A 892 -13.156 13.541 -24.255 1.00 44.82 C ANISOU12154 CD2 TYR A 892 5313 7393 4325 1928 233 -1382 C ATOM 12155 CE1 TYR A 892 -10.559 13.411 -25.163 1.00 47.19 C ANISOU12155 CE1 TYR A 892 5414 7884 4631 1866 212 -1622 C ATOM 12156 CE2 TYR A 892 -12.289 14.572 -23.987 1.00 50.19 C ANISOU12156 CE2 TYR A 892 5925 8159 4987 1905 197 -1483 C ATOM 12157 CZ TYR A 892 -10.992 14.508 -24.440 1.00 46.94 C ANISOU12157 CZ TYR A 892 5410 7845 4581 1872 186 -1606 C ATOM 12158 OH TYR A 892 -10.131 15.546 -24.158 1.00 45.66 O ANISOU12158 OH TYR A 892 5164 7773 4412 1847 153 -1725 O ATOM 12159 H TYR A 892 -12.286 9.053 -25.744 1.00 59.72 H ATOM 12160 HA TYR A 892 -13.436 10.204 -23.560 1.00 52.82 H ATOM 12161 HB2 TYR A 892 -13.668 11.127 -26.224 1.00 44.56 H ATOM 12162 HB3 TYR A 892 -14.611 11.637 -25.058 1.00 44.56 H ATOM 12163 HD1 TYR A 892 -11.152 11.645 -25.918 1.00 59.70 H ATOM 12164 HD2 TYR A 892 -14.033 13.591 -23.948 1.00 53.79 H ATOM 12165 HE1 TYR A 892 -9.682 13.368 -25.470 1.00 56.62 H ATOM 12166 HE2 TYR A 892 -12.577 15.309 -23.498 1.00 60.23 H ATOM 12167 HH TYR A 892 -9.373 15.387 -24.484 1.00 54.79 H ATOM 12168 N TYR A 893 -14.524 7.797 -24.468 1.00 55.10 N ANISOU12168 N TYR A 893 6735 8414 5786 2179 378 -1183 N ATOM 12169 CA TYR A 893 -15.546 6.815 -24.845 1.00 57.59 C ANISOU12169 CA TYR A 893 7093 8606 6181 2180 454 -1130 C ATOM 12170 C TYR A 893 -16.865 6.904 -24.068 1.00 60.52 C ANISOU12170 C TYR A 893 7542 8891 6561 2235 468 -994 C ATOM 12171 O TYR A 893 -17.900 6.480 -24.571 1.00 64.09 O ANISOU12171 O TYR A 893 8020 9249 7081 2202 529 -961 O ATOM 12172 CB TYR A 893 -15.004 5.385 -24.751 1.00 61.09 C ANISOU12172 CB TYR A 893 7513 9008 6689 2260 497 -1152 C ATOM 12173 CG TYR A 893 -16.048 4.336 -25.096 1.00 60.35 C ANISOU12173 CG TYR A 893 7451 8772 6710 2263 588 -1113 C ATOM 12174 CD1 TYR A 893 -16.403 4.093 -26.418 1.00 64.21 C ANISOU12174 CD1 TYR A 893 7920 9227 7250 2156 639 -1196 C ATOM 12175 CD2 TYR A 893 -16.694 3.609 -24.103 1.00 62.45 C ANISOU12175 CD2 TYR A 893 7759 8940 7030 2376 624 -997 C ATOM 12176 CE1 TYR A 893 -17.362 3.144 -26.741 1.00 65.75 C ANISOU12176 CE1 TYR A 893 8128 9292 7561 2163 720 -1185 C ATOM 12177 CE2 TYR A 893 -17.654 2.658 -24.419 1.00 62.21 C ANISOU12177 CE2 TYR A 893 7737 8765 7135 2375 715 -971 C ATOM 12178 CZ TYR A 893 -17.981 2.431 -25.735 1.00 64.30 C ANISOU12178 CZ TYR A 893 7973 8995 7463 2269 760 -1074 C ATOM 12179 OH TYR A 893 -18.935 1.487 -26.040 1.00 72.18 O ANISOU12179 OH TYR A 893 8966 9850 8610 2274 848 -1070 O ATOM 12180 H TYR A 893 -13.849 7.466 -24.050 1.00 66.12 H ATOM 12181 HA TYR A 893 -15.765 6.968 -25.777 1.00 69.10 H ATOM 12182 HB2 TYR A 893 -14.264 5.286 -25.370 1.00 73.31 H ATOM 12183 HB3 TYR A 893 -14.702 5.220 -23.844 1.00 73.31 H ATOM 12184 HD1 TYR A 893 -15.986 4.570 -27.098 1.00 77.05 H ATOM 12185 HD2 TYR A 893 -16.475 3.758 -23.211 1.00 74.94 H ATOM 12186 HE1 TYR A 893 -17.585 2.989 -27.630 1.00 78.90 H ATOM 12187 HE2 TYR A 893 -18.073 2.176 -23.743 1.00 74.65 H ATOM 12188 HH TYR A 893 -19.225 1.134 -25.335 1.00 86.62 H ATOM 12189 N ASN A 894 -16.845 7.436 -22.850 1.00 87.18 N ANISOU12189 N ASN A 894 10952 12304 9867 2325 414 -921 N ATOM 12190 CA ASN A 894 -18.079 7.528 -22.072 1.00 87.22 C ANISOU12190 CA ASN A 894 11036 12233 9870 2384 433 -782 C ATOM 12191 C ASN A 894 -18.790 8.866 -22.271 1.00 83.14 C ANISOU12191 C ASN A 894 10545 11726 9318 2306 411 -762 C ATOM 12192 O ASN A 894 -20.018 8.922 -22.329 1.00 88.55 O ANISOU12192 O ASN A 894 11280 12329 10036 2295 453 -675 O ATOM 12193 CB ASN A 894 -17.819 7.255 -20.591 1.00 93.01 C ANISOU12193 CB ASN A 894 11809 12998 10533 2541 400 -697 C ATOM 12194 CG ASN A 894 -18.838 6.300 -19.995 1.00 99.67 C ANISOU12194 CG ASN A 894 12715 13723 11430 2624 476 -557 C ATOM 12195 OD1 ASN A 894 -18.824 5.102 -20.282 1.00100.18 O ANISOU12195 OD1 ASN A 894 12759 13709 11596 2642 545 -558 O ATOM 12196 ND2 ASN A 894 -19.733 6.827 -19.165 1.00 96.41 N ANISOU12196 ND2 ASN A 894 12375 13291 10964 2671 475 -438 N ATOM 12197 H ASN A 894 -16.146 7.746 -22.456 1.00104.61 H ATOM 12198 HA ASN A 894 -18.683 6.837 -22.386 1.00104.66 H ATOM 12199 HB2 ASN A 894 -16.939 6.859 -20.491 1.00111.61 H ATOM 12200 HB3 ASN A 894 -17.866 8.091 -20.101 1.00111.61 H ATOM 12201 HD21 ASN A 894 -20.330 6.327 -18.802 1.00115.69 H ATOM 12202 HD22 ASN A 894 -19.714 7.669 -18.991 1.00115.69 H ATOM 12203 N ASP A 895 -18.013 9.937 -22.390 1.00 62.39 N ANISOU12203 N ASP A 895 7877 9193 6634 2254 354 -844 N ATOM 12204 CA ASP A 895 -18.559 11.253 -22.720 1.00 63.62 C ANISOU12204 CA ASP A 895 8047 9353 6772 2168 349 -840 C ATOM 12205 C ASP A 895 -19.121 11.268 -24.143 1.00 62.76 C ANISOU12205 C ASP A 895 7926 9210 6709 2044 406 -869 C ATOM 12206 O ASP A 895 -20.254 11.700 -24.362 1.00 66.17 O ANISOU12206 O ASP A 895 8401 9591 7151 2017 434 -798 O ATOM 12207 CB ASP A 895 -17.480 12.341 -22.586 1.00 65.28 C ANISOU12207 CB ASP A 895 8204 9666 6935 2133 293 -941 C ATOM 12208 CG ASP A 895 -17.187 12.710 -21.138 1.00 67.02 C ANISOU12208 CG ASP A 895 8441 9934 7089 2256 226 -918 C ATOM 12209 OD1 ASP A 895 -17.654 11.992 -20.228 1.00 63.15 O ANISOU12209 OD1 ASP A 895 8008 9413 6574 2377 223 -817 O ATOM 12210 OD2 ASP A 895 -16.478 13.718 -20.915 1.00 63.27 O ANISOU12210 OD2 ASP A 895 7921 9534 6584 2232 182 -1006 O ATOM 12211 H ASP A 895 -17.159 9.930 -22.286 1.00 74.86 H ATOM 12212 HA ASP A 895 -19.280 11.462 -22.106 1.00 76.34 H ATOM 12213 HB2 ASP A 895 -16.657 12.020 -22.986 1.00 78.34 H ATOM 12214 HB3 ASP A 895 -17.781 13.141 -23.044 1.00 78.34 H ATOM 12215 N TYR A 896 -18.331 10.783 -25.102 1.00 47.22 N ANISOU12215 N TYR A 896 5899 7282 4760 1978 420 -972 N ATOM 12216 CA TYR A 896 -18.652 10.938 -26.525 1.00 43.82 C ANISOU12216 CA TYR A 896 5450 6860 4339 1857 463 -1021 C ATOM 12217 C TYR A 896 -18.640 9.648 -27.355 1.00 46.02 C ANISOU12217 C TYR A 896 5706 7112 4668 1844 506 -1076 C ATOM 12218 O TYR A 896 -18.689 9.712 -28.586 1.00 41.51 O ANISOU12218 O TYR A 896 5112 6578 4084 1747 532 -1140 O ATOM 12219 CB TYR A 896 -17.653 11.891 -27.175 1.00 40.39 C ANISOU12219 CB TYR A 896 4963 6523 3862 1760 450 -1114 C ATOM 12220 CG TYR A 896 -17.454 13.205 -26.465 1.00 45.54 C ANISOU12220 CG TYR A 896 5619 7204 4478 1761 418 -1101 C ATOM 12221 CD1 TYR A 896 -18.528 13.917 -25.945 1.00 37.65 C ANISOU12221 CD1 TYR A 896 4682 6152 3471 1784 421 -1006 C ATOM 12222 CD2 TYR A 896 -16.184 13.742 -26.329 1.00 44.17 C ANISOU12222 CD2 TYR A 896 5384 7113 4286 1741 389 -1195 C ATOM 12223 CE1 TYR A 896 -18.332 15.131 -25.306 1.00 38.47 C ANISOU12223 CE1 TYR A 896 4790 6277 3550 1785 399 -1013 C ATOM 12224 CE2 TYR A 896 -15.980 14.940 -25.695 1.00 38.14 C ANISOU12224 CE2 TYR A 896 4617 6374 3499 1740 366 -1209 C ATOM 12225 CZ TYR A 896 -17.048 15.632 -25.189 1.00 37.47 C ANISOU12225 CZ TYR A 896 4600 6229 3409 1761 372 -1122 C ATOM 12226 OH TYR A 896 -16.799 16.827 -24.568 1.00 41.35 O ANISOU12226 OH TYR A 896 5086 6742 3883 1760 355 -1156 O ATOM 12227 H TYR A 896 -17.598 10.358 -24.955 1.00 56.66 H ATOM 12228 HA TYR A 896 -19.535 11.333 -26.603 1.00 52.58 H ATOM 12229 HB2 TYR A 896 -16.790 11.450 -27.217 1.00 48.47 H ATOM 12230 HB3 TYR A 896 -17.958 12.090 -28.074 1.00 48.47 H ATOM 12231 HD1 TYR A 896 -19.390 13.577 -26.030 1.00 45.18 H ATOM 12232 HD2 TYR A 896 -15.454 13.280 -26.673 1.00 53.01 H ATOM 12233 HE1 TYR A 896 -19.054 15.602 -24.960 1.00 46.17 H ATOM 12234 HE2 TYR A 896 -15.120 15.285 -25.614 1.00 45.76 H ATOM 12235 HH TYR A 896 -15.976 16.990 -24.579 1.00 49.62 H ATOM 12236 N GLY A 897 -18.569 8.489 -26.709 1.00 50.38 N ANISOU12236 N GLY A 897 6265 7602 5275 1941 520 -1054 N ATOM 12237 CA GLY A 897 -18.417 7.230 -27.425 1.00 49.55 C ANISOU12237 CA GLY A 897 6132 7460 5236 1935 571 -1124 C ATOM 12238 C GLY A 897 -19.453 6.968 -28.503 1.00 48.85 C ANISOU12238 C GLY A 897 6049 7333 5178 1868 618 -1150 C ATOM 12239 O GLY A 897 -19.113 6.662 -29.649 1.00 47.57 O ANISOU12239 O GLY A 897 5851 7216 5008 1794 636 -1257 O ATOM 12240 H GLY A 897 -18.606 8.405 -25.853 1.00 60.46 H ATOM 12241 HA2 GLY A 897 -17.542 7.211 -27.843 1.00 59.46 H ATOM 12242 HA3 GLY A 897 -18.460 6.500 -26.788 1.00 59.46 H ATOM 12243 N ASP A 898 -20.723 7.094 -28.139 1.00 48.01 N ANISOU12243 N ASP A 898 5986 7157 5099 1901 634 -1055 N ATOM 12244 CA ASP A 898 -21.808 6.740 -29.046 1.00 47.12 C ANISOU12244 CA ASP A 898 5870 7010 5024 1862 676 -1082 C ATOM 12245 C ASP A 898 -21.946 7.722 -30.213 1.00 44.56 C ANISOU12245 C ASP A 898 5533 6802 4596 1749 651 -1134 C ATOM 12246 O ASP A 898 -22.350 7.328 -31.307 1.00 52.08 O ANISOU12246 O ASP A 898 6461 7786 5543 1696 670 -1219 O ATOM 12247 CB ASP A 898 -23.127 6.638 -28.281 1.00 54.44 C ANISOU12247 CB ASP A 898 6838 7830 6017 1937 704 -955 C ATOM 12248 CG ASP A 898 -23.402 7.863 -27.438 1.00 60.76 C ANISOU12248 CG ASP A 898 7687 8655 6744 1959 661 -834 C ATOM 12249 OD1 ASP A 898 -22.425 8.459 -26.931 1.00 66.46 O ANISOU12249 OD1 ASP A 898 8412 9439 7402 1960 613 -838 O ATOM 12250 OD2 ASP A 898 -24.588 8.233 -27.282 1.00 56.03 O ANISOU12250 OD2 ASP A 898 7119 8012 6156 1979 678 -740 O ATOM 12251 H ASP A 898 -20.984 7.383 -27.372 1.00 57.61 H ATOM 12252 HA ASP A 898 -21.621 5.866 -29.421 1.00 56.54 H ATOM 12253 HB2 ASP A 898 -23.854 6.540 -28.915 1.00 65.33 H ATOM 12254 HB3 ASP A 898 -23.093 5.869 -27.692 1.00 65.33 H ATOM 12255 N ILE A 899 -21.609 8.991 -29.986 1.00 35.04 N ANISOU12255 N ILE A 899 4341 5664 3310 1713 612 -1088 N ATOM 12256 CA ILE A 899 -21.665 9.995 -31.054 1.00 35.29 C ANISOU12256 CA ILE A 899 4360 5803 3247 1605 601 -1117 C ATOM 12257 C ILE A 899 -20.545 9.768 -32.059 1.00 38.86 C ANISOU12257 C ILE A 899 4762 6343 3661 1524 602 -1240 C ATOM 12258 O ILE A 899 -20.746 9.906 -33.265 1.00 42.22 O ANISOU12258 O ILE A 899 5169 6851 4024 1443 610 -1293 O ATOM 12259 CB ILE A 899 -21.573 11.444 -30.512 1.00 33.19 C ANISOU12259 CB ILE A 899 4119 5563 2929 1590 578 -1038 C ATOM 12260 CG1 ILE A 899 -22.784 11.742 -29.626 1.00 30.76 C ANISOU12260 CG1 ILE A 899 3865 5174 2647 1669 581 -910 C ATOM 12261 CG2 ILE A 899 -21.503 12.461 -31.667 1.00 35.09 C ANISOU12261 CG2 ILE A 899 4343 5912 3079 1476 587 -1061 C ATOM 12262 CD1 ILE A 899 -22.728 13.075 -28.902 1.00 36.85 C ANISOU12262 CD1 ILE A 899 4666 5950 3384 1674 562 -838 C ATOM 12263 H ILE A 899 -21.347 9.297 -29.226 1.00 42.05 H ATOM 12264 HA ILE A 899 -22.509 9.906 -31.523 1.00 42.35 H ATOM 12265 HB ILE A 899 -20.769 11.526 -29.976 1.00 39.83 H ATOM 12266 HG12 ILE A 899 -23.580 11.742 -30.179 1.00 36.91 H ATOM 12267 HG13 ILE A 899 -22.854 11.046 -28.954 1.00 36.91 H ATOM 12268 HG21 ILE A 899 -21.447 13.356 -31.297 1.00 42.11 H ATOM 12269 HG22 ILE A 899 -20.717 12.274 -32.204 1.00 42.11 H ATOM 12270 HG23 ILE A 899 -22.302 12.377 -32.210 1.00 42.11 H ATOM 12271 HD11 ILE A 899 -23.531 13.178 -28.368 1.00 44.22 H ATOM 12272 HD12 ILE A 899 -21.945 13.090 -28.330 1.00 44.22 H ATOM 12273 HD13 ILE A 899 -22.672 13.787 -29.558 1.00 44.22 H ATOM 12274 N ILE A 900 -19.363 9.428 -31.560 1.00 52.58 N ANISOU12274 N ILE A 900 6476 8073 5428 1553 593 -1279 N ATOM 12275 CA ILE A 900 -18.234 9.134 -32.430 1.00 52.37 C ANISOU12275 CA ILE A 900 6398 8123 5377 1493 601 -1389 C ATOM 12276 C ILE A 900 -18.455 7.799 -33.135 1.00 50.71 C ANISOU12276 C ILE A 900 6173 7886 5209 1501 631 -1476 C ATOM 12277 O ILE A 900 -18.055 7.629 -34.285 1.00 51.91 O ANISOU12277 O ILE A 900 6293 8117 5314 1429 641 -1568 O ATOM 12278 CB ILE A 900 -16.907 9.137 -31.638 1.00 46.37 C ANISOU12278 CB ILE A 900 5607 7373 4638 1537 580 -1409 C ATOM 12279 CG1 ILE A 900 -16.524 10.573 -31.276 1.00 47.20 C ANISOU12279 CG1 ILE A 900 5707 7532 4693 1502 554 -1372 C ATOM 12280 CG2 ILE A 900 -15.768 8.517 -32.444 1.00 46.53 C ANISOU12280 CG2 ILE A 900 5571 7455 4655 1504 597 -1522 C ATOM 12281 CD1 ILE A 900 -15.433 10.680 -30.219 1.00 51.06 C ANISOU12281 CD1 ILE A 900 6164 8036 5200 1568 517 -1388 C ATOM 12282 H ILE A 900 -19.189 9.360 -30.721 1.00 63.09 H ATOM 12283 HA ILE A 900 -18.176 9.824 -33.110 1.00 62.85 H ATOM 12284 HB ILE A 900 -17.027 8.629 -30.821 1.00 55.64 H ATOM 12285 HG12 ILE A 900 -16.205 11.021 -32.075 1.00 56.63 H ATOM 12286 HG13 ILE A 900 -17.310 11.029 -30.936 1.00 56.63 H ATOM 12287 HG21 ILE A 900 -14.957 8.539 -31.912 1.00 55.84 H ATOM 12288 HG22 ILE A 900 -15.997 7.600 -32.660 1.00 55.84 H ATOM 12289 HG23 ILE A 900 -15.643 9.028 -33.259 1.00 55.84 H ATOM 12290 HD11 ILE A 900 -15.251 11.617 -30.049 1.00 61.27 H ATOM 12291 HD12 ILE A 900 -15.739 10.249 -29.406 1.00 61.27 H ATOM 12292 HD13 ILE A 900 -14.633 10.241 -30.547 1.00 61.27 H ATOM 12293 N LYS A 901 -19.110 6.863 -32.457 1.00 48.98 N ANISOU12293 N LYS A 901 5976 7552 5081 1589 652 -1449 N ATOM 12294 CA LYS A 901 -19.372 5.551 -33.039 1.00 51.40 C ANISOU12294 CA LYS A 901 6266 7808 5457 1605 693 -1544 C ATOM 12295 C LYS A 901 -20.349 5.653 -34.206 1.00 54.30 C ANISOU12295 C LYS A 901 6625 8235 5771 1533 690 -1603 C ATOM 12296 O LYS A 901 -20.267 4.880 -35.161 1.00 60.55 O ANISOU12296 O LYS A 901 7385 9054 6566 1498 703 -1731 O ATOM 12297 CB LYS A 901 -19.922 4.594 -31.981 1.00 60.22 C ANISOU12297 CB LYS A 901 7404 8769 6708 1720 735 -1485 C ATOM 12298 CG LYS A 901 -20.213 3.197 -32.506 1.00 64.41 C ANISOU12298 CG LYS A 901 7912 9214 7348 1743 796 -1589 C ATOM 12299 CD LYS A 901 -20.715 2.267 -31.404 1.00 69.89 C ANISOU12299 CD LYS A 901 8619 9731 8205 1859 859 -1510 C ATOM 12300 CE LYS A 901 -19.622 1.924 -30.389 1.00 72.02 C ANISOU12300 CE LYS A 901 8887 9968 8509 1936 867 -1455 C ATOM 12301 NZ LYS A 901 -20.078 0.935 -29.365 1.00 72.69 N ANISOU12301 NZ LYS A 901 8975 9883 8760 2047 937 -1370 N ATOM 12302 H LYS A 901 -19.414 6.962 -31.658 1.00 58.77 H ATOM 12303 HA LYS A 901 -18.540 5.182 -33.375 1.00 61.68 H ATOM 12304 HB2 LYS A 901 -19.272 4.512 -31.266 1.00 72.27 H ATOM 12305 HB3 LYS A 901 -20.750 4.958 -31.631 1.00 72.27 H ATOM 12306 HG2 LYS A 901 -20.896 3.250 -33.192 1.00 77.30 H ATOM 12307 HG3 LYS A 901 -19.399 2.818 -32.874 1.00 77.30 H ATOM 12308 HD2 LYS A 901 -21.441 2.701 -30.929 1.00 83.87 H ATOM 12309 HD3 LYS A 901 -21.026 1.440 -31.804 1.00 83.87 H ATOM 12310 HE2 LYS A 901 -18.863 1.542 -30.858 1.00 86.42 H ATOM 12311 HE3 LYS A 901 -19.354 2.733 -29.927 1.00 86.42 H ATOM 12312 HZ1 LYS A 901 -19.417 0.762 -28.795 1.00 87.22 H ATOM 12313 HZ2 LYS A 901 -20.771 1.263 -28.913 1.00 87.22 H ATOM 12314 HZ3 LYS A 901 -20.324 0.178 -29.762 1.00 87.22 H ATOM 12315 N GLU A 902 -21.275 6.602 -34.122 1.00 61.54 N ANISOU12315 N GLU A 902 7568 9181 6633 1515 668 -1516 N ATOM 12316 CA GLU A 902 -22.271 6.785 -35.170 1.00 65.23 C ANISOU12316 CA GLU A 902 8022 9730 7033 1456 655 -1562 C ATOM 12317 C GLU A 902 -21.669 7.520 -36.364 1.00 70.72 C ANISOU12317 C GLU A 902 8693 10587 7590 1343 629 -1610 C ATOM 12318 O GLU A 902 -22.064 7.291 -37.506 1.00 74.30 O ANISOU12318 O GLU A 902 9116 11136 7977 1284 615 -1702 O ATOM 12319 CB GLU A 902 -23.485 7.549 -34.633 1.00 67.33 C ANISOU12319 CB GLU A 902 8321 9974 7287 1491 647 -1436 C ATOM 12320 CG GLU A 902 -24.693 7.526 -35.565 1.00 72.43 C ANISOU12320 CG GLU A 902 8941 10699 7879 1459 633 -1488 C ATOM 12321 CD GLU A 902 -25.322 6.146 -35.688 1.00 83.30 C ANISOU12321 CD GLU A 902 10280 11990 9380 1510 659 -1607 C ATOM 12322 OE1 GLU A 902 -25.084 5.294 -34.804 1.00 85.51 O ANISOU12322 OE1 GLU A 902 10571 12111 9809 1592 706 -1591 O ATOM 12323 OE2 GLU A 902 -26.054 5.913 -36.674 1.00 85.88 O ANISOU12323 OE2 GLU A 902 10559 12409 9661 1464 633 -1721 O ATOM 12324 H GLU A 902 -21.347 7.155 -33.467 1.00 73.84 H ATOM 12325 HA GLU A 902 -22.574 5.915 -35.474 1.00 78.27 H ATOM 12326 HB2 GLU A 902 -23.754 7.154 -33.789 1.00 80.80 H ATOM 12327 HB3 GLU A 902 -23.234 8.476 -34.497 1.00 80.80 H ATOM 12328 HG2 GLU A 902 -25.368 8.132 -35.221 1.00 86.91 H ATOM 12329 HG3 GLU A 902 -24.414 7.807 -36.450 1.00 86.91 H ATOM 12330 N THR A 903 -20.717 8.409 -36.097 1.00 46.49 N ANISOU12330 N THR A 903 5631 7551 4482 1315 626 -1550 N ATOM 12331 CA THR A 903 -20.039 9.139 -37.160 1.00 44.88 C ANISOU12331 CA THR A 903 5403 7484 4167 1217 623 -1578 C ATOM 12332 C THR A 903 -19.215 8.176 -38.005 1.00 51.52 C ANISOU12332 C THR A 903 6201 8367 5008 1192 635 -1717 C ATOM 12333 O THR A 903 -19.075 8.358 -39.215 1.00 54.13 O ANISOU12333 O THR A 903 6506 8821 5239 1117 635 -1771 O ATOM 12334 CB THR A 903 -19.105 10.216 -36.594 1.00 39.18 C ANISOU12334 CB THR A 903 4684 6768 3434 1202 630 -1507 C ATOM 12335 OG1 THR A 903 -19.833 11.060 -35.696 1.00 40.40 O ANISOU12335 OG1 THR A 903 4881 6869 3602 1236 621 -1387 O ATOM 12336 CG2 THR A 903 -18.513 11.064 -37.714 1.00 38.65 C ANISOU12336 CG2 THR A 903 4590 6835 3258 1105 649 -1519 C ATOM 12337 H THR A 903 -20.444 8.606 -35.305 1.00 55.78 H ATOM 12338 HA THR A 903 -20.696 9.568 -37.731 1.00 53.86 H ATOM 12339 HB THR A 903 -18.377 9.790 -36.115 1.00 47.02 H ATOM 12340 HG1 THR A 903 -19.326 11.652 -35.383 1.00 48.49 H ATOM 12341 HG21 THR A 903 -17.925 11.740 -37.342 1.00 46.37 H ATOM 12342 HG22 THR A 903 -18.005 10.503 -38.321 1.00 46.37 H ATOM 12343 HG23 THR A 903 -19.224 11.502 -38.209 1.00 46.37 H HETATM12344 N MSE A 904 -18.670 7.152 -37.355 1.00 71.22 N ANISOU12344 N MSE A 904 8689 10762 7610 1262 651 -1766 N HETATM12345 CA MSE A 904 -17.909 6.116 -38.041 1.00 70.52 C ANISOU12345 CA MSE A 904 8562 10692 7540 1256 670 -1899 C HETATM12346 C MSE A 904 -18.818 5.273 -38.928 1.00 76.55 C ANISOU12346 C MSE A 904 9312 11475 8299 1237 665 -2012 C HETATM12347 O MSE A 904 -18.476 4.969 -40.069 1.00 81.78 O ANISOU12347 O MSE A 904 9941 12235 8896 1181 664 -2122 O HETATM12348 CB MSE A 904 -17.193 5.225 -37.023 1.00 66.13 C ANISOU12348 CB MSE A 904 8005 10015 7106 1349 695 -1908 C HETATM12349 CG MSE A 904 -15.994 5.888 -36.363 1.00 67.32 C ANISOU12349 CG MSE A 904 8142 10187 7249 1362 689 -1852 C HETATM12350 SE MSE A 904 -15.315 4.905 -34.824 1.00 99.14 SE ANISOU12350 SE MSE A 904 12173 14081 11415 1502 704 -1824 SE HETATM12351 CE MSE A 904 -15.429 3.091 -35.533 1.00 79.84 C ANISOU12351 CE MSE A 904 9714 11559 9061 1537 763 -1964 C HETATM12352 H MSE A 904 -18.729 7.034 -36.505 1.00 85.47 H HETATM12353 HA MSE A 904 -17.233 6.537 -38.595 1.00 84.63 H HETATM12354 HB2 MSE A 904 -17.821 4.983 -36.323 1.00 79.35 H HETATM12355 HB3 MSE A 904 -16.880 4.425 -37.473 1.00 79.35 H HETATM12356 HG2 MSE A 904 -15.276 5.956 -37.012 1.00 80.78 H HETATM12357 HG3 MSE A 904 -16.251 6.773 -36.061 1.00 80.78 H HETATM12358 HE1 MSE A 904 -15.115 2.469 -34.859 1.00 95.80 H HETATM12359 HE2 MSE A 904 -16.353 2.898 -35.758 1.00 95.80 H HETATM12360 HE3 MSE A 904 -14.875 3.028 -36.327 1.00 95.80 H ATOM 12361 N SER A 905 -19.977 4.895 -38.401 1.00 62.17 N ANISOU12361 N SER A 905 7510 9563 6548 1287 662 -1995 N ATOM 12362 CA SER A 905 -20.935 4.101 -39.164 1.00 66.70 C ANISOU12362 CA SER A 905 8055 10150 7136 1271 650 -2124 C ATOM 12363 C SER A 905 -21.511 4.865 -40.351 1.00 65.66 C ANISOU12363 C SER A 905 7904 10199 6844 1176 602 -2146 C ATOM 12364 O SER A 905 -21.553 4.345 -41.466 1.00 64.68 O ANISOU12364 O SER A 905 7739 10168 6667 1125 583 -2290 O ATOM 12365 CB SER A 905 -22.061 3.611 -38.256 1.00 62.50 C ANISOU12365 CB SER A 905 7539 9474 6735 1354 668 -2092 C ATOM 12366 OG SER A 905 -21.598 2.556 -37.430 1.00 68.76 O ANISOU12366 OG SER A 905 8340 10099 7688 1443 725 -2103 O ATOM 12367 H SER A 905 -20.234 5.086 -37.603 1.00 74.60 H ATOM 12368 HA SER A 905 -20.479 3.319 -39.513 1.00 80.03 H ATOM 12369 HB2 SER A 905 -22.361 4.344 -37.697 1.00 75.00 H ATOM 12370 HB3 SER A 905 -22.793 3.287 -38.804 1.00 75.00 H ATOM 12371 HG SER A 905 -22.218 2.288 -36.932 1.00 82.52 H ATOM 12372 N LYS A 906 -21.943 6.100 -40.121 1.00 67.59 N ANISOU12372 N LYS A 906 8177 10497 7006 1157 584 -2002 N ATOM 12373 CA LYS A 906 -22.533 6.895 -41.192 1.00 65.83 C ANISOU12373 CA LYS A 906 7940 10448 6625 1078 545 -1989 C ATOM 12374 C LYS A 906 -21.508 7.286 -42.256 1.00 60.53 C ANISOU12374 C LYS A 906 7250 9911 5837 1004 553 -2014 C ATOM 12375 O LYS A 906 -21.863 7.904 -43.256 1.00 65.24 O ANISOU12375 O LYS A 906 7835 10663 6292 943 529 -1997 O ATOM 12376 CB LYS A 906 -23.215 8.154 -40.638 1.00 65.84 C ANISOU12376 CB LYS A 906 7979 10460 6578 1085 538 -1811 C ATOM 12377 CG LYS A 906 -24.456 7.919 -39.756 1.00 67.84 C ANISOU12377 CG LYS A 906 8245 10614 6916 1163 533 -1772 C ATOM 12378 CD LYS A 906 -25.517 7.010 -40.380 1.00 65.53 C ANISOU12378 CD LYS A 906 7900 10363 6634 1161 499 -1924 C ATOM 12379 CE LYS A 906 -26.383 7.742 -41.396 1.00 67.29 C ANISOU12379 CE LYS A 906 8099 10784 6686 1094 442 -1906 C ATOM 12380 NZ LYS A 906 -27.079 6.786 -42.302 1.00 66.98 N ANISOU12380 NZ LYS A 906 7988 10827 6635 1061 389 -2113 N ATOM 12381 H LYS A 906 -21.906 6.499 -39.360 1.00 81.10 H ATOM 12382 HA LYS A 906 -23.216 6.362 -41.629 1.00 79.00 H ATOM 12383 HB2 LYS A 906 -22.569 8.641 -40.103 1.00 79.01 H ATOM 12384 HB3 LYS A 906 -23.493 8.705 -41.387 1.00 79.01 H ATOM 12385 HG2 LYS A 906 -24.171 7.510 -38.923 1.00 81.41 H ATOM 12386 HG3 LYS A 906 -24.873 8.776 -39.573 1.00 81.41 H ATOM 12387 HD2 LYS A 906 -25.078 6.274 -40.834 1.00 78.63 H ATOM 12388 HD3 LYS A 906 -26.097 6.671 -39.680 1.00 78.63 H ATOM 12389 HE2 LYS A 906 -27.054 8.264 -40.929 1.00 80.75 H ATOM 12390 HE3 LYS A 906 -25.822 8.321 -41.937 1.00 80.75 H ATOM 12391 HZ1 LYS A 906 -27.579 7.231 -42.888 1.00 80.38 H ATOM 12392 HZ2 LYS A 906 -26.482 6.296 -42.745 1.00 80.38 H ATOM 12393 HZ3 LYS A 906 -27.603 6.244 -41.828 1.00 80.38 H ATOM 12394 N THR A 907 -20.243 6.932 -42.043 1.00 47.47 N ANISOU12394 N THR A 907 5593 8205 4240 1019 591 -2047 N ATOM 12395 CA THR A 907 -19.218 7.132 -43.064 1.00 51.91 C ANISOU12395 CA THR A 907 6129 8888 4707 963 612 -2091 C ATOM 12396 C THR A 907 -18.865 5.799 -43.718 1.00 58.75 C ANISOU12396 C THR A 907 6957 9759 5605 969 615 -2274 C ATOM 12397 O THR A 907 -18.398 5.762 -44.856 1.00 61.91 O ANISOU12397 O THR A 907 7329 10289 5903 923 622 -2347 O ATOM 12398 CB THR A 907 -17.952 7.810 -42.498 1.00 47.98 C ANISOU12398 CB THR A 907 5639 8359 4234 968 655 -2008 C ATOM 12399 OG1 THR A 907 -17.592 7.210 -41.248 1.00 49.40 O ANISOU12399 OG1 THR A 907 5829 8382 4560 1044 663 -2005 O ATOM 12400 CG2 THR A 907 -18.197 9.303 -42.290 1.00 45.57 C ANISOU12400 CG2 THR A 907 5360 8093 3861 935 660 -1852 C ATOM 12401 H THR A 907 -19.952 6.575 -41.317 1.00 56.97 H ATOM 12402 HA THR A 907 -19.578 7.711 -43.754 1.00 62.30 H ATOM 12403 HB THR A 907 -17.222 7.705 -43.128 1.00 57.58 H ATOM 12404 HG1 THR A 907 -18.219 7.299 -40.696 1.00 59.28 H ATOM 12405 HG21 THR A 907 -17.398 9.723 -41.934 1.00 54.68 H ATOM 12406 HG22 THR A 907 -18.425 9.723 -43.134 1.00 54.68 H ATOM 12407 HG23 THR A 907 -18.927 9.435 -41.665 1.00 54.68 H ATOM 12408 N ARG A 908 -19.101 4.704 -43.001 1.00101.84 N ANISOU12408 N ARG A 908 12414 15072 11208 1033 619 -2348 N ATOM 12409 CA ARG A 908 -18.946 3.375 -43.578 1.00103.29 C ANISOU12409 CA ARG A 908 12561 15238 11446 1042 626 -2536 C ATOM 12410 C ARG A 908 -20.058 3.135 -44.593 1.00110.09 C ANISOU12410 C ARG A 908 13390 16208 12230 991 573 -2652 C ATOM 12411 O ARG A 908 -19.808 2.699 -45.718 1.00113.57 O ANISOU12411 O ARG A 908 13795 16759 12597 951 563 -2787 O ATOM 12412 CB ARG A 908 -19.001 2.304 -42.489 1.00101.34 C ANISOU12412 CB ARG A 908 12324 14789 11391 1131 657 -2569 C ATOM 12413 CG ARG A 908 -18.807 0.893 -43.014 1.00109.62 C ANISOU12413 CG ARG A 908 13336 15791 12525 1145 678 -2766 C ATOM 12414 CD ARG A 908 -18.821 -0.133 -41.896 1.00113.69 C ANISOU12414 CD ARG A 908 13866 16089 13244 1244 729 -2772 C ATOM 12415 NE ARG A 908 -20.124 -0.228 -41.241 1.00119.78 N ANISOU12415 NE ARG A 908 14647 16755 14108 1277 719 -2741 N ATOM 12416 CZ ARG A 908 -21.134 -0.979 -41.674 1.00119.93 C ANISOU12416 CZ ARG A 908 14626 16736 14206 1261 703 -2893 C ATOM 12417 NH1 ARG A 908 -21.016 -1.707 -42.778 1.00118.07 N ANISOU12417 NH1 ARG A 908 14340 16564 13956 1207 687 -3095 N ATOM 12418 NH2 ARG A 908 -22.276 -0.997 -41.001 1.00115.58 N ANISOU12418 NH2 ARG A 908 14077 16082 13756 1299 704 -2853 N ATOM 12419 H ARG A 908 -19.351 4.705 -42.178 1.00122.20 H ATOM 12420 HA ARG A 908 -18.092 3.313 -44.032 1.00123.94 H ATOM 12421 HB2 ARG A 908 -18.300 2.479 -41.842 1.00121.61 H ATOM 12422 HB3 ARG A 908 -19.868 2.343 -42.055 1.00121.61 H ATOM 12423 HG2 ARG A 908 -19.526 0.680 -43.630 1.00131.55 H ATOM 12424 HG3 ARG A 908 -17.951 0.836 -43.467 1.00131.55 H ATOM 12425 HD2 ARG A 908 -18.605 -1.005 -42.262 1.00136.43 H ATOM 12426 HD3 ARG A 908 -18.166 0.118 -41.226 1.00136.43 H ATOM 12427 HE ARG A 908 -20.247 0.234 -40.527 1.00143.73 H ATOM 12428 HH11 ARG A 908 -20.278 -1.702 -43.220 1.00141.68 H ATOM 12429 HH12 ARG A 908 -21.675 -2.188 -43.049 1.00141.68 H ATOM 12430 HH21 ARG A 908 -22.361 -0.526 -40.287 1.00138.70 H ATOM 12431 HH22 ARG A 908 -22.932 -1.478 -41.280 1.00138.70 H ATOM 12432 N GLN A 909 -21.286 3.436 -44.180 1.00111.00 N ANISOU12432 N GLN A 909 13514 16301 12360 998 536 -2603 N ATOM 12433 CA GLN A 909 -22.470 3.240 -45.013 1.00107.87 C ANISOU12433 CA GLN A 909 13076 16012 11900 953 472 -2717 C ATOM 12434 C GLN A 909 -22.539 4.237 -46.171 1.00104.73 C ANISOU12434 C GLN A 909 12671 15841 11281 882 434 -2662 C ATOM 12435 O GLN A 909 -23.399 4.119 -47.044 1.00112.93 O ANISOU12435 O GLN A 909 13667 17010 12230 841 371 -2757 O ATOM 12436 CB GLN A 909 -23.731 3.378 -44.156 1.00104.63 C ANISOU12436 CB GLN A 909 12671 15515 11566 991 451 -2663 C ATOM 12437 CG GLN A 909 -23.877 2.314 -43.078 1.00112.06 C ANISOU12437 CG GLN A 909 13614 16225 12738 1074 498 -2720 C ATOM 12438 CD GLN A 909 -24.965 2.643 -42.071 1.00115.99 C ANISOU12438 CD GLN A 909 14129 16627 13317 1132 501 -2617 C ATOM 12439 OE1 GLN A 909 -25.653 3.659 -42.188 1.00114.53 O ANISOU12439 OE1 GLN A 909 13952 16557 13007 1108 461 -2513 O ATOM 12440 NE2 GLN A 909 -25.123 1.782 -41.072 1.00115.92 N ANISOU12440 NE2 GLN A 909 14123 16402 13521 1220 560 -2631 N ATOM 12441 H GLN A 909 -21.463 3.762 -43.405 1.00133.20 H ATOM 12442 HA GLN A 909 -22.453 2.344 -45.385 1.00129.45 H ATOM 12443 HB2 GLN A 909 -23.714 4.243 -43.716 1.00125.55 H ATOM 12444 HB3 GLN A 909 -24.507 3.320 -44.734 1.00125.55 H ATOM 12445 HG2 GLN A 909 -24.102 1.469 -43.496 1.00134.47 H ATOM 12446 HG3 GLN A 909 -23.038 2.234 -42.597 1.00134.47 H ATOM 12447 HE21 GLN A 909 -24.623 1.084 -41.022 1.00139.11 H ATOM 12448 HE22 GLN A 909 -25.726 1.922 -40.475 1.00139.11 H ATOM 12449 N ILE A 910 -21.635 5.215 -46.170 1.00 79.62 N ANISOU12449 N ILE A 910 9526 12705 8021 869 474 -2510 N ATOM 12450 CA ILE A 910 -21.636 6.290 -47.164 1.00 80.64 C ANISOU12450 CA ILE A 910 9657 13027 7955 814 462 -2419 C ATOM 12451 C ILE A 910 -20.493 6.103 -48.155 1.00 85.01 C ANISOU12451 C ILE A 910 10192 13680 8426 789 500 -2492 C ATOM 12452 O ILE A 910 -20.630 6.407 -49.340 1.00 89.35 O ANISOU12452 O ILE A 910 10724 14413 8812 752 481 -2512 O ATOM 12453 CB ILE A 910 -21.548 7.680 -46.472 1.00 80.58 C ANISOU12453 CB ILE A 910 9698 12995 7923 815 491 -2191 C ATOM 12454 CG1 ILE A 910 -22.952 8.219 -46.187 1.00 84.66 C ANISOU12454 CG1 ILE A 910 10224 13535 8407 819 440 -2103 C ATOM 12455 CG2 ILE A 910 -20.806 8.707 -47.336 1.00 79.92 C ANISOU12455 CG2 ILE A 910 9622 13055 7689 770 531 -2095 C ATOM 12456 CD1 ILE A 910 -23.908 7.230 -45.518 1.00 88.47 C ANISOU12456 CD1 ILE A 910 10688 13907 9020 862 402 -2212 C ATOM 12457 H ILE A 910 -21.000 5.280 -45.594 1.00 95.54 H ATOM 12458 HA ILE A 910 -22.469 6.257 -47.660 1.00 96.77 H ATOM 12459 HB ILE A 910 -21.076 7.580 -45.631 1.00 96.69 H ATOM 12460 HG12 ILE A 910 -22.873 8.989 -45.602 1.00101.59 H ATOM 12461 HG13 ILE A 910 -23.354 8.490 -47.027 1.00101.59 H ATOM 12462 HG21 ILE A 910 -20.778 9.554 -46.863 1.00 95.90 H ATOM 12463 HG22 ILE A 910 -19.905 8.388 -47.499 1.00 95.90 H ATOM 12464 HG23 ILE A 910 -21.279 8.812 -48.176 1.00 95.90 H ATOM 12465 HD11 ILE A 910 -24.765 7.664 -45.380 1.00106.16 H ATOM 12466 HD12 ILE A 910 -24.017 6.458 -46.094 1.00106.16 H ATOM 12467 HD13 ILE A 910 -23.534 6.958 -44.666 1.00106.16 H ATOM 12468 N ASP A 911 -19.367 5.601 -47.659 1.00 85.31 N ANISOU12468 N ASP A 911 10235 13607 8574 820 556 -2528 N ATOM 12469 CA ASP A 911 -18.210 5.324 -48.500 1.00 87.53 C ANISOU12469 CA ASP A 911 10495 13969 8795 807 601 -2607 C ATOM 12470 C ASP A 911 -17.223 4.442 -47.743 1.00 87.63 C ANISOU12470 C ASP A 911 10503 13826 8968 858 647 -2674 C ATOM 12471 O ASP A 911 -16.380 4.939 -46.997 1.00 83.92 O ANISOU12471 O ASP A 911 10048 13286 8551 877 690 -2569 O ATOM 12472 CB ASP A 911 -17.537 6.628 -48.929 1.00 87.45 C ANISOU12472 CB ASP A 911 10500 14073 8654 775 648 -2458 C ATOM 12473 CG ASP A 911 -16.280 6.394 -49.745 1.00 90.86 C ANISOU12473 CG ASP A 911 10907 14590 9025 770 710 -2532 C ATOM 12474 OD1 ASP A 911 -16.295 5.521 -50.639 1.00 92.86 O ANISOU12474 OD1 ASP A 911 11133 14922 9229 769 696 -2692 O ATOM 12475 OD2 ASP A 911 -15.272 7.081 -49.487 1.00 89.90 O ANISOU12475 OD2 ASP A 911 10790 14460 8908 767 773 -2441 O ATOM 12476 H ASP A 911 -19.247 5.411 -46.829 1.00102.38 H ATOM 12477 HA ASP A 911 -18.497 4.850 -49.297 1.00105.04 H ATOM 12478 HB2 ASP A 911 -18.156 7.141 -49.472 1.00104.94 H ATOM 12479 HB3 ASP A 911 -17.292 7.133 -48.138 1.00104.94 H ATOM 12480 N LYS A 912 -17.341 3.133 -47.947 1.00 96.45 N ANISOU12480 N LYS A 912 11593 14892 10164 880 637 -2854 N ATOM 12481 CA LYS A 912 -16.535 2.145 -47.235 1.00 98.20 C ANISOU12481 CA LYS A 912 11809 14956 10546 939 681 -2923 C ATOM 12482 C LYS A 912 -15.029 2.403 -47.341 1.00 98.88 C ANISOU12482 C LYS A 912 11888 15076 10606 949 745 -2888 C ATOM 12483 O LYS A 912 -14.277 2.102 -46.413 1.00 99.74 O ANISOU12483 O LYS A 912 12001 15060 10835 1003 780 -2856 O ATOM 12484 CB LYS A 912 -16.856 0.750 -47.778 1.00101.03 C ANISOU12484 CB LYS A 912 12132 15285 10968 949 670 -3144 C ATOM 12485 CG LYS A 912 -16.278 -0.405 -46.975 1.00100.40 C ANISOU12485 CG LYS A 912 12051 15016 11080 1022 719 -3215 C ATOM 12486 CD LYS A 912 -17.280 -0.967 -45.979 1.00103.74 C ANISOU12486 CD LYS A 912 12486 15261 11669 1065 704 -3218 C ATOM 12487 CE LYS A 912 -16.744 -2.237 -45.331 1.00107.92 C ANISOU12487 CE LYS A 912 13013 15601 12390 1144 766 -3298 C ATOM 12488 NZ LYS A 912 -17.512 -2.635 -44.124 1.00 99.79 N ANISOU12488 NZ LYS A 912 12007 14375 11535 1209 779 -3241 N ATOM 12489 H LYS A 912 -17.895 2.785 -48.505 1.00115.74 H ATOM 12490 HA LYS A 912 -16.775 2.162 -46.295 1.00117.84 H ATOM 12491 HB2 LYS A 912 -17.820 0.640 -47.795 1.00121.23 H ATOM 12492 HB3 LYS A 912 -16.506 0.682 -48.680 1.00121.23 H ATOM 12493 HG2 LYS A 912 -16.023 -1.118 -47.582 1.00120.48 H ATOM 12494 HG3 LYS A 912 -15.503 -0.093 -46.482 1.00120.48 H ATOM 12495 HD2 LYS A 912 -17.442 -0.313 -45.281 1.00124.49 H ATOM 12496 HD3 LYS A 912 -18.106 -1.183 -46.439 1.00124.49 H ATOM 12497 HE2 LYS A 912 -16.794 -2.964 -45.972 1.00129.50 H ATOM 12498 HE3 LYS A 912 -15.822 -2.092 -45.066 1.00129.50 H ATOM 12499 HZ1 LYS A 912 -17.477 -1.987 -43.514 1.00119.75 H ATOM 12500 HZ2 LYS A 912 -18.363 -2.782 -44.339 1.00119.75 H ATOM 12501 HZ3 LYS A 912 -17.169 -3.378 -43.776 1.00119.75 H ATOM 12502 N ILE A 913 -14.591 2.963 -48.466 1.00 88.35 N ANISOU12502 N ILE A 913 10539 13917 9112 902 762 -2893 N ATOM 12503 CA ILE A 913 -13.160 3.123 -48.727 1.00 86.76 C ANISOU12503 CA ILE A 913 10318 13764 8883 910 831 -2889 C ATOM 12504 C ILE A 913 -12.541 4.305 -47.975 1.00 84.91 C ANISOU12504 C ILE A 913 10094 13511 8658 905 860 -2715 C ATOM 12505 O ILE A 913 -11.630 4.104 -47.172 1.00 83.75 O ANISOU12505 O ILE A 913 9934 13272 8617 948 890 -2702 O ATOM 12506 CB ILE A 913 -12.856 3.199 -50.252 1.00 93.66 C ANISOU12506 CB ILE A 913 11169 14834 9581 873 855 -2972 C ATOM 12507 CG1 ILE A 913 -12.725 1.789 -50.832 1.00100.55 C ANISOU12507 CG1 ILE A 913 12016 15699 10492 899 859 -3185 C ATOM 12508 CG2 ILE A 913 -11.550 3.943 -50.541 1.00 86.86 C ANISOU12508 CG2 ILE A 913 10291 14059 8653 865 934 -2903 C ATOM 12509 CD1 ILE A 913 -14.023 1.011 -50.915 1.00102.97 C ANISOU12509 CD1 ILE A 913 12321 15963 10842 893 787 -3302 C ATOM 12510 H ILE A 913 -15.099 3.258 -49.093 1.00106.02 H ATOM 12511 HA ILE A 913 -12.715 2.326 -48.398 1.00104.12 H ATOM 12512 HB ILE A 913 -13.586 3.657 -50.697 1.00112.39 H ATOM 12513 HG12 ILE A 913 -12.366 1.857 -51.731 1.00120.67 H ATOM 12514 HG13 ILE A 913 -12.114 1.281 -50.275 1.00120.67 H ATOM 12515 HG21 ILE A 913 -11.405 3.964 -51.499 1.00104.23 H ATOM 12516 HG22 ILE A 913 -11.619 4.847 -50.196 1.00104.23 H ATOM 12517 HG23 ILE A 913 -10.819 3.477 -50.105 1.00104.23 H ATOM 12518 HD11 ILE A 913 -13.843 0.136 -51.292 1.00123.57 H ATOM 12519 HD12 ILE A 913 -14.392 0.918 -50.023 1.00123.57 H ATOM 12520 HD13 ILE A 913 -14.645 1.495 -51.481 1.00123.57 H ATOM 12521 N GLN A 914 -13.016 5.526 -48.215 1.00 89.97 N ANISOU12521 N GLN A 914 10755 14239 9190 857 850 -2588 N ATOM 12522 CA GLN A 914 -12.374 6.688 -47.597 1.00 88.10 C ANISOU12522 CA GLN A 914 10519 13991 8963 845 887 -2445 C ATOM 12523 C GLN A 914 -12.637 6.738 -46.095 1.00 88.69 C ANISOU12523 C GLN A 914 10616 13896 9184 886 854 -2370 C ATOM 12524 O GLN A 914 -11.969 7.475 -45.370 1.00 87.97 O ANISOU12524 O GLN A 914 10517 13772 9136 890 877 -2286 O ATOM 12525 CB GLN A 914 -12.794 8.012 -48.245 1.00 88.28 C ANISOU12525 CB GLN A 914 10560 14145 8838 787 902 -2323 C ATOM 12526 CG GLN A 914 -11.779 9.136 -48.009 1.00 91.71 C ANISOU12526 CG GLN A 914 10975 14606 9263 766 973 -2222 C ATOM 12527 CD GLN A 914 -12.304 10.506 -48.383 1.00 94.05 C ANISOU12527 CD GLN A 914 11297 14993 9444 717 996 -2076 C ATOM 12528 OE1 GLN A 914 -13.428 10.646 -48.869 1.00 90.72 O ANISOU12528 OE1 GLN A 914 10908 14628 8935 701 953 -2040 O ATOM 12529 NE2 GLN A 914 -11.489 11.531 -48.155 1.00 94.92 N ANISOU12529 NE2 GLN A 914 11386 15121 9557 694 1069 -1993 N ATOM 12530 H GLN A 914 -13.690 5.708 -48.718 1.00107.96 H ATOM 12531 HA GLN A 914 -11.415 6.602 -47.717 1.00105.72 H ATOM 12532 HB2 GLN A 914 -12.880 7.882 -49.202 1.00105.94 H ATOM 12533 HB3 GLN A 914 -13.644 8.292 -47.870 1.00105.94 H ATOM 12534 HG2 GLN A 914 -11.543 9.154 -47.068 1.00110.05 H ATOM 12535 HG3 GLN A 914 -10.989 8.963 -48.544 1.00110.05 H ATOM 12536 HE21 GLN A 914 -10.712 11.394 -47.813 1.00113.90 H ATOM 12537 HE22 GLN A 914 -11.738 12.330 -48.350 1.00113.90 H ATOM 12538 N CYS A 915 -13.610 5.965 -45.625 1.00 76.25 N ANISOU12538 N CYS A 915 9065 12221 7685 918 803 -2408 N ATOM 12539 CA CYS A 915 -13.790 5.813 -44.191 1.00 69.09 C ANISOU12539 CA CYS A 915 8181 11152 6919 975 782 -2347 C ATOM 12540 C CYS A 915 -12.516 5.182 -43.651 1.00 69.58 C ANISOU12540 C CYS A 915 8211 11149 7077 1030 817 -2397 C ATOM 12541 O CYS A 915 -11.817 5.781 -42.839 1.00 69.74 O ANISOU12541 O CYS A 915 8221 11139 7139 1048 827 -2321 O ATOM 12542 CB CYS A 915 -14.999 4.937 -43.864 1.00 74.22 C ANISOU12542 CB CYS A 915 8855 11706 7641 1008 741 -2396 C ATOM 12543 SG CYS A 915 -15.336 4.802 -42.090 1.00 71.62 S ANISOU12543 SG CYS A 915 8562 11182 7469 1091 728 -2298 S ATOM 12544 H CYS A 915 -14.170 5.525 -46.108 1.00 91.50 H ATOM 12545 HA CYS A 915 -13.910 6.683 -43.779 1.00 82.91 H ATOM 12546 HB2 CYS A 915 -15.785 5.317 -44.288 1.00 89.07 H ATOM 12547 HB3 CYS A 915 -14.840 4.043 -44.206 1.00 89.07 H ATOM 12548 HG CYS A 915 -16.296 4.100 -41.927 1.00 85.95 H ATOM 12549 N ALA A 916 -12.205 3.989 -44.156 1.00 73.86 N ANISOU12549 N ALA A 916 8732 11683 7649 1056 835 -2535 N ATOM 12550 CA ALA A 916 -11.019 3.233 -43.749 1.00 68.18 C ANISOU12550 CA ALA A 916 7978 10908 7018 1117 873 -2594 C ATOM 12551 C ALA A 916 -9.730 4.009 -43.997 1.00 61.72 C ANISOU12551 C ALA A 916 7114 10193 6143 1093 913 -2568 C ATOM 12552 O ALA A 916 -8.711 3.744 -43.362 1.00 66.62 O ANISOU12552 O ALA A 916 7699 10774 6838 1146 933 -2578 O ATOM 12553 CB ALA A 916 -10.972 1.885 -44.477 1.00 67.40 C ANISOU12553 CB ALA A 916 7865 10799 6946 1140 895 -2759 C ATOM 12554 H ALA A 916 -12.677 3.585 -44.751 1.00 88.63 H ATOM 12555 HA ALA A 916 -11.076 3.053 -42.797 1.00 81.81 H ATOM 12556 HB1 ALA A 916 -10.180 1.401 -44.193 1.00 80.88 H ATOM 12557 HB2 ALA A 916 -11.768 1.378 -44.253 1.00 80.88 H ATOM 12558 HB3 ALA A 916 -10.938 2.044 -45.433 1.00 80.88 H ATOM 12559 N LYS A 917 -9.770 4.960 -44.925 1.00 47.43 N ANISOU12559 N LYS A 917 5299 8521 4202 1018 929 -2537 N ATOM 12560 CA LYS A 917 -8.626 5.835 -45.149 1.00 50.82 C ANISOU12560 CA LYS A 917 5680 9048 4581 990 980 -2504 C ATOM 12561 C LYS A 917 -8.419 6.750 -43.944 1.00 55.12 C ANISOU12561 C LYS A 917 6220 9532 5189 999 961 -2392 C ATOM 12562 O LYS A 917 -7.515 6.528 -43.148 1.00 55.53 O ANISOU12562 O LYS A 917 6231 9540 5329 1050 964 -2409 O ATOM 12563 CB LYS A 917 -8.801 6.670 -46.419 1.00 59.21 C ANISOU12563 CB LYS A 917 6745 10269 5483 914 1017 -2480 C ATOM 12564 CG LYS A 917 -8.736 5.872 -47.710 1.00 61.72 C ANISOU12564 CG LYS A 917 7054 10684 5712 908 1043 -2604 C ATOM 12565 CD LYS A 917 -8.561 6.786 -48.919 1.00 64.94 C ANISOU12565 CD LYS A 917 7454 11270 5950 848 1099 -2567 C ATOM 12566 CE LYS A 917 -7.175 7.431 -48.986 1.00 65.73 C ANISOU12566 CE LYS A 917 7496 11437 6040 839 1186 -2543 C ATOM 12567 NZ LYS A 917 -6.070 6.448 -48.821 1.00 75.79 N ANISOU12567 NZ LYS A 917 8719 12677 7400 893 1215 -2661 N ATOM 12568 H LYS A 917 -10.443 5.118 -45.436 1.00 56.92 H ATOM 12569 HA LYS A 917 -7.828 5.293 -45.254 1.00 60.98 H ATOM 12570 HB2 LYS A 917 -9.667 7.106 -46.386 1.00 71.05 H ATOM 12571 HB3 LYS A 917 -8.099 7.338 -46.450 1.00 71.05 H ATOM 12572 HG2 LYS A 917 -7.980 5.265 -47.675 1.00 74.06 H ATOM 12573 HG3 LYS A 917 -9.561 5.374 -47.822 1.00 74.06 H ATOM 12574 HD2 LYS A 917 -8.688 6.266 -49.729 1.00 77.93 H ATOM 12575 HD3 LYS A 917 -9.219 7.496 -48.876 1.00 77.93 H ATOM 12576 HE2 LYS A 917 -7.068 7.860 -49.849 1.00 78.87 H ATOM 12577 HE3 LYS A 917 -7.099 8.088 -48.277 1.00 78.87 H ATOM 12578 HZ1 LYS A 917 -6.139 6.043 -48.031 1.00 90.94 H ATOM 12579 HZ2 LYS A 917 -6.110 5.834 -49.464 1.00 90.94 H ATOM 12580 HZ3 LYS A 917 -5.284 6.863 -48.865 1.00 90.94 H ATOM 12581 N THR A 918 -9.267 7.766 -43.806 1.00 90.04 N ANISOU12581 N THR A 918 10682 13962 9567 955 940 -2285 N ATOM 12582 CA THR A 918 -9.188 8.704 -42.682 1.00 85.94 C ANISOU12582 CA THR A 918 10163 13388 9103 962 922 -2188 C ATOM 12583 C THR A 918 -9.049 7.960 -41.355 1.00 78.16 C ANISOU12583 C THR A 918 9179 12270 8249 1049 875 -2198 C ATOM 12584 O THR A 918 -8.411 8.436 -40.415 1.00 80.65 O ANISOU12584 O THR A 918 9462 12563 8618 1076 863 -2169 O ATOM 12585 CB THR A 918 -10.442 9.597 -42.625 1.00 87.51 C ANISOU12585 CB THR A 918 10423 13577 9252 921 897 -2078 C ATOM 12586 OG1 THR A 918 -11.615 8.777 -42.551 1.00 84.51 O ANISOU12586 OG1 THR A 918 10094 13123 8892 949 847 -2089 O ATOM 12587 CG2 THR A 918 -10.525 10.478 -43.867 1.00 91.99 C ANISOU12587 CG2 THR A 918 10987 14286 9678 843 951 -2043 C ATOM 12588 H THR A 918 -9.906 7.938 -44.355 1.00108.05 H ATOM 12589 HA THR A 918 -8.412 9.275 -42.795 1.00103.13 H ATOM 12590 HB THR A 918 -10.397 10.169 -41.843 1.00105.02 H ATOM 12591 HG1 THR A 918 -11.661 8.281 -43.227 1.00101.41 H ATOM 12592 HG21 THR A 918 -11.317 11.037 -43.824 1.00110.38 H ATOM 12593 HG22 THR A 918 -9.741 11.046 -43.924 1.00110.38 H ATOM 12594 HG23 THR A 918 -10.573 9.926 -44.663 1.00110.38 H ATOM 12595 N LEU A 919 -9.636 6.770 -41.315 1.00 59.14 N ANISOU12595 N LEU A 919 6803 9782 5886 1096 854 -2246 N ATOM 12596 CA LEU A 919 -9.568 5.883 -40.165 1.00 59.68 C ANISOU12596 CA LEU A 919 6879 9723 6072 1190 827 -2252 C ATOM 12597 C LEU A 919 -8.121 5.487 -39.828 1.00 61.36 C ANISOU12597 C LEU A 919 7024 9955 6336 1243 848 -2312 C ATOM 12598 O LEU A 919 -7.773 5.361 -38.652 1.00 66.09 O ANISOU12598 O LEU A 919 7611 10490 7009 1316 820 -2279 O ATOM 12599 CB LEU A 919 -10.440 4.659 -40.454 1.00 58.06 C ANISOU12599 CB LEU A 919 6715 9442 5905 1220 825 -2313 C ATOM 12600 CG LEU A 919 -10.765 3.637 -39.372 1.00 55.73 C ANISOU12600 CG LEU A 919 6447 8995 5734 1320 816 -2307 C ATOM 12601 CD1 LEU A 919 -11.959 2.812 -39.840 1.00 59.51 C ANISOU12601 CD1 LEU A 919 6964 9413 6233 1317 818 -2362 C ATOM 12602 CD2 LEU A 919 -9.597 2.729 -39.077 1.00 56.39 C ANISOU12602 CD2 LEU A 919 6487 9051 5889 1395 848 -2374 C ATOM 12603 H LEU A 919 -10.094 6.446 -41.966 1.00 70.97 H ATOM 12604 HA LEU A 919 -9.939 6.339 -39.394 1.00 71.61 H ATOM 12605 HB2 LEU A 919 -11.293 4.987 -40.778 1.00 69.68 H ATOM 12606 HB3 LEU A 919 -10.010 4.165 -41.169 1.00 69.68 H ATOM 12607 HG LEU A 919 -11.011 4.098 -38.554 1.00 66.88 H ATOM 12608 HD11 LEU A 919 -12.176 2.157 -39.158 1.00 71.41 H ATOM 12609 HD12 LEU A 919 -12.715 3.403 -39.983 1.00 71.41 H ATOM 12610 HD13 LEU A 919 -11.728 2.364 -40.668 1.00 71.41 H ATOM 12611 HD21 LEU A 919 -9.854 2.100 -38.385 1.00 67.67 H ATOM 12612 HD22 LEU A 919 -9.357 2.252 -39.886 1.00 67.67 H ATOM 12613 HD23 LEU A 919 -8.848 3.267 -38.775 1.00 67.67 H ATOM 12614 N ILE A 920 -7.278 5.303 -40.846 1.00 65.62 N ANISOU12614 N ILE A 920 7513 10593 6827 1211 897 -2399 N ATOM 12615 CA ILE A 920 -5.855 5.015 -40.616 1.00 66.70 C ANISOU12615 CA ILE A 920 7571 10767 7005 1257 922 -2460 C ATOM 12616 C ILE A 920 -5.085 6.297 -40.317 1.00 65.57 C ANISOU12616 C ILE A 920 7366 10712 6836 1219 922 -2421 C ATOM 12617 O ILE A 920 -4.161 6.305 -39.503 1.00 69.19 O ANISOU12617 O ILE A 920 7761 11177 7352 1274 906 -2439 O ATOM 12618 CB ILE A 920 -5.178 4.268 -41.810 1.00 67.74 C ANISOU12618 CB ILE A 920 7666 10971 7101 1247 984 -2578 C ATOM 12619 CG1 ILE A 920 -3.984 3.451 -41.317 1.00 61.78 C ANISOU12619 CG1 ILE A 920 6848 10199 6428 1334 1003 -2645 C ATOM 12620 CG2 ILE A 920 -4.670 5.225 -42.903 1.00 74.11 C ANISOU12620 CG2 ILE A 920 8431 11931 7795 1159 1036 -2588 C ATOM 12621 CD1 ILE A 920 -4.350 2.230 -40.508 1.00 62.92 C ANISOU12621 CD1 ILE A 920 7032 10198 6678 1435 986 -2653 C ATOM 12622 H ILE A 920 -7.500 5.339 -41.676 1.00 78.75 H ATOM 12623 HA ILE A 920 -5.781 4.442 -39.836 1.00 80.04 H ATOM 12624 HB ILE A 920 -5.826 3.663 -42.204 1.00 81.29 H ATOM 12625 HG12 ILE A 920 -3.475 3.152 -42.087 1.00 74.14 H ATOM 12626 HG13 ILE A 920 -3.429 4.018 -40.759 1.00 74.14 H ATOM 12627 HG21 ILE A 920 -4.262 4.705 -43.613 1.00 88.93 H ATOM 12628 HG22 ILE A 920 -5.420 5.732 -43.252 1.00 88.93 H ATOM 12629 HG23 ILE A 920 -4.015 5.827 -42.516 1.00 88.93 H ATOM 12630 HD11 ILE A 920 -3.537 1.775 -40.239 1.00 75.51 H ATOM 12631 HD12 ILE A 920 -4.848 2.509 -39.724 1.00 75.51 H ATOM 12632 HD13 ILE A 920 -4.894 1.641 -41.055 1.00 75.51 H ATOM 12633 N LEU A 921 -5.471 7.375 -40.992 1.00 58.38 N ANISOU12633 N LEU A 921 6468 9874 5839 1128 945 -2375 N ATOM 12634 CA LEU A 921 -4.890 8.692 -40.756 1.00 57.97 C ANISOU12634 CA LEU A 921 6361 9896 5768 1081 962 -2339 C ATOM 12635 C LEU A 921 -5.099 9.130 -39.303 1.00 60.77 C ANISOU12635 C LEU A 921 6722 10173 6193 1127 893 -2281 C ATOM 12636 O LEU A 921 -4.368 9.976 -38.792 1.00 59.37 O ANISOU12636 O LEU A 921 6475 10047 6034 1117 892 -2289 O ATOM 12637 CB LEU A 921 -5.500 9.707 -41.728 1.00 58.51 C ANISOU12637 CB LEU A 921 6462 10039 5731 985 1009 -2280 C ATOM 12638 CG LEU A 921 -5.376 11.208 -41.443 1.00 65.88 C ANISOU12638 CG LEU A 921 7367 11017 6647 927 1035 -2214 C ATOM 12639 CD1 LEU A 921 -3.928 11.681 -41.448 1.00 64.43 C ANISOU12639 CD1 LEU A 921 7066 10928 6487 911 1091 -2281 C ATOM 12640 CD2 LEU A 921 -6.198 11.984 -42.464 1.00 70.36 C ANISOU12640 CD2 LEU A 921 7988 11644 7101 848 1086 -2138 C ATOM 12641 H LEU A 921 -6.078 7.369 -41.601 1.00 70.05 H ATOM 12642 HA LEU A 921 -3.936 8.651 -40.923 1.00 69.56 H ATOM 12643 HB2 LEU A 921 -5.095 9.558 -42.597 1.00 70.21 H ATOM 12644 HB3 LEU A 921 -6.449 9.517 -41.791 1.00 70.21 H ATOM 12645 HG LEU A 921 -5.744 11.391 -40.565 1.00 79.05 H ATOM 12646 HD11 LEU A 921 -3.907 12.633 -41.263 1.00 77.32 H ATOM 12647 HD12 LEU A 921 -3.437 11.199 -40.764 1.00 77.32 H ATOM 12648 HD13 LEU A 921 -3.542 11.504 -42.320 1.00 77.32 H ATOM 12649 HD21 LEU A 921 -6.115 12.933 -42.279 1.00 84.43 H ATOM 12650 HD22 LEU A 921 -5.862 11.790 -43.353 1.00 84.43 H ATOM 12651 HD23 LEU A 921 -7.126 11.712 -42.393 1.00 84.43 H ATOM 12652 N SER A 922 -6.098 8.554 -38.643 1.00 66.58 N ANISOU12652 N SER A 922 7537 10792 6967 1180 839 -2230 N ATOM 12653 CA SER A 922 -6.304 8.786 -37.217 1.00 64.08 C ANISOU12653 CA SER A 922 7234 10401 6712 1244 773 -2175 C ATOM 12654 C SER A 922 -5.178 8.170 -36.397 1.00 63.54 C ANISOU12654 C SER A 922 7093 10342 6707 1337 745 -2237 C ATOM 12655 O SER A 922 -4.582 8.829 -35.544 1.00 65.97 O ANISOU12655 O SER A 922 7343 10688 7034 1361 706 -2243 O ATOM 12656 CB SER A 922 -7.638 8.197 -36.769 1.00 63.91 C ANISOU12656 CB SER A 922 7312 10256 6716 1286 739 -2106 C ATOM 12657 OG SER A 922 -8.704 9.069 -37.082 1.00 60.90 O ANISOU12657 OG SER A 922 6988 9868 6282 1217 742 -2030 O ATOM 12658 H SER A 922 -6.673 8.022 -38.999 1.00 79.89 H ATOM 12659 HA SER A 922 -6.319 9.741 -37.047 1.00 76.89 H ATOM 12660 HB2 SER A 922 -7.778 7.351 -37.223 1.00 76.69 H ATOM 12661 HB3 SER A 922 -7.615 8.058 -35.809 1.00 76.69 H ATOM 12662 HG SER A 922 -8.735 9.198 -37.911 1.00 73.08 H ATOM 12663 N LEU A 923 -4.905 6.894 -36.652 1.00 50.43 N ANISOU12663 N LEU A 923 5432 8651 5079 1393 764 -2290 N ATOM 12664 CA LEU A 923 -3.835 6.181 -35.967 1.00 50.28 C ANISOU12664 CA LEU A 923 5344 8643 5116 1493 746 -2347 C ATOM 12665 C LEU A 923 -2.484 6.803 -36.304 1.00 52.10 C ANISOU12665 C LEU A 923 5454 9012 5328 1457 767 -2428 C ATOM 12666 O LEU A 923 -1.570 6.791 -35.481 1.00 53.23 O ANISOU12666 O LEU A 923 5519 9201 5507 1527 727 -2468 O ATOM 12667 CB LEU A 923 -3.858 4.697 -36.345 1.00 55.27 C ANISOU12667 CB LEU A 923 6003 9207 5791 1552 785 -2392 C ATOM 12668 CG LEU A 923 -5.131 3.942 -35.940 1.00 54.30 C ANISOU12668 CG LEU A 923 5983 8940 5709 1598 777 -2328 C ATOM 12669 CD1 LEU A 923 -5.385 2.764 -36.868 1.00 53.13 C ANISOU12669 CD1 LEU A 923 5863 8740 5583 1599 840 -2397 C ATOM 12670 CD2 LEU A 923 -5.049 3.470 -34.494 1.00 50.69 C ANISOU12670 CD2 LEU A 923 5532 8411 5316 1725 735 -2275 C ATOM 12671 H LEU A 923 -5.331 6.415 -37.225 1.00 60.52 H ATOM 12672 HA LEU A 923 -3.969 6.251 -35.008 1.00 60.33 H ATOM 12673 HB2 LEU A 923 -3.768 4.623 -37.308 1.00 66.33 H ATOM 12674 HB3 LEU A 923 -3.108 4.258 -35.914 1.00 66.33 H ATOM 12675 HG LEU A 923 -5.888 4.544 -36.013 1.00 65.16 H ATOM 12676 HD11 LEU A 923 -6.194 2.309 -36.586 1.00 63.75 H ATOM 12677 HD12 LEU A 923 -5.488 3.093 -37.774 1.00 63.75 H ATOM 12678 HD13 LEU A 923 -4.630 2.157 -36.820 1.00 63.75 H ATOM 12679 HD21 LEU A 923 -5.866 2.997 -34.270 1.00 60.82 H ATOM 12680 HD22 LEU A 923 -4.287 2.877 -34.399 1.00 60.82 H ATOM 12681 HD23 LEU A 923 -4.943 4.241 -33.916 1.00 60.82 H ATOM 12682 N GLN A 924 -2.364 7.350 -37.513 1.00 56.14 N ANISOU12682 N GLN A 924 5949 9600 5783 1353 833 -2455 N ATOM 12683 CA GLN A 924 -1.158 8.073 -37.912 1.00 59.02 C ANISOU12683 CA GLN A 924 6195 10097 6131 1305 875 -2527 C ATOM 12684 C GLN A 924 -0.960 9.315 -37.052 1.00 58.18 C ANISOU12684 C GLN A 924 6036 10032 6037 1283 833 -2511 C ATOM 12685 O GLN A 924 0.157 9.628 -36.641 1.00 60.93 O ANISOU12685 O GLN A 924 6265 10467 6417 1301 822 -2589 O ATOM 12686 CB GLN A 924 -1.241 8.506 -39.376 1.00 60.81 C ANISOU12686 CB GLN A 924 6429 10397 6279 1199 967 -2534 C ATOM 12687 CG GLN A 924 -1.056 7.390 -40.388 1.00 59.92 C ANISOU12687 CG GLN A 924 6331 10291 6144 1214 1021 -2595 C ATOM 12688 CD GLN A 924 -1.096 7.903 -41.813 1.00 60.02 C ANISOU12688 CD GLN A 924 6347 10401 6058 1118 1109 -2600 C ATOM 12689 OE1 GLN A 924 -0.664 9.023 -42.091 1.00 59.96 O ANISOU12689 OE1 GLN A 924 6282 10484 6014 1049 1159 -2586 O ATOM 12690 NE2 GLN A 924 -1.622 7.090 -42.723 1.00 59.21 N ANISOU12690 NE2 GLN A 924 6307 10283 5906 1116 1134 -2624 N ATOM 12691 H GLN A 924 -2.969 7.315 -38.122 1.00 67.37 H ATOM 12692 HA GLN A 924 -0.385 7.497 -37.804 1.00 70.82 H ATOM 12693 HB2 GLN A 924 -2.113 8.900 -39.532 1.00 72.97 H ATOM 12694 HB3 GLN A 924 -0.551 9.167 -39.542 1.00 72.97 H ATOM 12695 HG2 GLN A 924 -0.195 6.968 -40.242 1.00 71.90 H ATOM 12696 HG3 GLN A 924 -1.769 6.742 -40.280 1.00 71.90 H ATOM 12697 HE21 GLN A 924 -1.919 6.317 -42.490 1.00 71.05 H ATOM 12698 HE22 GLN A 924 -1.667 7.337 -43.546 1.00 71.05 H ATOM 12699 N GLN A 925 -2.052 10.028 -36.795 1.00 63.85 N ANISOU12699 N GLN A 925 6837 10691 6734 1245 810 -2422 N ATOM 12700 CA GLN A 925 -1.992 11.292 -36.070 1.00 60.32 C ANISOU12700 CA GLN A 925 6349 10273 6296 1214 782 -2413 C ATOM 12701 C GLN A 925 -1.699 11.071 -34.590 1.00 58.01 C ANISOU12701 C GLN A 925 6025 9961 6055 1324 680 -2433 C ATOM 12702 O GLN A 925 -1.033 11.889 -33.958 1.00 58.28 O ANISOU12702 O GLN A 925 5965 10068 6111 1321 649 -2496 O ATOM 12703 CB GLN A 925 -3.295 12.078 -36.254 1.00 63.50 C ANISOU12703 CB GLN A 925 6856 10613 6657 1150 796 -2307 C ATOM 12704 CG GLN A 925 -3.386 12.808 -37.596 1.00 67.43 C ANISOU12704 CG GLN A 925 7354 11180 7088 1034 901 -2291 C ATOM 12705 CD GLN A 925 -4.629 13.667 -37.728 1.00 69.30 C ANISOU12705 CD GLN A 925 7684 11367 7279 978 915 -2184 C ATOM 12706 OE1 GLN A 925 -5.349 13.900 -36.755 1.00 60.13 O ANISOU12706 OE1 GLN A 925 6579 10122 6146 1017 850 -2131 O ATOM 12707 NE2 GLN A 925 -4.884 14.150 -38.942 1.00 73.62 N ANISOU12707 NE2 GLN A 925 8251 11974 7748 894 1003 -2147 N ATOM 12708 H GLN A 925 -2.847 9.798 -37.031 1.00 76.62 H ATOM 12709 HA GLN A 925 -1.271 11.826 -36.437 1.00 72.38 H ATOM 12710 HB2 GLN A 925 -4.042 11.462 -36.199 1.00 76.20 H ATOM 12711 HB3 GLN A 925 -3.362 12.741 -35.549 1.00 76.20 H ATOM 12712 HG2 GLN A 925 -2.613 13.385 -37.693 1.00 80.92 H ATOM 12713 HG3 GLN A 925 -3.400 12.152 -38.310 1.00 80.92 H ATOM 12714 HE21 GLN A 925 -4.357 13.969 -39.596 1.00 88.35 H ATOM 12715 HE22 GLN A 925 -5.577 14.643 -39.072 1.00 88.35 H ATOM 12716 N LEU A 926 -2.198 9.969 -34.040 1.00 48.45 N ANISOU12716 N LEU A 926 4888 8658 4861 1423 631 -2385 N ATOM 12717 CA LEU A 926 -1.859 9.590 -32.675 1.00 44.71 C ANISOU12717 CA LEU A 926 4387 8180 4419 1549 539 -2396 C ATOM 12718 C LEU A 926 -0.379 9.247 -32.610 1.00 52.35 C ANISOU12718 C LEU A 926 5218 9263 5411 1596 531 -2515 C ATOM 12719 O LEU A 926 0.296 9.542 -31.625 1.00 56.41 O ANISOU12719 O LEU A 926 5647 9851 5935 1663 455 -2572 O ATOM 12720 CB LEU A 926 -2.687 8.386 -32.217 1.00 43.49 C ANISOU12720 CB LEU A 926 4341 7902 4283 1646 518 -2314 C ATOM 12721 CG LEU A 926 -4.178 8.599 -31.934 1.00 45.45 C ANISOU12721 CG LEU A 926 4717 8034 4520 1632 508 -2195 C ATOM 12722 CD1 LEU A 926 -4.805 7.301 -31.425 1.00 42.52 C ANISOU12722 CD1 LEU A 926 4425 7548 4182 1738 501 -2133 C ATOM 12723 CD2 LEU A 926 -4.411 9.741 -30.941 1.00 42.90 C ANISOU12723 CD2 LEU A 926 4390 7730 4180 1639 444 -2166 C ATOM 12724 H LEU A 926 -2.733 9.424 -34.436 1.00 58.13 H ATOM 12725 HA LEU A 926 -2.033 10.334 -32.077 1.00 53.65 H ATOM 12726 HB2 LEU A 926 -2.626 7.704 -32.904 1.00 52.19 H ATOM 12727 HB3 LEU A 926 -2.291 8.046 -31.399 1.00 52.19 H ATOM 12728 HG LEU A 926 -4.621 8.835 -32.764 1.00 54.55 H ATOM 12729 HD11 LEU A 926 -5.747 7.452 -31.251 1.00 51.02 H ATOM 12730 HD12 LEU A 926 -4.700 6.613 -32.101 1.00 51.02 H ATOM 12731 HD13 LEU A 926 -4.356 7.033 -30.607 1.00 51.02 H ATOM 12732 HD21 LEU A 926 -5.365 9.840 -30.792 1.00 51.48 H ATOM 12733 HD22 LEU A 926 -3.966 9.529 -30.105 1.00 51.48 H ATOM 12734 HD23 LEU A 926 -4.047 10.560 -31.311 1.00 51.48 H ATOM 12735 N PHE A 927 0.120 8.629 -33.676 1.00 67.81 N ANISOU12735 N PHE A 927 7150 11244 7372 1564 607 -2561 N ATOM 12736 CA PHE A 927 1.502 8.173 -33.728 1.00 69.74 C ANISOU12736 CA PHE A 927 7266 11589 7643 1613 614 -2671 C ATOM 12737 C PHE A 927 2.478 9.346 -33.680 1.00 69.56 C ANISOU12737 C PHE A 927 7097 11705 7626 1549 612 -2771 C ATOM 12738 O PHE A 927 3.412 9.350 -32.879 1.00 71.08 O ANISOU12738 O PHE A 927 7176 11987 7844 1622 547 -2856 O ATOM 12739 CB PHE A 927 1.729 7.356 -34.999 1.00 71.57 C ANISOU12739 CB PHE A 927 7510 11812 7873 1581 711 -2697 C ATOM 12740 CG PHE A 927 2.987 6.540 -34.981 1.00 73.02 C ANISOU12740 CG PHE A 927 7589 12062 8092 1662 723 -2791 C ATOM 12741 CD1 PHE A 927 3.064 5.387 -34.221 1.00 71.79 C ANISOU12741 CD1 PHE A 927 7458 11846 7972 1802 682 -2776 C ATOM 12742 CD2 PHE A 927 4.086 6.914 -35.736 1.00 75.57 C ANISOU12742 CD2 PHE A 927 7790 12507 8417 1602 787 -2888 C ATOM 12743 CE1 PHE A 927 4.217 4.626 -34.203 1.00 69.91 C ANISOU12743 CE1 PHE A 927 7125 11667 7769 1885 698 -2857 C ATOM 12744 CE2 PHE A 927 5.242 6.155 -35.725 1.00 76.53 C ANISOU12744 CE2 PHE A 927 7812 12690 8576 1682 802 -2974 C ATOM 12745 CZ PHE A 927 5.306 5.008 -34.959 1.00 73.50 C ANISOU12745 CZ PHE A 927 7455 12244 8226 1825 754 -2959 C ATOM 12746 H PHE A 927 -0.328 8.460 -34.390 1.00 81.38 H ATOM 12747 HA PHE A 927 1.678 7.601 -32.965 1.00 83.69 H ATOM 12748 HB2 PHE A 927 0.983 6.747 -35.115 1.00 85.89 H ATOM 12749 HB3 PHE A 927 1.780 7.962 -35.755 1.00 85.89 H ATOM 12750 HD1 PHE A 927 2.332 5.123 -33.711 1.00 86.14 H ATOM 12751 HD2 PHE A 927 4.046 7.685 -36.255 1.00 90.69 H ATOM 12752 HE1 PHE A 927 4.257 3.853 -33.687 1.00 83.89 H ATOM 12753 HE2 PHE A 927 5.976 6.416 -36.234 1.00 91.83 H ATOM 12754 HZ PHE A 927 6.083 4.497 -34.948 1.00 88.19 H ATOM 12755 N ASN A 928 2.255 10.344 -34.531 1.00 69.20 N ANISOU12755 N ASN A 928 7050 11685 7560 1414 688 -2765 N ATOM 12756 CA ASN A 928 3.136 11.508 -34.590 1.00 71.26 C ANISOU12756 CA ASN A 928 7165 12066 7844 1334 717 -2865 C ATOM 12757 C ASN A 928 3.121 12.332 -33.299 1.00 74.84 C ANISOU12757 C ASN A 928 7571 12544 8322 1364 616 -2902 C ATOM 12758 O ASN A 928 4.074 13.053 -33.004 1.00 78.87 O ANISOU12758 O ASN A 928 7926 13165 8874 1335 607 -3029 O ATOM 12759 CB ASN A 928 2.768 12.406 -35.775 1.00 71.17 C ANISOU12759 CB ASN A 928 7178 12063 7800 1189 839 -2827 C ATOM 12760 CG ASN A 928 2.994 11.734 -37.118 1.00 71.27 C ANISOU12760 CG ASN A 928 7209 12094 7775 1157 942 -2820 C ATOM 12761 OD1 ASN A 928 3.645 10.692 -37.210 1.00 75.72 O ANISOU12761 OD1 ASN A 928 7739 12675 8356 1230 936 -2870 O ATOM 12762 ND2 ASN A 928 2.465 12.343 -38.173 1.00 69.44 N ANISOU12762 ND2 ASN A 928 7031 11866 7488 1053 1041 -2759 N ATOM 12763 H ASN A 928 1.598 10.371 -35.085 1.00 83.05 H ATOM 12764 HA ASN A 928 4.045 11.199 -34.729 1.00 85.51 H ATOM 12765 HB2 ASN A 928 1.829 12.642 -35.712 1.00 85.40 H ATOM 12766 HB3 ASN A 928 3.314 13.207 -35.745 1.00 85.40 H ATOM 12767 HD21 ASN A 928 2.563 12.005 -38.958 1.00 83.33 H ATOM 12768 HD22 ASN A 928 2.026 13.075 -38.072 1.00 83.33 H ATOM 12769 N GLU A 929 2.032 12.228 -32.541 1.00 77.91 N ANISOU12769 N GLU A 929 8085 12829 8686 1421 544 -2802 N ATOM 12770 CA GLU A 929 1.909 12.915 -31.256 1.00 79.57 C ANISOU12770 CA GLU A 929 8270 13058 8907 1469 441 -2831 C ATOM 12771 C GLU A 929 2.817 12.268 -30.216 1.00 83.93 C ANISOU12771 C GLU A 929 8726 13696 9466 1611 331 -2918 C ATOM 12772 O GLU A 929 3.417 12.951 -29.385 1.00 90.09 O ANISOU12772 O GLU A 929 9391 14577 10263 1634 254 -3033 O ATOM 12773 CB GLU A 929 0.450 12.892 -30.781 1.00 81.41 C ANISOU12773 CB GLU A 929 8673 13154 9106 1500 408 -2684 C ATOM 12774 CG GLU A 929 -0.454 13.892 -31.513 1.00 80.01 C ANISOU12774 CG GLU A 929 8570 12915 8916 1368 493 -2614 C ATOM 12775 CD GLU A 929 -1.934 13.529 -31.463 1.00 75.60 C ANISOU12775 CD GLU A 929 8189 12211 8324 1390 488 -2456 C ATOM 12776 OE1 GLU A 929 -2.368 12.890 -30.482 1.00 78.50 O ANISOU12776 OE1 GLU A 929 8618 12522 8688 1504 406 -2402 O ATOM 12777 OE2 GLU A 929 -2.662 13.889 -32.413 1.00 67.26 O ANISOU12777 OE2 GLU A 929 7205 11108 7242 1294 570 -2387 O ATOM 12778 H GLU A 929 1.342 11.760 -32.751 1.00 93.49 H ATOM 12779 HA GLU A 929 2.179 13.841 -31.362 1.00 95.49 H ATOM 12780 HB2 GLU A 929 0.088 12.004 -30.926 1.00 97.70 H ATOM 12781 HB3 GLU A 929 0.426 13.108 -29.836 1.00 97.70 H ATOM 12782 HG2 GLU A 929 -0.349 14.766 -31.105 1.00 96.02 H ATOM 12783 HG3 GLU A 929 -0.189 13.930 -32.445 1.00 96.02 H HETATM12784 N MSE A 930 2.919 10.945 -30.277 1.00 92.54 N ANISOU12784 N MSE A 930 9863 14752 10546 1709 326 -2872 N HETATM12785 CA MSE A 930 3.798 10.195 -29.391 1.00 87.94 C ANISOU12785 CA MSE A 930 9199 14254 9961 1857 236 -2939 C HETATM12786 C MSE A 930 5.251 10.567 -29.665 1.00 90.55 C ANISOU12786 C MSE A 930 9332 14743 10330 1822 246 -3111 C HETATM12787 O MSE A 930 6.051 10.716 -28.739 1.00 91.22 O ANISOU12787 O MSE A 930 9296 14951 10413 1906 145 -3223 O HETATM12788 CB MSE A 930 3.590 8.695 -29.602 1.00 80.67 C ANISOU12788 CB MSE A 930 8370 13242 9037 1952 266 -2853 C HETATM12789 CG MSE A 930 4.598 7.807 -28.893 1.00 84.47 C ANISOU12789 CG MSE A 930 8767 13810 9518 2109 203 -2915 C HETATM12790 SE MSE A 930 4.138 5.923 -29.071 1.00108.44 SE ANISOU12790 SE MSE A 930 11938 16693 12573 2231 266 -2793 SE HETATM12791 CE MSE A 930 4.080 5.813 -31.019 1.00 86.15 C ANISOU12791 CE MSE A 930 9134 13809 9791 2057 427 -2812 C HETATM12792 H MSE A 930 2.482 10.453 -30.831 1.00111.05 H HETATM12793 HA MSE A 930 3.581 10.406 -28.469 1.00105.53 H HETATM12794 HB2 MSE A 930 2.708 8.456 -29.277 1.00 96.80 H HETATM12795 HB3 MSE A 930 3.649 8.505 -30.551 1.00 96.80 H HETATM12796 HG2 MSE A 930 5.475 7.944 -29.282 1.00101.37 H HETATM12797 HG3 MSE A 930 4.610 8.029 -27.948 1.00101.37 H HETATM12798 HE1 MSE A 930 3.406 6.427 -31.350 1.00103.38 H HETATM12799 HE2 MSE A 930 4.950 6.053 -31.374 1.00103.38 H HETATM12800 HE3 MSE A 930 3.857 4.905 -31.277 1.00103.38 H ATOM 12801 N ILE A 931 5.582 10.718 -30.946 1.00 70.91 N ANISOU12801 N ILE A 931 6809 12261 7873 1700 370 -3136 N ATOM 12802 CA ILE A 931 6.931 11.096 -31.358 1.00 72.60 C ANISOU12802 CA ILE A 931 6834 12616 8136 1648 410 -3291 C ATOM 12803 C ILE A 931 7.314 12.465 -30.810 1.00 79.40 C ANISOU12803 C ILE A 931 7561 13573 9034 1577 368 -3418 C ATOM 12804 O ILE A 931 8.376 12.620 -30.211 1.00 85.78 O ANISOU12804 O ILE A 931 8202 14514 9877 1622 300 -3571 O ATOM 12805 CB ILE A 931 7.079 11.079 -32.906 1.00 74.13 C ANISOU12805 CB ILE A 931 7033 12792 8343 1525 571 -3272 C ATOM 12806 CG1 ILE A 931 7.501 9.691 -33.384 1.00 67.99 C ANISOU12806 CG1 ILE A 931 6276 11995 7561 1611 607 -3254 C ATOM 12807 CG2 ILE A 931 8.124 12.092 -33.401 1.00 84.05 C ANISOU12807 CG2 ILE A 931 8104 14172 9659 1407 647 -3408 C ATOM 12808 CD1 ILE A 931 6.459 8.631 -33.195 1.00 72.26 C ANISOU12808 CD1 ILE A 931 6997 12394 8067 1699 580 -3121 C ATOM 12809 H ILE A 931 5.037 10.605 -31.601 1.00 85.10 H ATOM 12810 HA ILE A 931 7.558 10.450 -30.996 1.00 87.12 H ATOM 12811 HB ILE A 931 6.222 11.298 -33.303 1.00 88.96 H ATOM 12812 HG12 ILE A 931 7.706 9.738 -34.331 1.00 81.58 H ATOM 12813 HG13 ILE A 931 8.291 9.419 -32.892 1.00 81.58 H ATOM 12814 HG21 ILE A 931 8.178 12.042 -34.368 1.00100.86 H ATOM 12815 HG22 ILE A 931 7.852 12.983 -33.129 1.00100.86 H ATOM 12816 HG23 ILE A 931 8.984 11.874 -33.009 1.00100.86 H ATOM 12817 HD11 ILE A 931 5.663 8.879 -33.692 1.00 86.72 H ATOM 12818 HD12 ILE A 931 6.805 7.786 -33.522 1.00 86.72 H ATOM 12819 HD13 ILE A 931 6.250 8.560 -32.250 1.00 86.72 H ATOM 12820 N GLN A 932 6.451 13.454 -31.011 1.00103.12 N ANISOU12820 N GLN A 932 10633 16510 12039 1468 411 -3367 N ATOM 12821 CA GLN A 932 6.768 14.815 -30.602 1.00101.18 C ANISOU12821 CA GLN A 932 10259 16335 11850 1381 399 -3499 C ATOM 12822 C GLN A 932 6.932 14.931 -29.088 1.00 98.32 C ANISOU12822 C GLN A 932 9840 16041 11475 1502 225 -3592 C ATOM 12823 O GLN A 932 7.606 15.840 -28.599 1.00 98.13 O ANISOU12823 O GLN A 932 9651 16119 11513 1459 185 -3771 O ATOM 12824 CB GLN A 932 5.685 15.780 -31.075 1.00102.42 C ANISOU12824 CB GLN A 932 10523 16388 12004 1257 486 -3404 C ATOM 12825 CG GLN A 932 5.982 17.232 -30.747 1.00111.62 C ANISOU12825 CG GLN A 932 11554 17604 13253 1151 504 -3546 C ATOM 12826 CD GLN A 932 4.789 18.132 -30.981 1.00115.22 C ANISOU12826 CD GLN A 932 12135 17945 13698 1061 573 -3440 C ATOM 12827 OE1 GLN A 932 3.766 17.698 -31.511 1.00112.63 O ANISOU12827 OE1 GLN A 932 11989 17511 13296 1068 613 -3259 O ATOM 12828 NE2 GLN A 932 4.909 19.393 -30.580 1.00118.83 N ANISOU12828 NE2 GLN A 932 12491 18421 14239 976 590 -3562 N ATOM 12829 H GLN A 932 5.680 13.364 -31.380 1.00123.75 H ATOM 12830 HA GLN A 932 7.605 15.080 -31.014 1.00121.42 H ATOM 12831 N GLU A 933 6.326 14.005 -28.351 1.00 93.76 N ANISOU12831 N GLU A 933 9392 15411 10820 1654 127 -3478 N ATOM 12832 CA GLU A 933 6.315 14.078 -26.895 1.00 99.70 C ANISOU12832 CA GLU A 933 10122 16229 11530 1789 -37 -3534 C ATOM 12833 C GLU A 933 7.396 13.208 -26.253 1.00103.05 C ANISOU12833 C GLU A 933 10437 16793 11925 1942 -139 -3629 C ATOM 12834 O GLU A 933 7.644 13.307 -25.052 1.00106.86 O ANISOU12834 O GLU A 933 10863 17380 12360 2064 -284 -3714 O ATOM 12835 CB GLU A 933 4.937 13.684 -26.357 1.00101.38 C ANISOU12835 CB GLU A 933 10545 16304 11669 1871 -75 -3340 C ATOM 12836 CG GLU A 933 4.597 14.296 -25.003 1.00108.40 C ANISOU12836 CG GLU A 933 11433 17238 12518 1957 -210 -3383 C ATOM 12837 CD GLU A 933 4.367 15.800 -25.077 1.00105.37 C ANISOU12837 CD GLU A 933 10993 16845 12196 1812 -176 -3476 C ATOM 12838 OE1 GLU A 933 3.639 16.255 -25.988 1.00101.33 O ANISOU12838 OE1 GLU A 933 10573 16208 11718 1677 -48 -3380 O ATOM 12839 OE2 GLU A 933 4.918 16.527 -24.222 1.00100.59 O ANISOU12839 OE2 GLU A 933 10251 16361 11608 1838 -277 -3656 O ATOM 12840 N ASN A 934 8.037 12.358 -27.049 1.00 94.33 N ANISOU12840 N ASN A 934 9303 15694 10842 1946 -63 -3617 N ATOM 12841 CA ASN A 934 9.037 11.438 -26.511 1.00 97.23 C ANISOU12841 CA ASN A 934 9581 16181 11184 2101 -142 -3688 C ATOM 12842 C ASN A 934 10.238 11.205 -27.425 1.00101.65 C ANISOU12842 C ASN A 934 9993 16814 11816 2041 -52 -3791 C ATOM 12843 O ASN A 934 11.312 10.816 -26.964 1.00107.00 O ANISOU12843 O ASN A 934 10534 17627 12494 2141 -120 -3909 O ATOM 12844 CB ASN A 934 8.386 10.102 -26.148 1.00 93.38 C ANISOU12844 CB ASN A 934 9264 15593 10623 2259 -164 -3508 C ATOM 12845 CG ASN A 934 7.220 10.266 -25.194 1.00 90.38 C ANISOU12845 CG ASN A 934 9028 15141 10171 2331 -245 -3394 C ATOM 12846 OD1 ASN A 934 6.061 10.227 -25.605 1.00 82.82 O ANISOU12846 OD1 ASN A 934 8232 14020 9215 2270 -174 -3241 O ATOM 12847 ND2 ASN A 934 7.522 10.467 -23.915 1.00 94.35 N ANISOU12847 ND2 ASN A 934 9471 15775 10603 2464 -395 -3475 N ATOM 12848 N GLY A 935 10.058 11.448 -28.718 1.00 79.77 N ANISOU12848 N GLY A 935 7249 13962 9099 1886 104 -3744 N ATOM 12849 CA GLY A 935 11.109 11.186 -29.683 1.00 78.68 C ANISOU12849 CA GLY A 935 6990 13881 9023 1830 211 -3817 C ATOM 12850 C GLY A 935 10.893 9.835 -30.337 1.00 80.43 C ANISOU12850 C GLY A 935 7337 14005 9218 1900 283 -3682 C ATOM 12851 O GLY A 935 9.784 9.301 -30.312 1.00 79.40 O ANISOU12851 O GLY A 935 7392 13738 9037 1938 284 -3529 O ATOM 12852 N TYR A 936 11.952 9.266 -30.902 1.00104.11 N ANISOU12852 N TYR A 936 10228 17070 12260 1919 347 -3748 N ATOM 12853 CA TYR A 936 11.820 8.036 -31.679 1.00102.14 C ANISOU12853 CA TYR A 936 10081 16724 12001 1968 438 -3646 C ATOM 12854 C TYR A 936 12.232 6.757 -30.947 1.00104.92 C ANISOU12854 C TYR A 936 10439 17087 12340 2167 368 -3630 C ATOM 12855 O TYR A 936 12.628 5.784 -31.587 1.00104.27 O ANISOU12855 O TYR A 936 10364 16968 12283 2211 453 -3610 O ATOM 12856 CB TYR A 936 12.613 8.146 -32.983 1.00 96.16 C ANISOU12856 CB TYR A 936 9229 16010 11298 1860 589 -3705 C ATOM 12857 CG TYR A 936 11.926 8.943 -34.063 1.00 96.52 C ANISOU12857 CG TYR A 936 9346 15993 11334 1686 709 -3647 C ATOM 12858 CD1 TYR A 936 11.025 8.337 -34.927 1.00102.37 C ANISOU12858 CD1 TYR A 936 10261 16606 12028 1663 790 -3520 C ATOM 12859 CD2 TYR A 936 12.179 10.297 -34.223 1.00 92.58 C ANISOU12859 CD2 TYR A 936 8736 15564 10876 1546 746 -3724 C ATOM 12860 CE1 TYR A 936 10.394 9.058 -35.923 1.00 99.49 C ANISOU12860 CE1 TYR A 936 9964 16203 11636 1518 895 -3464 C ATOM 12861 CE2 TYR A 936 11.556 11.027 -35.215 1.00 90.91 C ANISOU12861 CE2 TYR A 936 8593 15300 10650 1399 869 -3655 C ATOM 12862 CZ TYR A 936 10.664 10.403 -36.063 1.00 96.38 C ANISOU12862 CZ TYR A 936 9465 15882 11274 1391 937 -3521 C ATOM 12863 OH TYR A 936 10.041 11.127 -37.053 1.00102.07 O ANISOU12863 OH TYR A 936 10254 16567 11960 1257 1053 -3449 O ATOM 12864 N ASN A 937 12.134 6.746 -29.621 1.00 96.89 N ANISOU12864 N ASN A 937 9419 16117 11277 2292 222 -3636 N ATOM 12865 CA ASN A 937 12.517 5.563 -28.856 1.00 94.47 C ANISOU12865 CA ASN A 937 9120 15827 10948 2495 162 -3606 C ATOM 12866 C ASN A 937 11.325 4.793 -28.303 1.00 98.04 C ANISOU12866 C ASN A 937 9774 16128 11347 2596 137 -3435 C ATOM 12867 O ASN A 937 11.477 3.688 -27.779 1.00 99.32 O ANISOU12867 O ASN A 937 9972 16265 11501 2763 122 -3376 O ATOM 12868 CB ASN A 937 13.493 5.934 -27.747 1.00 96.39 C ANISOU12868 CB ASN A 937 9193 16264 11165 2599 21 -3747 C ATOM 12869 CG ASN A 937 14.813 6.445 -28.292 1.00104.93 C ANISOU12869 CG ASN A 937 10055 17488 12325 2518 61 -3921 C ATOM 12870 OD1 ASN A 937 15.075 7.649 -28.290 1.00104.27 O ANISOU12870 OD1 ASN A 937 9855 17492 12271 2395 37 -4046 O ATOM 12871 ND2 ASN A 937 15.645 5.531 -28.786 1.00106.27 N ANISOU12871 ND2 ASN A 937 10164 17672 12543 2584 135 -3929 N ATOM 12872 N PHE A 938 10.147 5.400 -28.424 1.00130.23 N ANISOU12872 N PHE A 938 13977 20104 15401 2495 144 -3353 N ATOM 12873 CA PHE A 938 8.871 4.725 -28.201 1.00131.43 C ANISOU12873 CA PHE A 938 14328 20082 15527 2545 159 -3184 C ATOM 12874 C PHE A 938 8.742 3.979 -26.877 1.00131.89 C ANISOU12874 C PHE A 938 14435 20144 15531 2750 65 -3113 C ATOM 12875 O PHE A 938 7.998 4.391 -25.988 1.00136.24 O ANISOU12875 O PHE A 938 15059 20687 16017 2790 -20 -3054 O ATOM 12876 CB PHE A 938 8.598 3.730 -29.333 1.00137.70 C ANISOU12876 CB PHE A 938 15210 20732 16378 2509 303 -3118 C ATOM 12877 CG PHE A 938 8.708 4.319 -30.708 1.00138.88 C ANISOU12877 CG PHE A 938 15327 20882 16558 2327 408 -3171 C ATOM 12878 CD1 PHE A 938 7.643 4.997 -31.269 1.00137.51 C ANISOU12878 CD1 PHE A 938 15259 20623 16366 2188 446 -3107 C ATOM 12879 CD2 PHE A 938 9.871 4.171 -31.450 1.00137.13 C ANISOU12879 CD2 PHE A 938 14974 20750 16379 2303 477 -3277 C ATOM 12880 CE1 PHE A 938 7.737 5.530 -32.539 1.00138.33 C ANISOU12880 CE1 PHE A 938 15339 20739 16480 2034 549 -3144 C ATOM 12881 CE2 PHE A 938 9.971 4.703 -32.724 1.00137.22 C ANISOU12881 CE2 PHE A 938 14961 20770 16405 2145 585 -3315 C ATOM 12882 CZ PHE A 938 8.900 5.383 -33.268 1.00138.55 C ANISOU12882 CZ PHE A 938 15239 20860 16542 2013 621 -3246 C ATOM 12883 N ASP A 939 9.473 2.872 -26.772 1.00 95.48 N ANISOU12883 N ASP A 939 9785 15546 10947 2885 91 -3114 N ATOM 12884 CA ASP A 939 9.204 1.843 -25.775 1.00 93.26 C ANISOU12884 CA ASP A 939 9586 15215 10635 3083 59 -3002 C ATOM 12885 C ASP A 939 7.832 1.254 -26.086 1.00 90.76 C ANISOU12885 C ASP A 939 9460 14671 10352 3048 151 -2845 C ATOM 12886 O ASP A 939 6.816 1.704 -25.556 1.00 94.87 O ANISOU12886 O ASP A 939 10085 15140 10823 3033 104 -2763 O ATOM 12887 CB ASP A 939 9.253 2.405 -24.351 1.00 94.37 C ANISOU12887 CB ASP A 939 9698 15498 10659 3203 -102 -3017 C ATOM 12888 CG ASP A 939 9.043 1.334 -23.294 1.00 98.09 C ANISOU12888 CG ASP A 939 10252 15936 11082 3424 -126 -2890 C ATOM 12889 OD1 ASP A 939 9.265 0.143 -23.603 1.00 98.19 O ANISOU12889 OD1 ASP A 939 10285 15851 11172 3502 -26 -2828 O ATOM 12890 OD2 ASP A 939 8.660 1.680 -22.156 1.00 96.51 O ANISOU12890 OD2 ASP A 939 10095 15807 10769 3524 -237 -2851 O ATOM 12891 HA ASP A 939 9.867 1.138 -25.851 1.00111.91 H ATOM 12892 N ARG A 940 7.809 0.252 -26.962 1.00 96.22 N ANISOU12892 N ARG A 940 10193 15231 11136 3035 283 -2815 N ATOM 12893 CA ARG A 940 6.558 -0.327 -27.441 1.00 96.35 C ANISOU12893 CA ARG A 940 10371 15033 11205 2981 382 -2701 C ATOM 12894 C ARG A 940 5.736 -0.989 -26.334 1.00 97.36 C ANISOU12894 C ARG A 940 10612 15059 11321 3124 363 -2557 C ATOM 12895 O ARG A 940 4.570 -1.328 -26.540 1.00 93.57 O ANISOU12895 O ARG A 940 10262 14407 10882 3079 430 -2461 O ATOM 12896 CB ARG A 940 6.825 -1.320 -28.574 1.00 99.85 C ANISOU12896 CB ARG A 940 10816 15371 11750 2953 527 -2729 C ATOM 12897 CG ARG A 940 7.721 -0.775 -29.675 1.00104.60 C ANISOU12897 CG ARG A 940 11303 16082 12357 2830 561 -2864 C ATOM 12898 CD ARG A 940 7.692 -1.657 -30.917 1.00109.12 C ANISOU12898 CD ARG A 940 11913 16538 13010 2781 709 -2886 C ATOM 12899 NE ARG A 940 8.631 -1.191 -31.935 1.00119.38 N ANISOU12899 NE ARG A 940 13100 17954 14307 2682 751 -3009 N ATOM 12900 CZ ARG A 940 9.794 -1.778 -32.212 1.00121.10 C ANISOU12900 CZ ARG A 940 13208 18233 14573 2753 801 -3086 C ATOM 12901 NH1 ARG A 940 10.167 -2.869 -31.552 1.00116.60 N ANISOU12901 NH1 ARG A 940 12626 17615 14061 2927 816 -3050 N ATOM 12902 NH2 ARG A 940 10.582 -1.277 -33.159 1.00117.99 N ANISOU12902 NH2 ARG A 940 12712 17946 14174 2654 848 -3191 N ATOM 12903 N SER A 941 6.349 -1.178 -25.169 1.00102.11 N ANISOU12903 N SER A 941 11159 15774 11865 3300 275 -2543 N ATOM 12904 CA SER A 941 5.642 -1.708 -24.008 1.00105.98 C ANISOU12904 CA SER A 941 11749 16197 12321 3451 251 -2398 C ATOM 12905 C SER A 941 4.873 -0.613 -23.270 1.00105.96 C ANISOU12905 C SER A 941 11805 16253 12200 3419 139 -2363 C ATOM 12906 O SER A 941 4.019 -0.905 -22.430 1.00104.80 O ANISOU12906 O SER A 941 11767 16032 12019 3510 131 -2230 O ATOM 12907 CB SER A 941 6.623 -2.380 -23.047 1.00104.16 C ANISOU12907 CB SER A 941 11441 16081 12055 3672 204 -2389 C ATOM 12908 OG SER A 941 7.192 -3.537 -23.628 1.00105.82 O ANISOU12908 OG SER A 941 11612 16199 12394 3723 326 -2394 O ATOM 12909 H SER A 941 7.179 -1.006 -25.025 1.00122.54 H ATOM 12910 HA SER A 941 5.004 -2.376 -24.303 1.00127.18 H ATOM 12911 N SER A 942 5.171 0.642 -23.594 1.00 99.89 N ANISOU12911 N SER A 942 10960 15611 11381 3291 63 -2480 N ATOM 12912 CA SER A 942 4.574 1.788 -22.911 1.00 98.65 C ANISOU12912 CA SER A 942 10837 15524 11123 3258 -46 -2473 C ATOM 12913 C SER A 942 3.045 1.786 -23.004 1.00 97.11 C ANISOU12913 C SER A 942 10806 15139 10952 3187 13 -2332 C ATOM 12914 O SER A 942 2.459 1.037 -23.785 1.00 97.37 O ANISOU12914 O SER A 942 10914 14995 11086 3127 137 -2270 O ATOM 12915 CB SER A 942 5.139 3.090 -23.490 1.00 98.82 C ANISOU12915 CB SER A 942 10737 15675 11137 3101 -97 -2631 C ATOM 12916 OG SER A 942 4.709 4.220 -22.750 1.00102.40 O ANISOU12916 OG SER A 942 11198 16206 11505 3085 -206 -2648 O ATOM 12917 H SER A 942 5.725 0.860 -24.216 1.00119.86 H ATOM 12918 HA SER A 942 4.814 1.753 -21.972 1.00118.38 H ATOM 12919 HB2 SER A 942 6.108 3.050 -23.466 1.00118.59 H ATOM 12920 HB3 SER A 942 4.836 3.183 -24.407 1.00118.59 H ATOM 12921 HG SER A 942 3.871 4.270 -22.763 1.00122.88 H ATOM 12922 N SER A 943 2.408 2.623 -22.190 1.00 95.91 N ANISOU12922 N SER A 943 10703 15030 10709 3199 -76 -2293 N ATOM 12923 CA SER A 943 0.952 2.734 -22.173 1.00 90.46 C ANISOU12923 CA SER A 943 10161 14177 10035 3138 -30 -2161 C ATOM 12924 C SER A 943 0.440 3.572 -23.347 1.00 86.78 C ANISOU12924 C SER A 943 9703 13641 9629 2916 20 -2203 C ATOM 12925 O SER A 943 -0.646 3.320 -23.869 1.00 84.01 O ANISOU12925 O SER A 943 9459 13124 9337 2836 106 -2113 O ATOM 12926 CB SER A 943 0.493 3.361 -20.857 1.00 91.30 C ANISOU12926 CB SER A 943 10314 14362 10013 3241 -142 -2106 C ATOM 12927 OG SER A 943 0.777 4.749 -20.837 1.00 96.72 O ANISOU12927 OG SER A 943 10919 15180 10651 3151 -237 -2226 O ATOM 12928 H SER A 943 2.802 3.144 -21.630 1.00115.09 H ATOM 12929 HA SER A 943 0.563 1.848 -22.240 1.00108.56 H ATOM 12930 HB2 SER A 943 -0.464 3.233 -20.763 1.00109.56 H ATOM 12931 HB3 SER A 943 0.959 2.932 -20.123 1.00109.56 H ATOM 12932 HG SER A 943 0.521 5.084 -20.111 1.00116.07 H ATOM 12933 N THR A 944 1.223 4.571 -23.750 1.00 79.75 N ANISOU12933 N THR A 944 8693 12885 8725 2821 -29 -2342 N ATOM 12934 CA THR A 944 0.883 5.401 -24.907 1.00 74.42 C ANISOU12934 CA THR A 944 8013 12163 8101 2616 29 -2383 C ATOM 12935 C THR A 944 0.804 4.553 -26.173 1.00 74.09 C ANISOU12935 C THR A 944 8001 12005 8144 2538 159 -2373 C ATOM 12936 O THR A 944 -0.165 4.637 -26.926 1.00 74.70 O ANISOU12936 O THR A 944 8168 11959 8255 2424 231 -2314 O ATOM 12937 CB THR A 944 1.915 6.543 -25.127 1.00 73.17 C ANISOU12937 CB THR A 944 7697 12174 7930 2535 -26 -2546 C ATOM 12938 OG1 THR A 944 1.821 7.495 -24.060 1.00 71.36 O ANISOU12938 OG1 THR A 944 7443 12040 7631 2580 -142 -2574 O ATOM 12939 CG2 THR A 944 1.678 7.265 -26.465 1.00 60.81 C ANISOU12939 CG2 THR A 944 6126 10561 6420 2330 65 -2577 C ATOM 12940 H THR A 944 1.962 4.790 -23.368 1.00 95.70 H ATOM 12941 HA THR A 944 0.013 5.805 -24.761 1.00 89.30 H ATOM 12942 HB THR A 944 2.809 6.167 -25.140 1.00 87.80 H ATOM 12943 HG1 THR A 944 2.378 8.114 -24.177 1.00 85.63 H ATOM 12944 HG21 THR A 944 2.333 7.972 -26.581 1.00 72.98 H ATOM 12945 HG22 THR A 944 1.760 6.637 -27.200 1.00 72.98 H ATOM 12946 HG23 THR A 944 0.789 7.653 -26.480 1.00 72.98 H ATOM 12947 N PHE A 945 1.830 3.742 -26.407 1.00 79.87 N ANISOU12947 N PHE A 945 8654 12786 8907 2604 186 -2438 N ATOM 12948 CA PHE A 945 1.892 2.920 -27.610 1.00 78.84 C ANISOU12948 CA PHE A 945 8539 12562 8855 2540 308 -2453 C ATOM 12949 C PHE A 945 0.890 1.773 -27.565 1.00 69.64 C ANISOU12949 C PHE A 945 7505 11210 7745 2595 385 -2336 C ATOM 12950 O PHE A 945 0.255 1.458 -28.569 1.00 68.82 O ANISOU12950 O PHE A 945 7463 10993 7693 2495 477 -2326 O ATOM 12951 CB PHE A 945 3.297 2.355 -27.807 1.00 86.75 C ANISOU12951 CB PHE A 945 9415 13665 9882 2609 321 -2556 C ATOM 12952 CG PHE A 945 3.467 1.610 -29.100 1.00 86.80 C ANISOU12952 CG PHE A 945 9425 13593 9961 2540 446 -2592 C ATOM 12953 CD1 PHE A 945 3.857 2.275 -30.248 1.00 82.32 C ANISOU12953 CD1 PHE A 945 8797 13089 9392 2392 489 -2681 C ATOM 12954 CD2 PHE A 945 3.223 0.247 -29.170 1.00 83.92 C ANISOU12954 CD2 PHE A 945 9125 13092 9667 2628 529 -2539 C ATOM 12955 CE1 PHE A 945 4.010 1.598 -31.442 1.00 79.14 C ANISOU12955 CE1 PHE A 945 8403 12631 9036 2338 601 -2720 C ATOM 12956 CE2 PHE A 945 3.373 -0.436 -30.363 1.00 75.45 C ANISOU12956 CE2 PHE A 945 8056 11953 8658 2570 644 -2590 C ATOM 12957 CZ PHE A 945 3.766 0.241 -31.500 1.00 75.65 C ANISOU12957 CZ PHE A 945 8027 12058 8660 2427 673 -2681 C ATOM 12958 H PHE A 945 2.506 3.650 -25.883 1.00 95.84 H ATOM 12959 HA PHE A 945 1.680 3.472 -28.379 1.00 94.61 H ATOM 12960 HB2 PHE A 945 3.933 3.088 -27.801 1.00104.10 H ATOM 12961 HB3 PHE A 945 3.494 1.742 -27.082 1.00104.10 H ATOM 12962 HD1 PHE A 945 4.022 3.190 -30.215 1.00 98.78 H ATOM 12963 HD2 PHE A 945 2.957 -0.213 -28.407 1.00100.70 H ATOM 12964 HE1 PHE A 945 4.275 2.056 -32.206 1.00 94.97 H ATOM 12965 HE2 PHE A 945 3.209 -1.351 -30.399 1.00 90.54 H ATOM 12966 HZ PHE A 945 3.869 -0.217 -32.303 1.00 90.78 H ATOM 12967 N SER A 946 0.771 1.137 -26.404 1.00 70.29 N ANISOU12967 N SER A 946 7622 11267 7818 2758 352 -2255 N ATOM 12968 CA SER A 946 -0.206 0.072 -26.214 1.00 73.54 C ANISOU12968 CA SER A 946 8147 11495 8300 2818 434 -2138 C ATOM 12969 C SER A 946 -1.616 0.599 -26.467 1.00 74.55 C ANISOU12969 C SER A 946 8382 11514 8427 2703 451 -2066 C ATOM 12970 O SER A 946 -2.480 -0.120 -26.972 1.00 68.71 O ANISOU12970 O SER A 946 7720 10615 7771 2668 547 -2021 O ATOM 12971 CB SER A 946 -0.112 -0.488 -24.795 1.00 76.55 C ANISOU12971 CB SER A 946 8544 11890 8650 3017 389 -2047 C ATOM 12972 OG SER A 946 1.202 -0.936 -24.507 1.00 84.29 O ANISOU12972 OG SER A 946 9419 12986 9621 3137 363 -2111 O ATOM 12973 H SER A 946 1.247 1.305 -25.708 1.00 84.35 H ATOM 12974 HA SER A 946 -0.028 -0.646 -26.842 1.00 88.25 H ATOM 12975 HB2 SER A 946 -0.352 0.209 -24.165 1.00 91.85 H ATOM 12976 HB3 SER A 946 -0.724 -1.235 -24.711 1.00 91.85 H ATOM 12977 HG SER A 946 1.237 -1.240 -23.724 1.00101.15 H ATOM 12978 N GLY A 947 -1.833 1.864 -26.118 1.00 79.23 N ANISOU12978 N GLY A 947 8972 12197 8934 2647 360 -2065 N ATOM 12979 CA GLY A 947 -3.126 2.500 -26.286 1.00 75.76 C ANISOU12979 CA GLY A 947 8627 11671 8488 2545 369 -1994 C ATOM 12980 C GLY A 947 -3.561 2.622 -27.735 1.00 73.95 C ANISOU12980 C GLY A 947 8417 11378 8303 2379 449 -2038 C ATOM 12981 O GLY A 947 -4.735 2.426 -28.051 1.00 76.85 O ANISOU12981 O GLY A 947 8875 11620 8705 2327 501 -1973 O ATOM 12982 H GLY A 947 -1.234 2.379 -25.778 1.00 95.07 H ATOM 12983 HA2 GLY A 947 -3.797 1.988 -25.809 1.00 90.92 H ATOM 12984 HA3 GLY A 947 -3.095 3.391 -25.903 1.00 90.92 H ATOM 12985 N ILE A 948 -2.625 2.956 -28.618 1.00 59.30 N ANISOU12985 N ILE A 948 6473 9620 6439 2300 459 -2150 N ATOM 12986 CA ILE A 948 -2.941 3.086 -30.036 1.00 55.17 C ANISOU12986 CA ILE A 948 5965 9064 5932 2153 533 -2194 C ATOM 12987 C ILE A 948 -3.243 1.710 -30.626 1.00 64.48 C ANISOU12987 C ILE A 948 7191 10119 7189 2181 630 -2198 C ATOM 12988 O ILE A 948 -4.136 1.570 -31.462 1.00 62.66 O ANISOU12988 O ILE A 948 7026 9809 6975 2094 684 -2192 O ATOM 12989 CB ILE A 948 -1.797 3.764 -30.829 1.00 56.41 C ANISOU12989 CB ILE A 948 6010 9364 6058 2070 533 -2310 C ATOM 12990 CG1 ILE A 948 -1.577 5.195 -30.326 1.00 52.47 C ANISOU12990 CG1 ILE A 948 5458 8975 5504 2026 453 -2321 C ATOM 12991 CG2 ILE A 948 -2.125 3.786 -32.323 1.00 63.04 C ANISOU12991 CG2 ILE A 948 6874 10181 6897 1936 615 -2347 C ATOM 12992 CD1 ILE A 948 -0.404 5.936 -30.981 1.00 52.88 C ANISOU12992 CD1 ILE A 948 5381 9172 5541 1947 461 -2440 C ATOM 12993 H ILE A 948 -1.802 3.112 -28.423 1.00 71.16 H ATOM 12994 HA ILE A 948 -3.736 3.634 -30.132 1.00 66.20 H ATOM 12995 HB ILE A 948 -0.981 3.256 -30.696 1.00 67.69 H ATOM 12996 HG12 ILE A 948 -2.381 5.710 -30.497 1.00 62.97 H ATOM 12997 HG13 ILE A 948 -1.407 5.164 -29.371 1.00 62.97 H ATOM 12998 HG21 ILE A 948 -1.396 4.214 -32.800 1.00 75.65 H ATOM 12999 HG22 ILE A 948 -2.234 2.874 -32.636 1.00 75.65 H ATOM 13000 HG23 ILE A 948 -2.946 4.283 -32.459 1.00 75.65 H ATOM 13001 HD11 ILE A 948 -0.343 6.827 -30.602 1.00 63.46 H ATOM 13002 HD12 ILE A 948 0.415 5.446 -30.808 1.00 63.46 H ATOM 13003 HD13 ILE A 948 -0.561 5.993 -31.936 1.00 63.46 H ATOM 13004 N LYS A 949 -2.500 0.699 -30.184 1.00 75.66 N ANISOU13004 N LYS A 949 8569 11522 8656 2307 652 -2216 N ATOM 13005 CA LYS A 949 -2.720 -0.669 -30.648 1.00 77.77 C ANISOU13005 CA LYS A 949 8873 11656 9021 2348 757 -2228 C ATOM 13006 C LYS A 949 -4.105 -1.153 -30.255 1.00 71.60 C ANISOU13006 C LYS A 949 8196 10711 8298 2369 794 -2128 C ATOM 13007 O LYS A 949 -4.759 -1.876 -31.004 1.00 68.52 O ANISOU13007 O LYS A 949 7852 10204 7977 2330 879 -2152 O ATOM 13008 CB LYS A 949 -1.668 -1.620 -30.074 1.00 78.08 C ANISOU13008 CB LYS A 949 8849 11704 9115 2498 778 -2246 C ATOM 13009 CG LYS A 949 -0.471 -1.843 -30.986 1.00 79.33 C ANISOU13009 CG LYS A 949 8915 11948 9278 2474 816 -2370 C ATOM 13010 CD LYS A 949 0.434 -2.950 -30.469 1.00 84.22 C ANISOU13010 CD LYS A 949 9480 12546 9973 2632 858 -2380 C ATOM 13011 CE LYS A 949 0.956 -2.640 -29.078 1.00 90.03 C ANISOU13011 CE LYS A 949 10170 13379 10660 2762 757 -2323 C ATOM 13012 NZ LYS A 949 2.149 -3.459 -28.734 1.00 94.90 N ANISOU13012 NZ LYS A 949 10697 14038 11321 2906 778 -2357 N ATOM 13013 H LYS A 949 -1.860 0.777 -29.614 1.00 90.79 H ATOM 13014 HA LYS A 949 -2.654 -0.692 -31.616 1.00 93.33 H ATOM 13015 HB2 LYS A 949 -1.339 -1.253 -29.238 1.00 93.70 H ATOM 13016 HB3 LYS A 949 -2.082 -2.482 -29.913 1.00 93.70 H ATOM 13017 HG2 LYS A 949 -0.784 -2.096 -31.868 1.00 95.19 H ATOM 13018 HG3 LYS A 949 0.049 -1.026 -31.036 1.00 95.19 H ATOM 13019 HD2 LYS A 949 -0.067 -3.779 -30.428 1.00101.06 H ATOM 13020 HD3 LYS A 949 1.194 -3.046 -31.065 1.00101.06 H ATOM 13021 HE2 LYS A 949 1.209 -1.705 -29.034 1.00108.04 H ATOM 13022 HE3 LYS A 949 0.262 -2.829 -28.428 1.00108.04 H ATOM 13023 HZ1 LYS A 949 1.942 -4.324 -28.762 1.00113.88 H ATOM 13024 HZ2 LYS A 949 2.805 -3.299 -29.314 1.00113.88 H ATOM 13025 HZ3 LYS A 949 2.431 -3.255 -27.915 1.00113.88 H ATOM 13026 N GLU A 950 -4.550 -0.751 -29.072 1.00 69.72 N ANISOU13026 N GLU A 950 7990 10470 8032 2435 730 -2025 N ATOM 13027 CA GLU A 950 -5.857 -1.159 -28.591 1.00 69.17 C ANISOU13027 CA GLU A 950 8010 10251 8022 2463 768 -1921 C ATOM 13028 C GLU A 950 -6.953 -0.511 -29.434 1.00 65.73 C ANISOU13028 C GLU A 950 7630 9782 7561 2315 774 -1925 C ATOM 13029 O GLU A 950 -7.914 -1.173 -29.835 1.00 64.49 O ANISOU13029 O GLU A 950 7526 9491 7485 2293 849 -1914 O ATOM 13030 CB GLU A 950 -6.017 -0.796 -27.115 1.00 75.86 C ANISOU13030 CB GLU A 950 8877 11126 8818 2574 691 -1807 C ATOM 13031 CG GLU A 950 -7.380 -1.123 -26.540 1.00 78.12 C ANISOU13031 CG GLU A 950 9251 11267 9164 2604 729 -1688 C ATOM 13032 CD GLU A 950 -7.799 -2.560 -26.781 1.00 74.94 C ANISOU13032 CD GLU A 950 8863 10682 8927 2650 860 -1678 C ATOM 13033 OE1 GLU A 950 -6.913 -3.441 -26.865 1.00 71.64 O ANISOU13033 OE1 GLU A 950 8393 10250 8577 2725 911 -1725 O ATOM 13034 OE2 GLU A 950 -9.021 -2.807 -26.896 1.00 71.64 O ANISOU13034 OE2 GLU A 950 8501 10131 8588 2613 916 -1630 O ATOM 13035 H GLU A 950 -4.115 -0.244 -28.531 1.00 83.67 H ATOM 13036 HA GLU A 950 -5.941 -2.122 -28.676 1.00 83.01 H ATOM 13037 HB2 GLU A 950 -5.354 -1.283 -26.601 1.00 91.03 H ATOM 13038 HB3 GLU A 950 -5.874 0.158 -27.012 1.00 91.03 H ATOM 13039 HG2 GLU A 950 -7.361 -0.974 -25.581 1.00 93.74 H ATOM 13040 HG3 GLU A 950 -8.042 -0.546 -26.951 1.00 93.74 H ATOM 13041 N LEU A 951 -6.807 0.783 -29.708 1.00 51.29 N ANISOU13041 N LEU A 951 5782 8076 5627 2219 700 -1946 N ATOM 13042 CA LEU A 951 -7.743 1.475 -30.588 1.00 46.95 C ANISOU13042 CA LEU A 951 5277 7518 5043 2082 705 -1950 C ATOM 13043 C LEU A 951 -7.700 0.866 -31.988 1.00 56.60 C ANISOU13043 C LEU A 951 6491 8722 6291 2005 778 -2052 C ATOM 13044 O LEU A 951 -8.708 0.836 -32.695 1.00 62.40 O ANISOU13044 O LEU A 951 7276 9404 7029 1931 806 -2058 O ATOM 13045 CB LEU A 951 -7.436 2.975 -30.660 1.00 43.73 C ANISOU13045 CB LEU A 951 4836 7242 4535 1997 630 -1956 C ATOM 13046 CG LEU A 951 -8.349 3.783 -31.597 1.00 43.57 C ANISOU13046 CG LEU A 951 4856 7225 4472 1859 639 -1950 C ATOM 13047 CD1 LEU A 951 -9.834 3.628 -31.233 1.00 42.78 C ANISOU13047 CD1 LEU A 951 4846 7005 4403 1870 651 -1857 C ATOM 13048 CD2 LEU A 951 -7.952 5.259 -31.621 1.00 42.22 C ANISOU13048 CD2 LEU A 951 4646 7171 4225 1783 586 -1952 C ATOM 13049 H LEU A 951 -6.178 1.280 -29.398 1.00 61.54 H ATOM 13050 HA LEU A 951 -8.642 1.368 -30.240 1.00 56.34 H ATOM 13051 HB2 LEU A 951 -7.525 3.351 -29.770 1.00 52.47 H ATOM 13052 HB3 LEU A 951 -6.524 3.089 -30.971 1.00 52.47 H ATOM 13053 HG LEU A 951 -8.237 3.442 -32.498 1.00 52.28 H ATOM 13054 HD11 LEU A 951 -10.366 4.154 -31.850 1.00 51.33 H ATOM 13055 HD12 LEU A 951 -10.078 2.692 -31.299 1.00 51.33 H ATOM 13056 HD13 LEU A 951 -9.970 3.943 -30.325 1.00 51.33 H ATOM 13057 HD21 LEU A 951 -8.548 5.736 -32.220 1.00 50.67 H ATOM 13058 HD22 LEU A 951 -8.027 5.620 -30.723 1.00 50.67 H ATOM 13059 HD23 LEU A 951 -7.037 5.335 -31.933 1.00 50.67 H ATOM 13060 N ALA A 952 -6.528 0.377 -32.379 1.00 68.07 N ANISOU13060 N ALA A 952 7878 10231 7755 2031 803 -2140 N ATOM 13061 CA ALA A 952 -6.344 -0.215 -33.698 1.00 65.85 C ANISOU13061 CA ALA A 952 7585 9951 7486 1970 869 -2249 C ATOM 13062 C ALA A 952 -7.135 -1.511 -33.851 1.00 65.17 C ANISOU13062 C ALA A 952 7552 9703 7508 2017 951 -2261 C ATOM 13063 O ALA A 952 -7.664 -1.789 -34.928 1.00 65.61 O ANISOU13063 O ALA A 952 7630 9741 7557 1944 986 -2336 O ATOM 13064 CB ALA A 952 -4.867 -0.457 -33.964 1.00 69.23 C ANISOU13064 CB ALA A 952 7924 10472 7909 2003 882 -2334 C ATOM 13065 H ALA A 952 -5.818 0.376 -31.894 1.00 81.68 H ATOM 13066 HA ALA A 952 -6.666 0.409 -34.367 1.00 79.03 H ATOM 13067 HB1 ALA A 952 -4.765 -0.850 -34.845 1.00 83.08 H ATOM 13068 HB2 ALA A 952 -4.397 0.390 -33.923 1.00 83.08 H ATOM 13069 HB3 ALA A 952 -4.520 -1.061 -33.289 1.00 83.08 H ATOM 13070 N ARG A 953 -7.220 -2.306 -32.787 1.00 71.44 N ANISOU13070 N ARG A 953 8360 10380 8403 2143 984 -2191 N ATOM 13071 CA ARG A 953 -7.972 -3.555 -32.859 1.00 75.37 C ANISOU13071 CA ARG A 953 8901 10701 9037 2195 1082 -2197 C ATOM 13072 C ARG A 953 -9.468 -3.290 -33.021 1.00 76.25 C ANISOU13072 C ARG A 953 9078 10739 9153 2130 1078 -2159 C ATOM 13073 O ARG A 953 -10.149 -3.980 -33.779 1.00 80.01 O ANISOU13073 O ARG A 953 9580 11131 9690 2101 1137 -2231 O ATOM 13074 CB ARG A 953 -7.744 -4.431 -31.624 1.00 72.08 C ANISOU13074 CB ARG A 953 8476 10167 8745 2349 1133 -2110 C ATOM 13075 CG ARG A 953 -8.424 -5.792 -31.746 1.00 76.40 C ANISOU13075 CG ARG A 953 9052 10506 9470 2406 1262 -2120 C ATOM 13076 CD ARG A 953 -8.288 -6.652 -30.499 1.00 83.02 C ANISOU13076 CD ARG A 953 9873 11214 10458 2558 1327 -2014 C ATOM 13077 NE ARG A 953 -8.438 -5.907 -29.249 1.00 82.44 N ANISOU13077 NE ARG A 953 9803 11199 10320 2605 1236 -1882 N ATOM 13078 CZ ARG A 953 -9.597 -5.667 -28.638 1.00 85.72 C ANISOU13078 CZ ARG A 953 10265 11540 10766 2603 1227 -1782 C ATOM 13079 NH1 ARG A 953 -10.742 -6.088 -29.161 1.00 89.29 N ANISOU13079 NH1 ARG A 953 10752 11849 11325 2549 1304 -1799 N ATOM 13080 NH2 ARG A 953 -9.613 -4.988 -27.501 1.00 78.08 N ANISOU13080 NH2 ARG A 953 9307 10647 9711 2660 1136 -1668 N ATOM 13081 H ARG A 953 -6.858 -2.148 -32.023 1.00 85.72 H ATOM 13082 HA ARG A 953 -7.674 -4.054 -33.635 1.00 90.45 H ATOM 13083 HB2 ARG A 953 -6.792 -4.579 -31.512 1.00 86.50 H ATOM 13084 HB3 ARG A 953 -8.106 -3.982 -30.845 1.00 86.50 H ATOM 13085 HG2 ARG A 953 -9.370 -5.656 -31.912 1.00 91.68 H ATOM 13086 HG3 ARG A 953 -8.026 -6.277 -32.486 1.00 91.68 H ATOM 13087 HD2 ARG A 953 -8.972 -7.340 -30.517 1.00 99.63 H ATOM 13088 HD3 ARG A 953 -7.409 -7.062 -30.496 1.00 99.63 H ATOM 13089 HE ARG A 953 -7.724 -5.601 -28.880 1.00 98.92 H ATOM 13090 HH11 ARG A 953 -10.741 -6.531 -29.898 1.00107.15 H ATOM 13091 HH12 ARG A 953 -11.485 -5.924 -28.759 1.00107.15 H ATOM 13092 HH21 ARG A 953 -8.876 -4.707 -27.157 1.00 93.69 H ATOM 13093 HH22 ARG A 953 -10.360 -4.825 -27.108 1.00 93.69 H ATOM 13094 N ARG A 954 -9.976 -2.293 -32.304 1.00 82.60 N ANISOU13094 N ARG A 954 9907 11583 9895 2112 1006 -2055 N ATOM 13095 CA ARG A 954 -11.408 -2.005 -32.302 1.00 83.63 C ANISOU13095 CA ARG A 954 10094 11645 10036 2066 1002 -2002 C ATOM 13096 C ARG A 954 -11.838 -1.397 -33.633 1.00 82.33 C ANISOU13096 C ARG A 954 9936 11573 9774 1929 971 -2091 C ATOM 13097 O ARG A 954 -12.994 -1.518 -34.039 1.00 83.08 O ANISOU13097 O ARG A 954 10066 11610 9892 1890 985 -2104 O ATOM 13098 CB ARG A 954 -11.758 -1.075 -31.138 1.00 84.03 C ANISOU13098 CB ARG A 954 10169 11721 10039 2095 933 -1866 C ATOM 13099 CG ARG A 954 -11.406 -1.669 -29.775 1.00 92.77 C ANISOU13099 CG ARG A 954 11268 12758 11224 2240 951 -1772 C ATOM 13100 CD ARG A 954 -12.645 -2.103 -29.002 1.00 97.98 C ANISOU13100 CD ARG A 954 11971 13264 11992 2297 997 -1663 C ATOM 13101 NE ARG A 954 -13.194 -1.007 -28.204 1.00 97.01 N ANISOU13101 NE ARG A 954 11886 13199 11775 2294 913 -1554 N ATOM 13102 CZ ARG A 954 -12.985 -0.830 -26.899 1.00 91.26 C ANISOU13102 CZ ARG A 954 11167 12491 11016 2400 867 -1445 C ATOM 13103 NH1 ARG A 954 -12.239 -1.680 -26.198 1.00 84.11 N ANISOU13103 NH1 ARG A 954 10232 11560 10166 2522 894 -1420 N ATOM 13104 NH2 ARG A 954 -13.534 0.209 -26.287 1.00 87.91 N ANISOU13104 NH2 ARG A 954 10785 12121 10497 2390 794 -1358 N ATOM 13105 H ARG A 954 -9.511 -1.766 -31.808 1.00 99.12 H ATOM 13106 HA ARG A 954 -11.896 -2.834 -32.180 1.00100.35 H ATOM 13107 HB2 ARG A 954 -11.266 -0.245 -31.239 1.00100.84 H ATOM 13108 HB3 ARG A 954 -12.712 -0.899 -31.151 1.00100.84 H ATOM 13109 HG2 ARG A 954 -10.842 -2.447 -29.903 1.00111.33 H ATOM 13110 HG3 ARG A 954 -10.940 -1.001 -29.248 1.00111.33 H ATOM 13111 HD2 ARG A 954 -13.327 -2.394 -29.627 1.00117.57 H ATOM 13112 HD3 ARG A 954 -12.409 -2.828 -28.401 1.00117.57 H ATOM 13113 HE ARG A 954 -13.689 -0.432 -28.608 1.00116.42 H ATOM 13114 HH11 ARG A 954 -11.878 -2.357 -26.586 1.00100.93 H ATOM 13115 HH12 ARG A 954 -12.117 -1.551 -25.357 1.00100.93 H ATOM 13116 HH21 ARG A 954 -14.020 0.763 -26.731 1.00105.50 H ATOM 13117 HH22 ARG A 954 -13.407 0.328 -25.445 1.00105.50 H ATOM 13118 N PHE A 955 -10.894 -0.753 -34.308 1.00 61.42 N ANISOU13118 N PHE A 955 7244 9073 7018 1862 929 -2153 N ATOM 13119 CA PHE A 955 -11.117 -0.232 -35.649 1.00 58.36 C ANISOU13119 CA PHE A 955 6850 8791 6532 1738 909 -2238 C ATOM 13120 C PHE A 955 -11.238 -1.373 -36.654 1.00 64.73 C ANISOU13120 C PHE A 955 7651 9556 7389 1730 967 -2374 C ATOM 13121 O PHE A 955 -11.917 -1.245 -37.673 1.00 68.98 O ANISOU13121 O PHE A 955 8196 10142 7870 1645 953 -2448 O ATOM 13122 CB PHE A 955 -9.945 0.664 -36.066 1.00 58.02 C ANISOU13122 CB PHE A 955 6751 8907 6386 1681 873 -2263 C ATOM 13123 CG PHE A 955 -10.052 2.105 -35.602 1.00 57.57 C ANISOU13123 CG PHE A 955 6697 8926 6251 1634 808 -2166 C ATOM 13124 CD1 PHE A 955 -11.163 2.573 -34.914 1.00 59.14 C ANISOU13124 CD1 PHE A 955 6951 9063 6457 1640 780 -2064 C ATOM 13125 CD2 PHE A 955 -9.023 2.996 -35.869 1.00 58.65 C ANISOU13125 CD2 PHE A 955 6776 9193 6316 1585 786 -2185 C ATOM 13126 CE1 PHE A 955 -11.238 3.896 -34.499 1.00 56.81 C ANISOU13126 CE1 PHE A 955 6659 8830 6096 1600 727 -1985 C ATOM 13127 CE2 PHE A 955 -9.096 4.321 -35.457 1.00 56.61 C ANISOU13127 CE2 PHE A 955 6515 8992 6001 1543 738 -2110 C ATOM 13128 CZ PHE A 955 -10.203 4.767 -34.773 1.00 55.37 C ANISOU13128 CZ PHE A 955 6420 8768 5850 1551 708 -2011 C ATOM 13129 H PHE A 955 -10.103 -0.603 -34.006 1.00 73.70 H ATOM 13130 HA PHE A 955 -11.934 0.291 -35.668 1.00 70.03 H ATOM 13131 HB2 PHE A 955 -9.128 0.296 -35.696 1.00 69.62 H ATOM 13132 HB3 PHE A 955 -9.891 0.671 -37.035 1.00 69.62 H ATOM 13133 HD1 PHE A 955 -11.864 1.992 -34.724 1.00 70.97 H ATOM 13134 HD2 PHE A 955 -8.271 2.701 -36.330 1.00 70.38 H ATOM 13135 HE1 PHE A 955 -11.988 4.196 -34.037 1.00 68.17 H ATOM 13136 HE2 PHE A 955 -8.397 4.905 -35.642 1.00 67.93 H ATOM 13137 HZ PHE A 955 -10.253 5.654 -34.496 1.00 66.44 H ATOM 13138 N ALA A 956 -10.563 -2.485 -36.373 1.00 66.82 N ANISOU13138 N ALA A 956 7899 9735 7756 1823 1031 -2415 N ATOM 13139 CA ALA A 956 -10.518 -3.609 -37.302 1.00 66.79 C ANISOU13139 CA ALA A 956 7883 9685 7807 1826 1092 -2559 C ATOM 13140 C ALA A 956 -11.866 -4.319 -37.364 1.00 68.76 C ANISOU13140 C ALA A 956 8174 9796 8156 1836 1123 -2587 C ATOM 13141 O ALA A 956 -12.263 -4.827 -38.414 1.00 71.63 O ANISOU13141 O ALA A 956 8528 10170 8519 1785 1130 -2731 O ATOM 13142 CB ALA A 956 -9.419 -4.585 -36.903 1.00 69.09 C ANISOU13142 CB ALA A 956 8145 9910 8195 1936 1162 -2581 C ATOM 13143 H ALA A 956 -10.122 -2.614 -35.646 1.00 80.19 H ATOM 13144 HA ALA A 956 -10.315 -3.276 -38.190 1.00 80.14 H ATOM 13145 HB1 ALA A 956 -9.408 -5.322 -37.534 1.00 82.91 H ATOM 13146 HB2 ALA A 956 -8.567 -4.124 -36.918 1.00 82.91 H ATOM 13147 HB3 ALA A 956 -9.601 -4.917 -36.010 1.00 82.91 H ATOM 13148 N LEU A 957 -12.577 -4.328 -36.240 1.00 69.72 N ANISOU13148 N LEU A 957 8332 9795 8364 1903 1139 -2457 N ATOM 13149 CA LEU A 957 -13.864 -5.008 -36.139 1.00 69.94 C ANISOU13149 CA LEU A 957 8390 9670 8516 1928 1182 -2466 C ATOM 13150 C LEU A 957 -14.943 -4.257 -36.922 1.00 69.58 C ANISOU13150 C LEU A 957 8349 9717 8370 1812 1106 -2517 C ATOM 13151 O LEU A 957 -16.086 -4.706 -37.008 1.00 70.57 O ANISOU13151 O LEU A 957 8484 9744 8585 1814 1122 -2554 O ATOM 13152 CB LEU A 957 -14.278 -5.129 -34.668 1.00 70.94 C ANISOU13152 CB LEU A 957 8545 9647 8761 2034 1231 -2289 C ATOM 13153 CG LEU A 957 -13.205 -5.614 -33.685 1.00 71.76 C ANISOU13153 CG LEU A 957 8632 9693 8942 2149 1288 -2204 C ATOM 13154 CD1 LEU A 957 -13.560 -5.217 -32.260 1.00 74.15 C ANISOU13154 CD1 LEU A 957 8947 9937 9290 2215 1283 -2025 C ATOM 13155 CD2 LEU A 957 -12.995 -7.119 -33.779 1.00 67.40 C ANISOU13155 CD2 LEU A 957 8072 8970 8565 2244 1413 -2260 C ATOM 13156 H LEU A 957 -12.331 -3.942 -35.512 1.00 83.67 H ATOM 13157 HA LEU A 957 -13.785 -5.902 -36.508 1.00 83.93 H ATOM 13158 HB2 LEU A 957 -14.571 -4.255 -34.364 1.00 85.13 H ATOM 13159 HB3 LEU A 957 -15.020 -5.751 -34.613 1.00 85.13 H ATOM 13160 HG LEU A 957 -12.364 -5.185 -33.909 1.00 86.12 H ATOM 13161 HD11 LEU A 957 -12.866 -5.535 -31.662 1.00 88.98 H ATOM 13162 HD12 LEU A 957 -13.624 -4.250 -32.209 1.00 88.98 H ATOM 13163 HD13 LEU A 957 -14.411 -5.618 -32.024 1.00 88.98 H ATOM 13164 HD21 LEU A 957 -12.311 -7.383 -33.144 1.00 80.87 H ATOM 13165 HD22 LEU A 957 -13.830 -7.568 -33.572 1.00 80.87 H ATOM 13166 HD23 LEU A 957 -12.713 -7.343 -34.680 1.00 80.87 H ATOM 13167 N THR A 958 -14.569 -3.116 -37.493 1.00 91.69 N ANISOU13167 N THR A 958 11136 12705 10996 1716 1028 -2517 N ATOM 13168 CA THR A 958 -15.490 -2.268 -38.243 1.00 91.99 C ANISOU13168 CA THR A 958 11175 12856 10920 1609 958 -2544 C ATOM 13169 C THR A 958 -15.545 -2.741 -39.697 1.00102.20 C ANISOU13169 C THR A 958 12430 14236 12164 1531 946 -2738 C ATOM 13170 O THR A 958 -16.126 -2.088 -40.560 1.00106.61 O ANISOU13170 O THR A 958 12977 14926 12604 1436 887 -2783 O ATOM 13171 CB THR A 958 -15.036 -0.786 -38.149 1.00 94.02 C ANISOU13171 CB THR A 958 11436 13262 11025 1550 897 -2433 C ATOM 13172 OG1 THR A 958 -14.945 -0.412 -36.771 1.00 98.61 O ANISOU13172 OG1 THR A 958 12045 13768 11656 1624 900 -2277 O ATOM 13173 CG2 THR A 958 -15.992 0.178 -38.853 1.00 97.03 C ANISOU13173 CG2 THR A 958 11823 13757 11287 1451 837 -2428 C ATOM 13174 H THR A 958 -13.768 -2.804 -37.460 1.00110.02 H ATOM 13175 HA THR A 958 -16.379 -2.341 -37.862 1.00110.38 H ATOM 13176 HB THR A 958 -14.162 -0.696 -38.560 1.00112.82 H ATOM 13177 HG1 THR A 958 -14.387 -0.901 -36.377 1.00118.34 H ATOM 13178 HG21 THR A 958 -15.668 1.088 -38.768 1.00116.43 H ATOM 13179 HG22 THR A 958 -16.055 -0.047 -39.795 1.00116.43 H ATOM 13180 HG23 THR A 958 -16.874 0.119 -38.455 1.00116.43 H ATOM 13181 N PHE A 959 -14.951 -3.898 -39.963 1.00101.78 N ANISOU13181 N PHE A 959 12357 14112 12203 1577 1003 -2854 N ATOM 13182 CA PHE A 959 -14.976 -4.465 -41.307 1.00 92.27 C ANISOU13182 CA PHE A 959 11112 12982 10964 1510 993 -3058 C ATOM 13183 C PHE A 959 -15.690 -5.822 -41.321 1.00 93.09 C ANISOU13183 C PHE A 959 11204 12910 11255 1553 1039 -3191 C ATOM 13184 O PHE A 959 -16.922 -5.901 -41.312 1.00 95.87 O ANISOU13184 O PHE A 959 11551 13207 11668 1528 1014 -3226 O ATOM 13185 CB PHE A 959 -13.552 -4.619 -41.858 1.00 80.21 C ANISOU13185 CB PHE A 959 9558 11544 9375 1511 1021 -3115 C ATOM 13186 CG PHE A 959 -12.785 -3.319 -41.994 1.00 79.14 C ANISOU13186 CG PHE A 959 9415 11578 9075 1459 983 -3010 C ATOM 13187 CD1 PHE A 959 -12.034 -2.823 -40.937 1.00 77.97 C ANISOU13187 CD1 PHE A 959 9278 11403 8945 1516 994 -2861 C ATOM 13188 CD2 PHE A 959 -12.774 -2.621 -43.197 1.00 79.54 C ANISOU13188 CD2 PHE A 959 9444 11815 8964 1357 943 -3067 C ATOM 13189 CE1 PHE A 959 -11.311 -1.641 -41.065 1.00 77.20 C ANISOU13189 CE1 PHE A 959 9163 11449 8722 1465 962 -2785 C ATOM 13190 CE2 PHE A 959 -12.054 -1.433 -43.330 1.00 78.76 C ANISOU13190 CE2 PHE A 959 9335 11852 8737 1313 926 -2967 C ATOM 13191 CZ PHE A 959 -11.318 -0.949 -42.264 1.00 77.60 C ANISOU13191 CZ PHE A 959 9192 11664 8627 1364 936 -2835 C ATOM 13192 N LYS A 965 -15.115 -3.005 -52.364 1.00119.03 N ANISOU13192 N LYS A 965 14254 17889 13081 921 736 -4007 N ATOM 13193 CA LYS A 965 -16.086 -2.568 -51.369 1.00116.58 C ANISOU13193 CA LYS A 965 13964 17475 12856 916 690 -3882 C ATOM 13194 C LYS A 965 -15.848 -3.264 -50.030 1.00117.70 C ANISOU13194 C LYS A 965 14123 17366 13231 982 734 -3854 C ATOM 13195 O LYS A 965 -15.136 -2.746 -49.173 1.00114.33 O ANISOU13195 O LYS A 965 13729 16874 12837 1019 775 -3684 O ATOM 13196 CB LYS A 965 -17.513 -2.827 -51.862 1.00119.24 C ANISOU13196 CB LYS A 965 14267 17865 13175 869 602 -4012 C ATOM 13197 CG LYS A 965 -18.601 -2.223 -50.983 1.00123.53 C ANISOU13197 CG LYS A 965 14826 18338 13770 860 552 -3879 C ATOM 13198 CD LYS A 965 -18.508 -0.703 -50.943 1.00125.41 C ANISOU13198 CD LYS A 965 15106 18703 13842 840 545 -3640 C ATOM 13199 CE LYS A 965 -19.724 -0.087 -50.262 1.00124.38 C ANISOU13199 CE LYS A 965 14987 18536 13735 828 488 -3529 C ATOM 13200 NZ LYS A 965 -19.883 -0.561 -48.860 1.00123.53 N ANISOU13200 NZ LYS A 965 14899 18188 13848 881 517 -3490 N ATOM 13201 N THR A 966 -16.438 -4.446 -49.867 1.00139.53 N ANISOU13201 N THR A 966 16861 19991 16163 998 729 -4024 N ATOM 13202 CA THR A 966 -16.341 -5.210 -48.623 1.00138.36 C ANISOU13202 CA THR A 966 16730 19592 16249 1073 781 -3998 C ATOM 13203 C THR A 966 -14.892 -5.494 -48.201 1.00134.85 C ANISOU13203 C THR A 966 16305 19081 15851 1144 867 -3941 C ATOM 13204 O THR A 966 -14.588 -5.568 -47.009 1.00121.86 O ANISOU13204 O THR A 966 14691 17280 14331 1215 908 -3811 O ATOM 13205 CB THR A 966 -17.110 -6.549 -48.741 1.00136.10 C ANISOU13205 CB THR A 966 16399 19164 16149 1074 778 -4225 C ATOM 13206 OG1 THR A 966 -18.355 -6.332 -49.416 1.00128.99 O ANISOU13206 OG1 THR A 966 15458 18371 15181 996 689 -4328 O ATOM 13207 CG2 THR A 966 -17.377 -7.147 -47.365 1.00132.86 C ANISOU13207 CG2 THR A 966 16012 18486 15983 1152 830 -4155 C ATOM 13208 N ARG A 967 -14.006 -5.630 -49.186 1.00141.60 N ANISOU13208 N ARG A 967 17139 20065 16598 1130 893 -4035 N ATOM 13209 CA ARG A 967 -12.628 -6.067 -48.953 1.00136.89 C ANISOU13209 CA ARG A 967 16545 19416 16052 1197 975 -4026 C ATOM 13210 C ARG A 967 -11.614 -5.241 -49.747 1.00127.93 C ANISOU13210 C ARG A 967 15402 18482 14724 1169 994 -3978 C ATOM 13211 O ARG A 967 -10.403 -5.386 -49.568 1.00122.57 O ANISOU13211 O ARG A 967 14717 17789 14066 1219 1059 -3953 O ATOM 13212 CB ARG A 967 -12.496 -7.539 -49.330 1.00142.07 C ANISOU13212 CB ARG A 967 17172 19965 16842 1233 1020 -4250 C ATOM 13213 CG ARG A 967 -13.625 -8.397 -48.785 1.00146.27 C ANISOU13213 CG ARG A 967 17698 20304 17575 1246 1006 -4335 C ATOM 13214 CD ARG A 967 -13.422 -9.849 -49.125 1.00155.33 C ANISOU13214 CD ARG A 967 18813 21323 18880 1282 1061 -4556 C ATOM 13215 NE ARG A 967 -13.399 -10.054 -50.569 1.00166.82 N ANISOU13215 NE ARG A 967 20227 22953 20203 1216 1032 -4765 N ATOM 13216 CZ ARG A 967 -13.226 -11.231 -51.161 1.00174.80 C ANISOU13216 CZ ARG A 967 21203 23900 21312 1229 1070 -4996 C ATOM 13217 NH1 ARG A 967 -13.063 -12.328 -50.435 1.00178.56 N ANISOU13217 NH1 ARG A 967 21680 24130 22035 1304 1145 -5041 N ATOM 13218 NH2 ARG A 967 -13.219 -11.312 -52.484 1.00176.17 N ANISOU13218 NH2 ARG A 967 21342 24258 21339 1172 1038 -5178 N ATOM 13219 H ARG A 967 -14.181 -5.473 -50.014 1.00169.92 H ATOM 13220 HA ARG A 967 -12.420 -5.976 -48.010 1.00164.27 H ATOM 13221 HB2 ARG A 967 -12.501 -7.618 -50.297 1.00170.48 H ATOM 13222 HB3 ARG A 967 -11.662 -7.882 -48.975 1.00170.48 H ATOM 13223 HG2 ARG A 967 -13.655 -8.311 -47.819 1.00175.52 H ATOM 13224 HG3 ARG A 967 -14.465 -8.107 -49.175 1.00175.52 H ATOM 13225 HD2 ARG A 967 -12.574 -10.148 -48.761 1.00186.39 H ATOM 13226 HD3 ARG A 967 -14.151 -10.371 -48.754 1.00186.39 H ATOM 13227 HE ARG A 967 -13.505 -9.365 -51.073 1.00200.18 H ATOM 13228 HH11 ARG A 967 -13.066 -12.280 -49.576 1.00214.27 H ATOM 13229 HH12 ARG A 967 -12.952 -13.088 -50.823 1.00214.27 H ATOM 13230 HH21 ARG A 967 -13.325 -10.602 -52.959 1.00211.41 H ATOM 13231 HH22 ARG A 967 -13.108 -12.073 -52.868 1.00211.41 H ATOM 13232 N GLU A 968 -12.114 -4.386 -50.633 1.00112.22 N ANISOU13232 N GLU A 968 13409 16681 12549 1094 942 -3964 N ATOM 13233 CA GLU A 968 -11.269 -3.423 -51.327 1.00111.57 C ANISOU13233 CA GLU A 968 13324 16785 12283 1066 968 -3884 C ATOM 13234 C GLU A 968 -10.868 -2.317 -50.351 1.00108.72 C ANISOU13234 C GLU A 968 12985 16393 11929 1073 976 -3652 C ATOM 13235 O GLU A 968 -9.994 -1.499 -50.644 1.00105.08 O ANISOU13235 O GLU A 968 12516 16044 11364 1059 1014 -3566 O ATOM 13236 CB GLU A 968 -12.014 -2.830 -52.526 1.00113.33 C ANISOU13236 CB GLU A 968 13541 17213 12307 996 915 -3921 C ATOM 13237 CG GLU A 968 -11.103 -2.224 -53.586 1.00117.09 C ANISOU13237 CG GLU A 968 14009 17890 12592 980 964 -3908 C ATOM 13238 CD GLU A 968 -11.871 -1.614 -54.745 1.00115.91 C ANISOU13238 CD GLU A 968 13860 17951 12231 925 915 -3924 C ATOM 13239 OE1 GLU A 968 -12.058 -2.308 -55.768 1.00122.05 O ANISOU13239 OE1 GLU A 968 14614 18827 12932 921 902 -4113 O ATOM 13240 OE2 GLU A 968 -12.285 -0.440 -54.636 1.00104.17 O ANISOU13240 OE2 GLU A 968 12394 16534 10651 890 889 -3750 O ATOM 13241 H GLU A 968 -12.945 -4.344 -50.850 1.00134.66 H ATOM 13242 HA GLU A 968 -10.466 -3.863 -51.646 1.00133.88 H ATOM 13243 HB2 GLU A 968 -12.533 -3.532 -52.949 1.00136.00 H ATOM 13244 HB3 GLU A 968 -12.606 -2.130 -52.210 1.00136.00 H ATOM 13245 HG2 GLU A 968 -10.568 -1.524 -53.180 1.00140.51 H ATOM 13246 HG3 GLU A 968 -10.526 -2.919 -53.941 1.00140.51 H ATOM 13247 N ALA A 969 -11.516 -2.307 -49.188 1.00108.36 N ANISOU13247 N ALA A 969 12966 16196 12013 1095 944 -3561 N ATOM 13248 CA ALA A 969 -11.247 -1.323 -48.144 1.00104.62 C ANISOU13248 CA ALA A 969 12513 15677 11559 1106 943 -3357 C ATOM 13249 C ALA A 969 -10.003 -1.684 -47.331 1.00 95.46 C ANISOU13249 C ALA A 969 11340 14421 10511 1180 1002 -3324 C ATOM 13250 O ALA A 969 -9.049 -0.906 -47.274 1.00 89.08 O ANISOU13250 O ALA A 969 10513 13687 9645 1174 1029 -3238 O ATOM 13251 CB ALA A 969 -12.456 -1.193 -47.228 1.00104.12 C ANISOU13251 CB ALA A 969 12483 15497 11580 1111 890 -3277 C ATOM 13252 H ALA A 969 -12.129 -2.872 -48.976 1.00130.04 H ATOM 13253 HA ALA A 969 -11.092 -0.460 -48.558 1.00125.54 H ATOM 13254 HB1 ALA A 969 -12.262 -0.537 -46.541 1.00124.94 H ATOM 13255 HB2 ALA A 969 -13.220 -0.907 -47.753 1.00124.94 H ATOM 13256 HB3 ALA A 969 -12.638 -2.055 -46.822 1.00124.94 H ATOM 13257 N ILE A 970 -10.017 -2.857 -46.701 1.00 93.57 N ANISOU13257 N ILE A 970 11104 14016 10432 1254 1025 -3394 N ATOM 13258 CA ILE A 970 -8.886 -3.302 -45.889 1.00 96.35 C ANISOU13258 CA ILE A 970 11443 14276 10892 1340 1080 -3362 C ATOM 13259 C ILE A 970 -7.626 -3.347 -46.739 1.00102.91 C ANISOU13259 C ILE A 970 12228 15228 11646 1337 1134 -3438 C ATOM 13260 O ILE A 970 -6.525 -3.097 -46.247 1.00100.38 O ANISOU13260 O ILE A 970 11878 14914 11346 1377 1168 -3375 O ATOM 13261 CB ILE A 970 -9.144 -4.679 -45.242 1.00 97.77 C ANISOU13261 CB ILE A 970 11636 14256 11256 1428 1115 -3434 C ATOM 13262 CG1 ILE A 970 -10.292 -4.557 -44.234 1.00105.89 C ANISOU13262 CG1 ILE A 970 12708 15155 12371 1446 1077 -3330 C ATOM 13263 CG2 ILE A 970 -7.872 -5.203 -44.559 1.00 95.84 C ANISOU13263 CG2 ILE A 970 11371 13938 11107 1528 1181 -3408 C ATOM 13264 CD1 ILE A 970 -10.527 -5.784 -43.377 1.00108.10 C ANISOU13264 CD1 ILE A 970 13006 15218 12850 1549 1129 -3352 C ATOM 13265 H ILE A 970 -10.671 -3.415 -46.728 1.00112.28 H ATOM 13266 HA ILE A 970 -8.741 -2.661 -45.176 1.00115.63 H ATOM 13267 HB ILE A 970 -9.405 -5.305 -45.936 1.00117.32 H ATOM 13268 HG12 ILE A 970 -10.101 -3.817 -43.638 1.00127.07 H ATOM 13269 HG13 ILE A 970 -11.112 -4.379 -44.721 1.00127.07 H ATOM 13270 HG21 ILE A 970 -8.061 -6.068 -44.161 1.00115.01 H ATOM 13271 HG22 ILE A 970 -7.170 -5.290 -45.222 1.00115.01 H ATOM 13272 HG23 ILE A 970 -7.601 -4.574 -43.871 1.00115.01 H ATOM 13273 HD11 ILE A 970 -11.268 -5.610 -42.776 1.00129.72 H ATOM 13274 HD12 ILE A 970 -10.737 -6.535 -43.953 1.00129.72 H ATOM 13275 HD13 ILE A 970 -9.724 -5.971 -42.868 1.00129.72 H ATOM 13276 N ALA A 971 -7.797 -3.667 -48.016 1.00106.33 N ANISOU13276 N ALA A 971 12649 15766 11986 1292 1142 -3582 N ATOM 13277 CA ALA A 971 -6.704 -3.585 -48.970 1.00104.71 C ANISOU13277 CA ALA A 971 12405 15702 11679 1283 1198 -3652 C ATOM 13278 C ALA A 971 -6.146 -2.169 -48.937 1.00100.28 C ANISOU13278 C ALA A 971 11828 15266 11007 1238 1199 -3501 C ATOM 13279 O ALA A 971 -4.945 -1.967 -48.777 1.00100.45 O ANISOU13279 O ALA A 971 11808 15320 11036 1267 1250 -3475 O ATOM 13280 CB ALA A 971 -7.191 -3.935 -50.368 1.00103.25 C ANISOU13280 CB ALA A 971 12218 15636 11377 1233 1193 -3812 C ATOM 13281 H ALA A 971 -8.540 -3.936 -48.355 1.00127.60 H ATOM 13282 HA ALA A 971 -6.001 -4.205 -48.719 1.00125.66 H ATOM 13283 HB1 ALA A 971 -6.446 -3.873 -50.986 1.00123.90 H ATOM 13284 HB2 ALA A 971 -7.543 -4.839 -50.363 1.00123.90 H ATOM 13285 HB3 ALA A 971 -7.887 -3.310 -50.625 1.00123.90 H HETATM13286 N MSE A 972 -7.039 -1.191 -49.053 1.00116.19 N ANISOU13286 N MSE A 972 13871 17343 12932 1170 1144 -3405 N HETATM13287 CA MSE A 972 -6.644 0.211 -49.108 1.00116.00 C ANISOU13287 CA MSE A 972 13836 17433 12805 1121 1152 -3266 C HETATM13288 C MSE A 972 -6.069 0.698 -47.778 1.00120.75 C ANISOU13288 C MSE A 972 14423 17944 13513 1156 1148 -3140 C HETATM13289 O MSE A 972 -5.274 1.638 -47.748 1.00122.76 O ANISOU13289 O MSE A 972 14641 18279 13721 1133 1178 -3065 O HETATM13290 CB MSE A 972 -7.843 1.075 -49.512 1.00114.53 C ANISOU13290 CB MSE A 972 13689 17322 12506 1049 1097 -3192 C HETATM13291 CG MSE A 972 -7.536 2.556 -49.680 1.00115.57 C ANISOU13291 CG MSE A 972 13815 17570 12528 996 1118 -3049 C HETATM13292 SE MSE A 972 -6.002 2.930 -50.832 1.00134.78 SE ANISOU13292 SE MSE A 972 16189 20187 14832 984 1231 -3092 SE HETATM13293 CE MSE A 972 -6.575 1.962 -52.424 1.00122.79 C ANISOU13293 CE MSE A 972 14688 18790 13175 978 1231 -3276 C HETATM13294 H MSE A 972 -7.888 -1.316 -49.102 1.00139.43 H HETATM13295 HA MSE A 972 -5.965 0.313 -49.793 1.00139.20 H HETATM13296 HB2 MSE A 972 -8.187 0.750 -50.358 1.00137.44 H HETATM13297 HB3 MSE A 972 -8.527 0.994 -48.829 1.00137.44 H HETATM13298 HG2 MSE A 972 -8.310 2.993 -50.068 1.00138.69 H HETATM13299 HG3 MSE A 972 -7.349 2.936 -48.807 1.00138.69 H HETATM13300 HE1 MSE A 972 -5.897 2.055 -53.111 1.00147.34 H HETATM13301 HE2 MSE A 972 -6.692 1.026 -52.199 1.00147.34 H HETATM13302 HE3 MSE A 972 -7.415 2.335 -52.735 1.00147.34 H ATOM 13303 N LEU A 973 -6.467 0.060 -46.681 1.00 76.63 N ANISOU13303 N LEU A 973 8858 12191 8066 1214 1114 -3122 N ATOM 13304 CA LEU A 973 -5.980 0.444 -45.358 1.00 68.69 C ANISOU13304 CA LEU A 973 7840 11104 7156 1260 1101 -3010 C ATOM 13305 C LEU A 973 -4.528 0.019 -45.162 1.00 63.34 C ANISOU13305 C LEU A 973 7098 10436 6532 1323 1156 -3059 C ATOM 13306 O LEU A 973 -3.701 0.809 -44.707 1.00 55.75 O ANISOU13306 O LEU A 973 6089 9526 5566 1321 1160 -2992 O ATOM 13307 CB LEU A 973 -6.861 -0.157 -44.258 1.00 67.89 C ANISOU13307 CB LEU A 973 7787 10830 7179 1318 1060 -2970 C ATOM 13308 CG LEU A 973 -6.505 0.237 -42.820 1.00 59.90 C ANISOU13308 CG LEU A 973 6769 9739 6251 1375 1037 -2849 C ATOM 13309 CD1 LEU A 973 -7.758 0.358 -41.968 1.00 50.40 C ANISOU13309 CD1 LEU A 973 5628 8423 5097 1386 987 -2757 C ATOM 13310 CD2 LEU A 973 -5.548 -0.772 -42.192 1.00 60.86 C ANISOU13310 CD2 LEU A 973 6858 9781 6486 1481 1076 -2894 C ATOM 13311 H LEU A 973 -7.019 -0.600 -46.675 1.00 91.95 H ATOM 13312 HA LEU A 973 -6.020 1.410 -45.277 1.00 82.43 H ATOM 13313 HB2 LEU A 973 -7.777 0.120 -44.416 1.00 81.47 H ATOM 13314 HB3 LEU A 973 -6.803 -1.124 -44.315 1.00 81.47 H ATOM 13315 HG LEU A 973 -6.066 1.102 -42.830 1.00 71.88 H ATOM 13316 HD11 LEU A 973 -7.503 0.608 -41.066 1.00 60.47 H ATOM 13317 HD12 LEU A 973 -8.335 1.038 -42.349 1.00 60.47 H ATOM 13318 HD13 LEU A 973 -8.216 -0.498 -41.957 1.00 60.47 H ATOM 13319 HD21 LEU A 973 -5.345 -0.492 -41.285 1.00 73.03 H ATOM 13320 HD22 LEU A 973 -5.972 -1.644 -42.182 1.00 73.03 H ATOM 13321 HD23 LEU A 973 -4.734 -0.805 -42.718 1.00 73.03 H ATOM 13322 N HIS A 974 -4.223 -1.230 -45.499 1.00 79.22 N ANISOU13322 N HIS A 974 9102 12399 8599 1379 1199 -3184 N ATOM 13323 CA HIS A 974 -2.859 -1.739 -45.375 1.00 78.00 C ANISOU13323 CA HIS A 974 8885 12254 8498 1448 1258 -3239 C ATOM 13324 C HIS A 974 -1.892 -1.015 -46.302 1.00 74.94 C ANISOU13324 C HIS A 974 8437 12042 7996 1396 1307 -3265 C ATOM 13325 O HIS A 974 -0.722 -0.840 -45.967 1.00 71.27 O ANISOU13325 O HIS A 974 7902 11615 7561 1432 1340 -3259 O ATOM 13326 CB HIS A 974 -2.809 -3.235 -45.672 1.00 71.56 C ANISOU13326 CB HIS A 974 8080 11346 7765 1518 1306 -3375 C ATOM 13327 CG HIS A 974 -3.318 -4.089 -44.555 1.00 63.85 C ANISOU13327 CG HIS A 974 7141 10179 6939 1604 1294 -3343 C ATOM 13328 ND1 HIS A 974 -2.491 -4.606 -43.580 1.00 63.23 N ANISOU13328 ND1 HIS A 974 7032 10016 6975 1712 1324 -3309 N ATOM 13329 CD2 HIS A 974 -4.566 -4.521 -44.257 1.00 67.40 C ANISOU13329 CD2 HIS A 974 7653 10508 7448 1606 1264 -3336 C ATOM 13330 CE1 HIS A 974 -3.209 -5.317 -42.730 1.00 68.69 C ANISOU13330 CE1 HIS A 974 7774 10540 7787 1780 1321 -3271 C ATOM 13331 NE2 HIS A 974 -4.472 -5.282 -43.118 1.00 70.93 N ANISOU13331 NE2 HIS A 974 8113 10794 8045 1716 1288 -3289 N ATOM 13332 H HIS A 974 -4.786 -1.804 -45.803 1.00 95.06 H ATOM 13333 HA HIS A 974 -2.556 -1.605 -44.464 1.00 93.60 H ATOM 13334 HB2 HIS A 974 -3.353 -3.417 -46.455 1.00 85.88 H ATOM 13335 HB3 HIS A 974 -1.889 -3.490 -45.844 1.00 85.88 H ATOM 13336 HD1 HIS A 974 -1.641 -4.484 -43.533 1.00 75.87 H ATOM 13337 HD2 HIS A 974 -5.343 -4.336 -44.734 1.00 80.88 H ATOM 13338 HE1 HIS A 974 -2.881 -5.767 -41.985 1.00 82.43 H ATOM 13339 HE2 HIS A 974 -5.127 -5.672 -42.722 1.00 85.12 H ATOM 13340 N LYS A 975 -2.376 -0.607 -47.470 1.00 66.71 N ANISOU13340 N LYS A 975 7417 11110 6820 1317 1317 -3297 N ATOM 13341 CA LYS A 975 -1.532 0.095 -48.428 1.00 68.54 C ANISOU13341 CA LYS A 975 7599 11513 6931 1271 1381 -3312 C ATOM 13342 C LYS A 975 -1.008 1.412 -47.851 1.00 70.01 C ANISOU13342 C LYS A 975 7739 11754 7107 1236 1378 -3186 C ATOM 13343 O LYS A 975 0.188 1.680 -47.914 1.00 71.36 O ANISOU13343 O LYS A 975 7833 12000 7281 1249 1437 -3202 O ATOM 13344 CB LYS A 975 -2.274 0.317 -49.755 1.00 78.44 C ANISOU13344 CB LYS A 975 8893 12882 8028 1202 1389 -3354 C ATOM 13345 CG LYS A 975 -2.423 -0.965 -50.579 1.00 84.69 C ANISOU13345 CG LYS A 975 9701 13667 8811 1235 1414 -3524 C ATOM 13346 CD LYS A 975 -2.616 -0.709 -52.068 1.00 85.24 C ANISOU13346 CD LYS A 975 9782 13910 8695 1183 1448 -3589 C ATOM 13347 CE LYS A 975 -2.720 -2.030 -52.828 1.00 89.01 C ANISOU13347 CE LYS A 975 10268 14378 9173 1220 1468 -3783 C ATOM 13348 NZ LYS A 975 -2.593 -1.882 -54.306 1.00 90.40 N ANISOU13348 NZ LYS A 975 10443 14745 9159 1190 1518 -3867 N ATOM 13349 H LYS A 975 -3.187 -0.725 -47.731 1.00 80.05 H ATOM 13350 HA LYS A 975 -0.762 -0.462 -48.619 1.00 82.25 H ATOM 13351 HB2 LYS A 975 -3.163 0.657 -49.566 1.00 94.12 H ATOM 13352 HB3 LYS A 975 -1.781 0.960 -50.288 1.00 94.12 H ATOM 13353 HG2 LYS A 975 -1.623 -1.502 -50.471 1.00101.63 H ATOM 13354 HG3 LYS A 975 -3.196 -1.456 -50.258 1.00101.63 H ATOM 13355 HD2 LYS A 975 -3.436 -0.210 -52.207 1.00102.29 H ATOM 13356 HD3 LYS A 975 -1.856 -0.216 -52.413 1.00102.29 H ATOM 13357 HE2 LYS A 975 -2.013 -2.621 -52.527 1.00106.81 H ATOM 13358 HE3 LYS A 975 -3.584 -2.430 -52.644 1.00106.81 H ATOM 13359 HZ1 LYS A 975 -2.660 -2.678 -54.698 1.00108.48 H ATOM 13360 HZ2 LYS A 975 -3.237 -1.351 -54.615 1.00108.48 H ATOM 13361 HZ3 LYS A 975 -1.803 -1.526 -54.509 1.00108.48 H ATOM 13362 N ASP A 976 -1.890 2.217 -47.265 1.00 86.78 N ANISOU13362 N ASP A 976 9906 13839 9228 1194 1312 -3071 N ATOM 13363 CA ASP A 976 -1.486 3.513 -46.718 1.00 82.19 C ANISOU13363 CA ASP A 976 9283 13305 8641 1156 1309 -2964 C ATOM 13364 C ASP A 976 -0.674 3.371 -45.436 1.00 74.73 C ANISOU13364 C ASP A 976 8278 12289 7826 1225 1283 -2952 C ATOM 13365 O ASP A 976 0.220 4.176 -45.165 1.00 64.85 O ANISOU13365 O ASP A 976 6949 11110 6581 1209 1307 -2929 O ATOM 13366 CB ASP A 976 -2.709 4.393 -46.467 1.00 81.55 C ANISOU13366 CB ASP A 976 9269 13199 8520 1098 1250 -2850 C ATOM 13367 CG ASP A 976 -3.333 4.898 -47.753 1.00 89.05 C ANISOU13367 CG ASP A 976 10256 14264 9314 1025 1282 -2838 C ATOM 13368 OD1 ASP A 976 -2.579 5.303 -48.662 1.00 97.23 O ANISOU13368 OD1 ASP A 976 11250 15434 10259 995 1364 -2860 O ATOM 13369 OD2 ASP A 976 -4.576 4.884 -47.861 1.00 89.49 O ANISOU13369 OD2 ASP A 976 10381 14284 9336 1002 1227 -2806 O ATOM 13370 H ASP A 976 -2.726 2.038 -47.170 1.00104.14 H ATOM 13371 HA ASP A 976 -0.928 3.964 -47.371 1.00 98.63 H ATOM 13372 HB2 ASP A 976 -3.378 3.878 -45.990 1.00 97.87 H ATOM 13373 HB3 ASP A 976 -2.443 5.163 -45.940 1.00 97.87 H ATOM 13374 N GLY A 977 -0.984 2.344 -44.652 1.00 60.69 N ANISOU13374 N GLY A 977 6532 10376 6151 1304 1238 -2971 N ATOM 13375 CA GLY A 977 -0.236 2.069 -43.440 1.00 56.33 C ANISOU13375 CA GLY A 977 5927 9764 5711 1389 1212 -2961 C ATOM 13376 C GLY A 977 1.196 1.695 -43.768 1.00 64.97 C ANISOU13376 C GLY A 977 6925 10937 6824 1430 1279 -3052 C ATOM 13377 O GLY A 977 2.120 2.014 -43.020 1.00 64.66 O ANISOU13377 O GLY A 977 6802 10931 6837 1468 1267 -3044 O ATOM 13378 H GLY A 977 -1.626 1.793 -44.803 1.00 72.83 H ATOM 13379 HA2 GLY A 977 -0.232 2.854 -42.871 1.00 67.59 H ATOM 13380 HA3 GLY A 977 -0.648 1.335 -42.959 1.00 67.59 H ATOM 13381 N ILE A 978 1.373 1.013 -44.895 1.00 68.48 N ANISOU13381 N ILE A 978 7376 11420 7223 1426 1349 -3146 N ATOM 13382 CA ILE A 978 2.697 0.643 -45.378 1.00 67.32 C ANISOU13382 CA ILE A 978 7140 11355 7083 1464 1429 -3238 C ATOM 13383 C ILE A 978 3.416 1.869 -45.942 1.00 64.33 C ANISOU13383 C ILE A 978 6686 11136 6620 1386 1481 -3219 C ATOM 13384 O ILE A 978 4.601 2.081 -45.669 1.00 64.13 O ANISOU13384 O ILE A 978 6553 11175 6636 1413 1514 -3246 O ATOM 13385 CB ILE A 978 2.595 -0.473 -46.441 1.00 64.81 C ANISOU13385 CB ILE A 978 6860 11028 6736 1486 1492 -3354 C ATOM 13386 CG1 ILE A 978 2.261 -1.801 -45.762 1.00 60.67 C ANISOU13386 CG1 ILE A 978 6379 10339 6335 1585 1471 -3391 C ATOM 13387 CG2 ILE A 978 3.900 -0.628 -47.230 1.00 73.41 C ANISOU13387 CG2 ILE A 978 7863 12235 7795 1504 1593 -3444 C ATOM 13388 CD1 ILE A 978 1.766 -2.872 -46.709 1.00 62.04 C ANISOU13388 CD1 ILE A 978 6609 10473 6491 1595 1514 -3508 C ATOM 13389 H ILE A 978 0.732 0.750 -45.404 1.00 82.18 H ATOM 13390 HA ILE A 978 3.221 0.304 -44.636 1.00 80.78 H ATOM 13391 HB ILE A 978 1.882 -0.251 -47.060 1.00 77.77 H ATOM 13392 HG12 ILE A 978 3.060 -2.138 -45.327 1.00 72.81 H ATOM 13393 HG13 ILE A 978 1.568 -1.647 -45.101 1.00 72.81 H ATOM 13394 HG21 ILE A 978 3.791 -1.337 -47.884 1.00 88.09 H ATOM 13395 HG22 ILE A 978 4.098 0.209 -47.679 1.00 88.09 H ATOM 13396 HG23 ILE A 978 4.616 -0.852 -46.615 1.00 88.09 H ATOM 13397 HD11 ILE A 978 1.577 -3.678 -46.203 1.00 74.45 H ATOM 13398 HD12 ILE A 978 0.958 -2.558 -47.145 1.00 74.45 H ATOM 13399 HD13 ILE A 978 2.452 -3.050 -47.371 1.00 74.45 H ATOM 13400 N GLU A 979 2.691 2.678 -46.714 1.00 73.41 N ANISOU13400 N GLU A 979 7886 12349 7656 1292 1492 -3171 N ATOM 13401 CA GLU A 979 3.241 3.905 -47.288 1.00 77.53 C ANISOU13401 CA GLU A 979 8348 13014 8096 1215 1560 -3134 C ATOM 13402 C GLU A 979 3.745 4.818 -46.181 1.00 79.07 C ANISOU13402 C GLU A 979 8464 13210 8368 1207 1523 -3076 C ATOM 13403 O GLU A 979 4.792 5.452 -46.307 1.00 81.41 O ANISOU13403 O GLU A 979 8654 13610 8670 1185 1590 -3095 O ATOM 13404 CB GLU A 979 2.177 4.646 -48.105 1.00 86.13 C ANISOU13404 CB GLU A 979 9519 14151 9054 1128 1567 -3064 C ATOM 13405 CG GLU A 979 1.825 3.991 -49.439 1.00 92.96 C ANISOU13405 CG GLU A 979 10440 15075 9805 1123 1617 -3136 C ATOM 13406 CD GLU A 979 0.661 4.672 -50.148 1.00 95.48 C ANISOU13406 CD GLU A 979 10842 15445 9992 1050 1603 -3063 C ATOM 13407 OE1 GLU A 979 0.822 5.832 -50.583 1.00 98.33 O ANISOU13407 OE1 GLU A 979 11183 15912 10267 989 1664 -2982 O ATOM 13408 OE2 GLU A 979 -0.412 4.045 -50.277 1.00 95.67 O ANISOU13408 OE2 GLU A 979 10945 15406 10000 1057 1537 -3087 O ATOM 13409 H GLU A 979 1.868 2.536 -46.922 1.00 88.09 H ATOM 13410 HA GLU A 979 3.984 3.686 -47.872 1.00 93.03 H ATOM 13411 HB2 GLU A 979 1.363 4.697 -47.580 1.00103.35 H ATOM 13412 HB3 GLU A 979 2.500 5.541 -48.294 1.00103.35 H ATOM 13413 HG2 GLU A 979 2.597 4.033 -50.024 1.00111.55 H ATOM 13414 HG3 GLU A 979 1.579 3.066 -49.281 1.00111.55 H ATOM 13415 N PHE A 980 2.981 4.878 -45.095 1.00 65.47 N ANISOU13415 N PHE A 980 6792 11378 6707 1226 1419 -3013 N ATOM 13416 CA PHE A 980 3.298 5.751 -43.970 1.00 61.98 C ANISOU13416 CA PHE A 980 6285 10935 6330 1222 1366 -2966 C ATOM 13417 C PHE A 980 4.463 5.209 -43.148 1.00 63.36 C ANISOU13417 C PHE A 980 6354 11114 6607 1312 1347 -3037 C ATOM 13418 O PHE A 980 5.274 5.974 -42.625 1.00 66.25 O ANISOU13418 O PHE A 980 6610 11552 7011 1300 1343 -3052 O ATOM 13419 CB PHE A 980 2.072 5.934 -43.070 1.00 59.72 C ANISOU13419 CB PHE A 980 6093 10532 6067 1225 1264 -2876 C ATOM 13420 CG PHE A 980 2.383 6.583 -41.745 1.00 59.65 C ANISOU13420 CG PHE A 980 6024 10509 6131 1250 1192 -2848 C ATOM 13421 CD1 PHE A 980 2.532 7.959 -41.647 1.00 55.17 C ANISOU13421 CD1 PHE A 980 5405 10014 5544 1170 1208 -2815 C ATOM 13422 CD2 PHE A 980 2.530 5.817 -40.598 1.00 58.46 C ANISOU13422 CD2 PHE A 980 5867 10280 6066 1357 1114 -2859 C ATOM 13423 CE1 PHE A 980 2.821 8.558 -40.429 1.00 53.61 C ANISOU13423 CE1 PHE A 980 5145 9813 5411 1193 1136 -2813 C ATOM 13424 CE2 PHE A 980 2.819 6.412 -39.379 1.00 53.10 C ANISOU13424 CE2 PHE A 980 5130 9608 5436 1388 1039 -2844 C ATOM 13425 CZ PHE A 980 2.962 7.783 -39.295 1.00 52.65 C ANISOU13425 CZ PHE A 980 5018 9628 5360 1304 1044 -2830 C ATOM 13426 H PHE A 980 2.264 4.416 -44.984 1.00 78.57 H ATOM 13427 HA PHE A 980 3.553 6.623 -44.311 1.00 74.38 H ATOM 13428 HB2 PHE A 980 1.427 6.493 -43.530 1.00 71.67 H ATOM 13429 HB3 PHE A 980 1.684 5.064 -42.890 1.00 71.67 H ATOM 13430 HD1 PHE A 980 2.437 8.486 -42.407 1.00 66.21 H ATOM 13431 HD2 PHE A 980 2.434 4.894 -40.647 1.00 70.15 H ATOM 13432 HE1 PHE A 980 2.917 9.482 -40.376 1.00 64.33 H ATOM 13433 HE2 PHE A 980 2.914 5.887 -38.616 1.00 63.72 H ATOM 13434 HZ PHE A 980 3.156 8.183 -38.478 1.00 63.18 H ATOM 13435 N ALA A 981 4.536 3.888 -43.029 1.00 72.23 N ANISOU13435 N ALA A 981 7504 12161 7778 1406 1337 -3086 N ATOM 13436 CA ALA A 981 5.597 3.249 -42.263 1.00 69.90 C ANISOU13436 CA ALA A 981 7115 11867 7576 1510 1321 -3146 C ATOM 13437 C ALA A 981 6.966 3.568 -42.860 1.00 81.48 C ANISOU13437 C ALA A 981 8446 13476 9038 1492 1409 -3225 C ATOM 13438 O ALA A 981 7.933 3.745 -42.124 1.00 88.02 O ANISOU13438 O ALA A 981 9154 14357 9932 1538 1385 -3263 O ATOM 13439 CB ALA A 981 5.377 1.744 -42.204 1.00 64.74 C ANISOU13439 CB ALA A 981 6525 11099 6974 1611 1324 -3180 C ATOM 13440 H ALA A 981 3.979 3.337 -43.384 1.00 86.67 H ATOM 13441 HA ALA A 981 5.580 3.590 -41.355 1.00 83.88 H ATOM 13442 HB1 ALA A 981 6.094 1.340 -41.691 1.00 77.69 H ATOM 13443 HB2 ALA A 981 4.524 1.567 -41.778 1.00 77.69 H ATOM 13444 HB3 ALA A 981 5.376 1.390 -43.107 1.00 77.69 H ATOM 13445 N PHE A 982 7.037 3.660 -44.187 1.00 92.12 N ANISOU13445 N PHE A 982 9806 14892 10304 1428 1513 -3252 N ATOM 13446 CA PHE A 982 8.295 3.956 -44.880 1.00 93.16 C ANISOU13446 CA PHE A 982 9813 15159 10425 1409 1622 -3320 C ATOM 13447 C PHE A 982 8.287 5.364 -45.469 1.00 94.05 C ANISOU13447 C PHE A 982 9892 15376 10464 1288 1687 -3271 C ATOM 13448 O PHE A 982 8.914 5.623 -46.497 1.00 96.65 O ANISOU13448 O PHE A 982 10170 15813 10739 1248 1811 -3298 O ATOM 13449 CB PHE A 982 8.565 2.937 -45.994 1.00 91.21 C ANISOU13449 CB PHE A 982 9594 14926 10136 1446 1717 -3394 C ATOM 13450 CG PHE A 982 8.717 1.525 -45.505 1.00 96.61 C ANISOU13450 CG PHE A 982 10296 15506 10906 1569 1685 -3451 C ATOM 13451 CD1 PHE A 982 9.910 1.088 -44.951 1.00 99.63 C ANISOU13451 CD1 PHE A 982 10559 15914 11382 1658 1698 -3509 C ATOM 13452 CD2 PHE A 982 7.666 0.631 -45.606 1.00 97.81 C ANISOU13452 CD2 PHE A 982 10578 15534 11050 1597 1652 -3446 C ATOM 13453 CE1 PHE A 982 10.047 -0.216 -44.503 1.00 99.48 C ANISOU13453 CE1 PHE A 982 10560 15794 11445 1781 1683 -3549 C ATOM 13454 CE2 PHE A 982 7.796 -0.671 -45.161 1.00 97.35 C ANISOU13454 CE2 PHE A 982 10538 15368 11083 1712 1643 -3494 C ATOM 13455 CZ PHE A 982 8.988 -1.095 -44.609 1.00 97.80 C ANISOU13455 CZ PHE A 982 10484 15446 11230 1807 1663 -3539 C ATOM 13456 H PHE A 982 6.367 3.554 -44.715 1.00110.55 H ATOM 13457 HA PHE A 982 9.025 3.902 -44.244 1.00111.79 H ATOM 13458 HB2 PHE A 982 7.824 2.955 -46.620 1.00109.46 H ATOM 13459 HB3 PHE A 982 9.386 3.182 -46.450 1.00109.46 H ATOM 13460 HD1 PHE A 982 10.626 1.677 -44.877 1.00119.56 H ATOM 13461 HD2 PHE A 982 6.860 0.910 -45.977 1.00117.37 H ATOM 13462 HE1 PHE A 982 10.851 -0.499 -44.131 1.00119.38 H ATOM 13463 HE2 PHE A 982 7.082 -1.261 -45.234 1.00116.82 H ATOM 13464 HZ PHE A 982 9.077 -1.970 -44.309 1.00117.36 H ATOM 13465 N LYS A 983 7.580 6.275 -44.810 1.00 94.74 N ANISOU13465 N LYS A 983 10011 15432 10555 1234 1615 -3193 N ATOM 13466 CA LYS A 983 7.494 7.654 -45.271 1.00 96.16 C ANISOU13466 CA LYS A 983 10163 15693 10679 1121 1684 -3135 C ATOM 13467 C LYS A 983 8.861 8.331 -45.205 1.00 99.20 C ANISOU13467 C LYS A 983 10370 16195 11128 1095 1764 -3193 C ATOM 13468 O LYS A 983 9.383 8.784 -46.225 1.00103.40 O ANISOU13468 O LYS A 983 10851 16826 11609 1039 1904 -3191 O ATOM 13469 CB LYS A 983 6.475 8.426 -44.430 1.00 92.85 C ANISOU13469 CB LYS A 983 9809 15200 10269 1082 1587 -3049 C ATOM 13470 CG LYS A 983 6.340 9.904 -44.782 1.00 88.53 C ANISOU13470 CG LYS A 983 9235 14722 9682 968 1663 -2983 C ATOM 13471 CD LYS A 983 5.374 10.622 -43.839 1.00 92.40 C ANISOU13471 CD LYS A 983 9784 15131 10194 941 1564 -2910 C ATOM 13472 CE LYS A 983 5.898 10.693 -42.400 1.00 96.06 C ANISOU13472 CE LYS A 983 10154 15570 10774 993 1458 -2971 C ATOM 13473 NZ LYS A 983 4.889 11.211 -41.434 1.00 88.13 N ANISOU13473 NZ LYS A 983 9224 14477 9783 989 1354 -2904 N ATOM 13474 H LYS A 983 7.138 6.118 -44.089 1.00113.69 H ATOM 13475 HA LYS A 983 7.195 7.664 -46.193 1.00115.39 H ATOM 13476 HB2 LYS A 983 5.603 8.016 -44.547 1.00111.42 H ATOM 13477 HB3 LYS A 983 6.737 8.370 -43.498 1.00111.42 H ATOM 13478 HG2 LYS A 983 7.208 10.330 -44.710 1.00106.24 H ATOM 13479 HG3 LYS A 983 5.999 9.987 -45.687 1.00106.24 H ATOM 13480 HD2 LYS A 983 5.239 11.529 -44.155 1.00110.88 H ATOM 13481 HD3 LYS A 983 4.530 10.145 -43.828 1.00110.88 H ATOM 13482 HE2 LYS A 983 6.156 9.803 -42.114 1.00115.27 H ATOM 13483 HE3 LYS A 983 6.667 11.284 -42.374 1.00115.27 H ATOM 13484 HZ1 LYS A 983 5.236 11.235 -40.615 1.00105.75 H ATOM 13485 HZ2 LYS A 983 4.639 12.033 -41.666 1.00105.75 H ATOM 13486 HZ3 LYS A 983 4.173 10.682 -41.429 1.00105.75 H ATOM 13487 N GLU A 984 9.434 8.395 -44.007 1.00127.47 N ANISOU13487 N GLU A 984 13849 19766 14817 1139 1677 -3244 N ATOM 13488 CA GLU A 984 10.713 9.073 -43.801 1.00134.23 C ANISOU13488 CA GLU A 984 14515 20732 15756 1111 1735 -3316 C ATOM 13489 C GLU A 984 11.825 8.058 -43.516 1.00136.98 C ANISOU13489 C GLU A 984 14760 21111 16176 1218 1722 -3418 C ATOM 13490 O GLU A 984 11.639 7.170 -42.685 1.00137.38 O ANISOU13490 O GLU A 984 14852 21086 16261 1322 1606 -3435 O ATOM 13491 CB GLU A 984 10.602 10.060 -42.639 1.00135.11 C ANISOU13491 CB GLU A 984 14562 20837 15939 1074 1644 -3319 C ATOM 13492 CG GLU A 984 9.524 11.119 -42.830 1.00135.13 C ANISOU13492 CG GLU A 984 14657 20801 15883 972 1662 -3216 C ATOM 13493 CD GLU A 984 9.854 12.104 -43.938 1.00136.18 C ANISOU13493 CD GLU A 984 14734 21022 15985 858 1842 -3177 C ATOM 13494 OE1 GLU A 984 10.699 12.997 -43.710 1.00132.89 O ANISOU13494 OE1 GLU A 984 14155 20676 15662 796 1905 -3228 O ATOM 13495 OE2 GLU A 984 9.267 11.988 -45.034 1.00133.84 O ANISOU13495 OE2 GLU A 984 14551 20727 15574 833 1926 -3096 O ATOM 13496 H GLU A 984 9.102 8.052 -43.292 1.00152.96 H ATOM 13497 HA GLU A 984 10.948 9.567 -44.602 1.00161.08 H ATOM 13498 HB2 GLU A 984 10.394 9.568 -41.830 1.00162.14 H ATOM 13499 HB3 GLU A 984 11.452 10.518 -42.536 1.00162.14 H ATOM 13500 HG2 GLU A 984 8.689 10.682 -43.057 1.00162.15 H ATOM 13501 HG3 GLU A 984 9.423 11.619 -42.004 1.00162.15 H ATOM 13502 N PRO A 985 12.977 8.169 -44.214 1.00103.97 N ANISOU13502 N PRO A 985 10445 17037 12021 1201 1853 -3477 N ATOM 13503 CA PRO A 985 14.088 7.242 -43.935 1.00102.91 C ANISOU13503 CA PRO A 985 10201 16939 11963 1308 1847 -3575 C ATOM 13504 C PRO A 985 14.952 7.614 -42.725 1.00103.88 C ANISOU13504 C PRO A 985 10149 17114 12205 1338 1758 -3656 C ATOM 13505 O PRO A 985 14.773 8.680 -42.137 1.00108.72 O ANISOU13505 O PRO A 985 10712 17745 12851 1264 1711 -3652 O ATOM 13506 CB PRO A 985 14.948 7.327 -45.203 1.00105.66 C ANISOU13506 CB PRO A 985 10469 17387 12288 1270 2034 -3598 C ATOM 13507 CG PRO A 985 14.091 7.982 -46.229 1.00102.98 C ANISOU13507 CG PRO A 985 10247 17050 11831 1170 2127 -3502 C ATOM 13508 CD PRO A 985 13.203 8.903 -45.472 1.00104.90 C ANISOU13508 CD PRO A 985 10538 17240 12079 1102 2030 -3439 C ATOM 13509 HA PRO A 985 13.756 6.336 -43.830 1.00123.50 H ATOM 13510 HB2 PRO A 985 15.737 7.862 -45.025 1.00126.79 H ATOM 13511 HB3 PRO A 985 15.198 6.434 -45.487 1.00126.79 H ATOM 13512 HG2 PRO A 985 14.648 8.477 -46.851 1.00123.57 H ATOM 13513 HG3 PRO A 985 13.570 7.310 -46.696 1.00123.57 H ATOM 13514 HD2 PRO A 985 13.653 9.745 -45.299 1.00125.88 H ATOM 13515 HD3 PRO A 985 12.366 9.034 -45.945 1.00125.88 H ATOM 13516 N ASN A 986 15.889 6.729 -42.378 1.00121.10 N ANISOU13516 N ASN A 986 12235 19325 14451 1451 1736 -3735 N ATOM 13517 CA ASN A 986 16.830 6.957 -41.277 1.00124.91 C ANISOU13517 CA ASN A 986 12537 19882 15041 1500 1647 -3829 C ATOM 13518 C ASN A 986 18.195 7.429 -41.792 1.00132.27 C ANISOU13518 C ASN A 986 13257 20945 16055 1453 1774 -3911 C ATOM 13519 O ASN A 986 18.758 6.812 -42.697 1.00136.51 O ANISOU13519 O ASN A 986 13776 21509 16583 1484 1899 -3920 O ATOM 13520 CB ASN A 986 17.013 5.668 -40.463 1.00120.67 C ANISOU13520 CB ASN A 986 12021 19299 14529 1671 1538 -3854 C ATOM 13521 CG ASN A 986 17.637 5.918 -39.095 1.00121.98 C ANISOU13521 CG ASN A 986 12041 19533 14771 1739 1396 -3932 C ATOM 13522 OD1 ASN A 986 18.327 6.915 -38.887 1.00124.89 O ANISOU13522 OD1 ASN A 986 12242 20008 15203 1663 1401 -4009 O ATOM 13523 ND2 ASN A 986 17.393 5.010 -38.154 1.00121.68 N ANISOU13523 ND2 ASN A 986 12066 19438 14729 1884 1272 -3913 N ATOM 13524 H ASN A 986 16.003 5.975 -42.774 1.00145.32 H ATOM 13525 HA ASN A 986 16.474 7.640 -40.688 1.00149.89 H ATOM 13526 HB2 ASN A 986 16.146 5.255 -40.326 1.00144.80 H ATOM 13527 HB3 ASN A 986 17.594 5.065 -40.952 1.00144.80 H ATOM 13528 HD21 ASN A 986 17.724 5.108 -37.366 1.00146.02 H ATOM 13529 HD22 ASN A 986 16.905 4.326 -38.334 1.00146.02 H ATOM 13530 N PRO A 987 18.732 8.526 -41.222 1.00115.53 N ANISOU13530 N PRO A 987 10969 18903 14023 1378 1750 -3976 N ATOM 13531 CA PRO A 987 20.069 8.985 -41.629 1.00122.81 C ANISOU13531 CA PRO A 987 11666 19943 15052 1330 1872 -4056 C ATOM 13532 C PRO A 987 21.205 8.004 -41.293 1.00122.83 C ANISOU13532 C PRO A 987 11538 20007 15123 1468 1844 -4146 C ATOM 13533 O PRO A 987 22.067 7.772 -42.143 1.00121.16 O ANISOU13533 O PRO A 987 11233 19855 14948 1469 1992 -4164 O ATOM 13534 CB PRO A 987 20.246 10.290 -40.841 1.00117.76 C ANISOU13534 CB PRO A 987 10884 19351 14511 1227 1814 -4122 C ATOM 13535 CG PRO A 987 18.856 10.746 -40.542 1.00107.49 C ANISOU13535 CG PRO A 987 9764 17953 13123 1178 1736 -4038 C ATOM 13536 CD PRO A 987 18.077 9.488 -40.316 1.00103.29 C ANISOU13536 CD PRO A 987 9429 17331 12485 1313 1634 -3976 C ATOM 13537 N GLN A 988 21.207 7.440 -40.085 1.00128.89 N ANISOU13537 N GLN A 988 12301 20766 15906 1592 1664 -4193 N ATOM 13538 CA GLN A 988 22.303 6.567 -39.650 1.00128.74 C ANISOU13538 CA GLN A 988 12146 20812 15956 1734 1628 -4274 C ATOM 13539 C GLN A 988 21.897 5.443 -38.687 1.00124.85 C ANISOU13539 C GLN A 988 11762 20255 15420 1909 1471 -4251 C ATOM 13540 O GLN A 988 21.187 5.670 -37.706 1.00121.40 O ANISOU13540 O GLN A 988 11395 19784 14946 1932 1320 -4234 O ATOM 13541 CB GLN A 988 23.425 7.400 -39.022 1.00135.19 C ANISOU13541 CB GLN A 988 12699 21764 16904 1696 1589 -4404 C ATOM 13542 CG GLN A 988 24.212 8.229 -40.022 1.00137.60 C ANISOU13542 CG GLN A 988 12846 22139 17296 1556 1781 -4429 C ATOM 13543 CD GLN A 988 25.310 9.051 -39.375 1.00137.79 C ANISOU13543 CD GLN A 988 12595 22282 17478 1508 1742 -4568 C ATOM 13544 OE1 GLN A 988 25.271 9.332 -38.176 1.00136.87 O ANISOU13544 OE1 GLN A 988 12423 22197 17386 1541 1561 -4652 O ATOM 13545 NE2 GLN A 988 26.301 9.442 -40.171 1.00134.89 N ANISOU13545 NE2 GLN A 988 12050 21983 17219 1431 1913 -4594 N ATOM 13546 N GLY A 989 22.370 4.232 -38.971 1.00122.13 N ANISOU13546 N GLY A 989 11427 19891 15086 2039 1522 -4245 N ATOM 13547 CA GLY A 989 22.170 3.094 -38.088 1.00121.92 C ANISOU13547 CA GLY A 989 11476 19803 15044 2219 1405 -4217 C ATOM 13548 C GLY A 989 20.752 2.561 -38.029 1.00127.76 C ANISOU13548 C GLY A 989 12469 20382 15693 2240 1364 -4101 C ATOM 13549 O GLY A 989 20.113 2.582 -36.977 1.00131.98 O ANISOU13549 O GLY A 989 13072 20878 16196 2294 1218 -4065 O ATOM 13550 N GLU A 990 20.259 2.080 -39.164 1.00147.28 N ANISOU13550 N GLU A 990 15075 22762 18122 2199 1494 -4047 N ATOM 13551 CA GLU A 990 21.035 2.100 -40.396 1.00147.33 C ANISOU13551 CA GLU A 990 15000 22829 18150 2144 1669 -4090 C ATOM 13552 C GLU A 990 20.190 2.625 -41.550 1.00149.60 C ANISOU13552 C GLU A 990 15421 23072 18349 1997 1775 -4032 C ATOM 13553 O GLU A 990 18.961 2.533 -41.527 1.00149.98 O ANISOU13553 O GLU A 990 15653 23009 18322 1972 1725 -3955 O ATOM 13554 CB GLU A 990 21.547 0.706 -40.731 1.00147.45 C ANISOU13554 CB GLU A 990 15025 22799 18199 2288 1745 -4103 C ATOM 13555 CG GLU A 990 20.447 -0.239 -41.144 1.00148.96 C ANISOU13555 CG GLU A 990 15443 22826 18328 2322 1770 -4030 C ATOM 13556 CD GLU A 990 20.926 -1.277 -42.126 1.00150.43 C ANISOU13556 CD GLU A 990 15643 22982 18532 2389 1921 -4063 C ATOM 13557 OE1 GLU A 990 22.138 -1.579 -42.128 1.00150.11 O ANISOU13557 OE1 GLU A 990 15441 23026 18570 2467 1976 -4127 O ATOM 13558 OE2 GLU A 990 20.091 -1.788 -42.902 1.00149.94 O ANISOU13558 OE2 GLU A 990 15749 22815 18406 2364 1984 -4033 O ATOM 13559 N SER A 991 20.862 3.166 -42.561 1.00111.83 N ANISOU13559 N SER A 991 10538 18379 13572 1909 1926 -4063 N ATOM 13560 CA SER A 991 20.189 3.763 -43.708 1.00105.93 C ANISOU13560 CA SER A 991 9897 17618 12731 1776 2042 -4003 C ATOM 13561 C SER A 991 19.877 2.731 -44.788 1.00 95.57 C ANISOU13561 C SER A 991 8725 16243 11345 1822 2149 -3985 C ATOM 13562 O SER A 991 19.887 1.527 -44.533 1.00 92.72 O ANISOU13562 O SER A 991 8416 15807 11005 1950 2116 -4004 O ATOM 13563 CB SER A 991 21.048 4.887 -44.289 1.00105.61 C ANISOU13563 CB SER A 991 9683 17708 12734 1660 2171 -4031 C ATOM 13564 OG SER A 991 21.461 5.786 -43.274 1.00 93.21 O ANISOU13564 OG SER A 991 7959 16200 11258 1620 2074 -4079 O ATOM 13565 N PRO A 994 13.926 1.158 -38.941 1.00 96.59 N ANISOU13565 N PRO A 994 9578 15707 11415 2103 1310 -3610 N ATOM 13566 CA PRO A 994 14.046 2.552 -39.384 1.00101.55 C ANISOU13566 CA PRO A 994 10137 16442 12006 1952 1333 -3631 C ATOM 13567 C PRO A 994 13.335 2.825 -40.706 1.00 98.33 C ANISOU13567 C PRO A 994 9838 16003 11521 1828 1439 -3594 C ATOM 13568 O PRO A 994 13.551 2.073 -41.654 1.00 92.49 O ANISOU13568 O PRO A 994 9126 15248 10769 1847 1544 -3622 O ATOM 13569 CB PRO A 994 15.562 2.736 -39.555 1.00107.45 C ANISOU13569 CB PRO A 994 10678 17334 12812 1968 1391 -3736 C ATOM 13570 CG PRO A 994 16.187 1.364 -39.304 1.00104.85 C ANISOU13570 CG PRO A 994 10325 16971 12542 2133 1402 -3764 C ATOM 13571 CD PRO A 994 15.209 0.638 -38.448 1.00 94.79 C ANISOU13571 CD PRO A 994 9197 15557 11261 2227 1306 -3682 C ATOM 13572 N LEU A 995 12.504 3.864 -40.783 1.00 94.33 N ANISOU13572 N LEU A 995 9391 15491 10959 1712 1415 -3536 N ATOM 13573 CA LEU A 995 12.144 4.737 -39.665 1.00 93.80 C ANISOU13573 CA LEU A 995 9305 15430 10905 1692 1293 -3507 C ATOM 13574 C LEU A 995 10.637 4.927 -39.769 1.00 97.11 C ANISOU13574 C LEU A 995 9905 15734 11258 1635 1261 -3400 C ATOM 13575 O LEU A 995 10.067 4.644 -40.821 1.00101.72 O ANISOU13575 O LEU A 995 10591 16274 11784 1586 1342 -3368 O ATOM 13576 CB LEU A 995 12.887 6.073 -39.765 1.00100.11 C ANISOU13576 CB LEU A 995 9947 16364 11727 1585 1330 -3565 C ATOM 13577 CG LEU A 995 12.581 7.163 -38.736 1.00 95.91 C ANISOU13577 CG LEU A 995 9377 15853 11212 1542 1222 -3563 C ATOM 13578 CD1 LEU A 995 12.968 6.708 -37.340 1.00 96.74 C ANISOU13578 CD1 LEU A 995 9420 15973 11363 1678 1076 -3609 C ATOM 13579 CD2 LEU A 995 13.314 8.442 -39.108 1.00 86.34 C ANISOU13579 CD2 LEU A 995 8008 14759 10039 1416 1303 -3629 C ATOM 13580 HA LEU A 995 12.358 4.311 -38.820 1.00112.56 H ATOM 13581 HB2 LEU A 995 13.837 5.888 -39.702 1.00120.14 H ATOM 13582 HB3 LEU A 995 12.697 6.452 -40.638 1.00120.14 H ATOM 13583 HG LEU A 995 11.629 7.348 -38.741 1.00115.10 H ATOM 13584 HD11 LEU A 995 12.764 7.417 -36.710 1.00116.09 H ATOM 13585 HD12 LEU A 995 12.463 5.911 -37.117 1.00116.09 H ATOM 13586 HD13 LEU A 995 13.918 6.514 -37.324 1.00116.09 H ATOM 13587 HD21 LEU A 995 13.112 9.125 -38.448 1.00103.61 H ATOM 13588 HD22 LEU A 995 14.268 8.267 -39.122 1.00103.61 H ATOM 13589 HD23 LEU A 995 13.017 8.732 -39.985 1.00103.61 H ATOM 13590 N ASN A 996 9.992 5.391 -38.699 1.00 85.79 N ANISOU13590 N ASN A 996 8508 14258 9828 1646 1144 -3352 N ATOM 13591 CA ASN A 996 8.529 5.357 -38.604 1.00 80.99 C ANISOU13591 CA ASN A 996 8075 13523 9174 1622 1102 -3244 C ATOM 13592 C ASN A 996 8.030 3.913 -38.660 1.00 79.75 C ANISOU13592 C ASN A 996 8033 13241 9028 1721 1105 -3212 C ATOM 13593 O ASN A 996 6.837 3.659 -38.828 1.00 81.85 O ANISOU13593 O ASN A 996 8441 13395 9263 1700 1096 -3136 O ATOM 13594 CB ASN A 996 7.883 6.179 -39.734 1.00 83.93 C ANISOU13594 CB ASN A 996 8510 13906 9475 1479 1187 -3199 C ATOM 13595 CG ASN A 996 7.226 7.459 -39.243 1.00 86.33 C ANISOU13595 CG ASN A 996 8830 14210 9760 1397 1137 -3144 C ATOM 13596 OD1 ASN A 996 7.216 7.768 -38.051 1.00 93.65 O ANISOU13596 OD1 ASN A 996 9725 15132 10726 1442 1033 -3147 O ATOM 13597 ND2 ASN A 996 6.683 8.224 -40.182 1.00 82.23 N ANISOU13597 ND2 ASN A 996 8361 13704 9177 1281 1217 -3094 N ATOM 13598 H ASN A 996 10.379 5.732 -38.011 1.00102.94 H ATOM 13599 HA ASN A 996 8.255 5.740 -37.756 1.00 97.19 H ATOM 13600 HB2 ASN A 996 8.568 6.423 -40.376 1.00100.72 H ATOM 13601 HB3 ASN A 996 7.202 5.640 -40.165 1.00100.72 H ATOM 13602 HD21 ASN A 996 6.296 8.961 -39.965 1.00 98.67 H ATOM 13603 HD22 ASN A 996 6.718 7.982 -41.006 1.00 98.67 H ATOM 13604 N LEU A 997 8.952 2.971 -38.488 1.00 76.28 N ANISOU13604 N LEU A 997 7522 12817 8642 1830 1122 -3274 N ATOM 13605 CA LEU A 997 8.701 1.568 -38.793 1.00 73.52 C ANISOU13605 CA LEU A 997 7258 12357 8320 1916 1169 -3270 C ATOM 13606 C LEU A 997 7.778 0.894 -37.782 1.00 71.44 C ANISOU13606 C LEU A 997 7105 11951 8087 2008 1092 -3186 C ATOM 13607 O LEU A 997 7.148 -0.118 -38.088 1.00 73.59 O ANISOU13607 O LEU A 997 7481 12098 8382 2046 1136 -3166 O ATOM 13608 CB LEU A 997 10.032 0.812 -38.868 1.00 73.34 C ANISOU13608 CB LEU A 997 7115 12394 8355 2013 1221 -3359 C ATOM 13609 CG LEU A 997 9.995 -0.611 -39.429 1.00 79.40 C ANISOU13609 CG LEU A 997 7948 13059 9160 2092 1306 -3383 C ATOM 13610 CD1 LEU A 997 9.393 -0.644 -40.827 1.00 76.86 C ANISOU13610 CD1 LEU A 997 7714 12717 8771 1987 1396 -3400 C ATOM 13611 CD2 LEU A 997 11.396 -1.205 -39.452 1.00 86.52 C ANISOU13611 CD2 LEU A 997 8716 14035 10125 2190 1360 -3467 C ATOM 13612 H LEU A 997 9.745 3.123 -38.190 1.00 91.53 H ATOM 13613 HA LEU A 997 8.278 1.509 -39.664 1.00 88.23 H ATOM 13614 HB2 LEU A 997 10.637 1.324 -39.427 1.00 88.00 H ATOM 13615 HB3 LEU A 997 10.397 0.756 -37.971 1.00 88.00 H ATOM 13616 HG LEU A 997 9.445 -1.164 -38.852 1.00 95.28 H ATOM 13617 HD11 LEU A 997 9.387 -1.559 -41.147 1.00 92.23 H ATOM 13618 HD12 LEU A 997 8.486 -0.301 -40.787 1.00 92.23 H ATOM 13619 HD13 LEU A 997 9.930 -0.090 -41.415 1.00 92.23 H ATOM 13620 HD21 LEU A 997 11.350 -2.106 -39.810 1.00103.83 H ATOM 13621 HD22 LEU A 997 11.963 -0.654 -40.013 1.00103.83 H ATOM 13622 HD23 LEU A 997 11.744 -1.226 -38.547 1.00103.83 H ATOM 13623 N ALA A 998 7.684 1.468 -36.587 1.00 68.82 N ANISOU13623 N ALA A 998 6749 11641 7759 2044 984 -3144 N ATOM 13624 CA ALA A 998 6.909 0.863 -35.506 1.00 67.22 C ANISOU13624 CA ALA A 998 6640 11318 7582 2149 917 -3056 C ATOM 13625 C ALA A 998 5.407 0.810 -35.803 1.00 59.25 C ANISOU13625 C ALA A 998 5791 10173 6550 2083 928 -2969 C ATOM 13626 O ALA A 998 4.651 0.165 -35.074 1.00 55.12 O ANISOU13626 O ALA A 998 5358 9527 6059 2163 902 -2893 O ATOM 13627 CB ALA A 998 7.162 1.611 -34.203 1.00 68.77 C ANISOU13627 CB ALA A 998 6770 11595 7763 2200 794 -3040 C ATOM 13628 H ALA A 998 8.061 2.211 -36.374 1.00 82.59 H ATOM 13629 HA ALA A 998 7.214 -0.049 -35.383 1.00 80.66 H ATOM 13630 HB1 ALA A 998 6.641 1.198 -33.496 1.00 82.52 H ATOM 13631 HB2 ALA A 998 8.107 1.562 -33.989 1.00 82.52 H ATOM 13632 HB3 ALA A 998 6.894 2.537 -34.313 1.00 82.52 H ATOM 13633 N PHE A 999 4.974 1.478 -36.869 1.00 56.76 N ANISOU13633 N PHE A 999 5507 9882 6178 1942 972 -2979 N ATOM 13634 CA PHE A 999 3.551 1.554 -37.184 1.00 55.29 C ANISOU13634 CA PHE A 999 5458 9589 5961 1873 973 -2903 C ATOM 13635 C PHE A 999 2.994 0.210 -37.654 1.00 55.71 C ANISOU13635 C PHE A 999 5601 9511 6056 1920 1038 -2912 C ATOM 13636 O PHE A 999 1.778 0.025 -37.716 1.00 54.93 O ANISOU13636 O PHE A 999 5612 9305 5953 1892 1033 -2855 O ATOM 13637 CB PHE A 999 3.284 2.631 -38.240 1.00 54.92 C ANISOU13637 CB PHE A 999 5413 9619 5833 1721 1007 -2910 C ATOM 13638 CG PHE A 999 1.835 3.017 -38.356 1.00 53.30 C ANISOU13638 CG PHE A 999 5330 9332 5588 1651 984 -2823 C ATOM 13639 CD1 PHE A 999 1.191 3.656 -37.309 1.00 56.53 C ANISOU13639 CD1 PHE A 999 5775 9702 6002 1660 901 -2738 C ATOM 13640 CD2 PHE A 999 1.118 2.742 -39.508 1.00 53.36 C ANISOU13640 CD2 PHE A 999 5414 9311 5550 1583 1041 -2832 C ATOM 13641 CE1 PHE A 999 -0.141 4.011 -37.408 1.00 53.98 C ANISOU13641 CE1 PHE A 999 5559 9302 5646 1601 885 -2656 C ATOM 13642 CE2 PHE A 999 -0.214 3.097 -39.614 1.00 52.00 C ANISOU13642 CE2 PHE A 999 5343 9075 5341 1524 1015 -2757 C ATOM 13643 CZ PHE A 999 -0.843 3.732 -38.562 1.00 53.09 C ANISOU13643 CZ PHE A 999 5515 9164 5492 1532 941 -2665 C ATOM 13644 H PHE A 999 5.483 1.895 -37.424 1.00 68.11 H ATOM 13645 HA PHE A 999 3.070 1.805 -36.380 1.00 66.35 H ATOM 13646 HB2 PHE A 999 3.786 3.428 -38.008 1.00 65.90 H ATOM 13647 HB3 PHE A 999 3.574 2.300 -39.105 1.00 65.90 H ATOM 13648 HD1 PHE A 999 1.660 3.846 -36.529 1.00 67.84 H ATOM 13649 HD2 PHE A 999 1.537 2.314 -40.220 1.00 64.03 H ATOM 13650 HE1 PHE A 999 -0.562 4.439 -36.698 1.00 64.77 H ATOM 13651 HE2 PHE A 999 -0.686 2.907 -40.393 1.00 62.40 H ATOM 13652 HZ PHE A 999 -1.740 3.971 -38.632 1.00 63.71 H ATOM 13653 N LEU A1000 3.881 -0.728 -37.972 1.00 59.93 N ANISOU13653 N LEU A1000 6082 10050 6638 1993 1103 -2989 N ATOM 13654 CA LEU A1000 3.460 -2.021 -38.501 1.00 61.04 C ANISOU13654 CA LEU A1000 6296 10067 6830 2037 1179 -3023 C ATOM 13655 C LEU A1000 2.897 -2.934 -37.416 1.00 58.09 C ANISOU13655 C LEU A1000 5985 9536 6549 2158 1166 -2951 C ATOM 13656 O LEU A1000 2.147 -3.862 -37.715 1.00 65.17 O ANISOU13656 O LEU A1000 6964 10298 7498 2178 1222 -2957 O ATOM 13657 CB LEU A1000 4.618 -2.711 -39.233 1.00 64.05 C ANISOU13657 CB LEU A1000 6598 10501 7236 2079 1266 -3133 C ATOM 13658 CG LEU A1000 5.171 -2.000 -40.475 1.00 64.30 C ANISOU13658 CG LEU A1000 6573 10680 7179 1967 1313 -3208 C ATOM 13659 CD1 LEU A1000 6.177 -2.892 -41.190 1.00 64.04 C ANISOU13659 CD1 LEU A1000 6479 10674 7179 2026 1412 -3316 C ATOM 13660 CD2 LEU A1000 4.061 -1.579 -41.436 1.00 68.85 C ANISOU13660 CD2 LEU A1000 7242 11250 7668 1844 1321 -3198 C ATOM 13661 H LEU A1000 4.733 -0.641 -37.890 1.00 71.91 H ATOM 13662 HA LEU A1000 2.754 -1.871 -39.150 1.00 73.25 H ATOM 13663 HB2 LEU A1000 5.354 -2.810 -38.609 1.00 76.86 H ATOM 13664 HB3 LEU A1000 4.317 -3.589 -39.515 1.00 76.86 H ATOM 13665 HG LEU A1000 5.637 -1.197 -40.193 1.00 77.16 H ATOM 13666 HD11 LEU A1000 6.513 -2.424 -41.970 1.00 76.85 H ATOM 13667 HD12 LEU A1000 6.907 -3.093 -40.584 1.00 76.85 H ATOM 13668 HD13 LEU A1000 5.735 -3.712 -41.460 1.00 76.85 H ATOM 13669 HD21 LEU A1000 4.458 -1.136 -42.202 1.00 82.62 H ATOM 13670 HD22 LEU A1000 3.577 -2.369 -41.725 1.00 82.62 H ATOM 13671 HD23 LEU A1000 3.460 -0.972 -40.977 1.00 82.62 H ATOM 13672 N ASP A1001 3.245 -2.675 -36.160 1.00 68.60 N ANISOU13672 N ASP A1001 7275 10888 7902 2243 1096 -2886 N ATOM 13673 CA ASP A1001 2.696 -3.461 -35.063 1.00 75.05 C ANISOU13673 CA ASP A1001 8152 11565 8799 2365 1089 -2798 C ATOM 13674 C ASP A1001 1.267 -3.001 -34.799 1.00 82.31 C ANISOU13674 C ASP A1001 9179 12403 9692 2300 1047 -2709 C ATOM 13675 O ASP A1001 0.437 -3.763 -34.301 1.00 87.61 O ANISOU13675 O ASP A1001 9929 12922 10437 2364 1078 -2643 O ATOM 13676 CB ASP A1001 3.549 -3.317 -33.802 1.00 78.16 C ANISOU13676 CB ASP A1001 8462 12032 9202 2488 1019 -2761 C ATOM 13677 CG ASP A1001 3.343 -4.461 -32.823 1.00 88.00 C ANISOU13677 CG ASP A1001 9746 13140 10549 2650 1052 -2683 C ATOM 13678 OD1 ASP A1001 3.197 -5.620 -33.273 1.00 87.72 O ANISOU13678 OD1 ASP A1001 9748 12970 10613 2695 1163 -2704 O ATOM 13679 OD2 ASP A1001 3.330 -4.203 -31.601 1.00 91.69 O ANISOU13679 OD2 ASP A1001 10204 13634 10998 2738 971 -2602 O ATOM 13680 H ASP A1001 3.791 -2.057 -35.918 1.00 82.32 H ATOM 13681 HA ASP A1001 2.676 -4.398 -35.314 1.00 90.06 H ATOM 13682 HB2 ASP A1001 4.485 -3.301 -34.054 1.00 93.79 H ATOM 13683 HB3 ASP A1001 3.311 -2.490 -33.353 1.00 93.79 H ATOM 13684 N ILE A1002 0.994 -1.746 -35.142 1.00 74.90 N ANISOU13684 N ILE A1002 8239 11563 8658 2175 988 -2703 N ATOM 13685 CA ILE A1002 -0.359 -1.206 -35.109 1.00 66.99 C ANISOU13685 CA ILE A1002 7333 10498 7623 2096 956 -2628 C ATOM 13686 C ILE A1002 -1.110 -1.704 -36.335 1.00 68.19 C ANISOU13686 C ILE A1002 7550 10584 7775 2017 1026 -2680 C ATOM 13687 O ILE A1002 -2.243 -2.176 -36.239 1.00 65.35 O ANISOU13687 O ILE A1002 7278 10098 7456 2021 1043 -2638 O ATOM 13688 CB ILE A1002 -0.345 0.338 -35.114 1.00 63.40 C ANISOU13688 CB ILE A1002 6847 10170 7074 1992 881 -2607 C ATOM 13689 CG1 ILE A1002 0.358 0.868 -33.863 1.00 63.16 C ANISOU13689 CG1 ILE A1002 6745 10217 7036 2073 797 -2577 C ATOM 13690 CG2 ILE A1002 -1.765 0.901 -35.187 1.00 60.14 C ANISOU13690 CG2 ILE A1002 6533 9691 6627 1910 858 -2528 C ATOM 13691 CD1 ILE A1002 0.664 2.348 -33.919 1.00 61.05 C ANISOU13691 CD1 ILE A1002 6416 10083 6697 1976 740 -2593 C ATOM 13692 H ILE A1002 1.586 -1.178 -35.401 1.00 89.89 H ATOM 13693 HA ILE A1002 -0.819 -1.515 -34.312 1.00 80.39 H ATOM 13694 HB ILE A1002 0.146 0.639 -35.894 1.00 76.09 H ATOM 13695 HG12 ILE A1002 -0.211 0.711 -33.094 1.00 75.79 H ATOM 13696 HG13 ILE A1002 1.198 0.395 -33.753 1.00 75.79 H ATOM 13697 HG21 ILE A1002 -1.720 1.870 -35.189 1.00 72.17 H ATOM 13698 HG22 ILE A1002 -2.186 0.587 -36.003 1.00 72.17 H ATOM 13699 HG23 ILE A1002 -2.266 0.593 -34.416 1.00 72.17 H ATOM 13700 HD11 ILE A1002 1.107 2.610 -33.097 1.00 73.26 H ATOM 13701 HD12 ILE A1002 1.243 2.523 -34.678 1.00 73.26 H ATOM 13702 HD13 ILE A1002 -0.168 2.838 -34.018 1.00 73.26 H ATOM 13703 N LEU A1003 -0.463 -1.594 -37.490 1.00 73.54 N ANISOU13703 N LEU A1003 8179 11358 8404 1949 1068 -2778 N ATOM 13704 CA LEU A1003 -1.051 -2.027 -38.749 1.00 70.09 C ANISOU13704 CA LEU A1003 7791 10897 7942 1877 1124 -2851 C ATOM 13705 C LEU A1003 -1.299 -3.534 -38.735 1.00 68.10 C ANISOU13705 C LEU A1003 7581 10494 7799 1970 1195 -2895 C ATOM 13706 O LEU A1003 -2.168 -4.038 -39.446 1.00 64.73 O ANISOU13706 O LEU A1003 7215 10002 7377 1930 1226 -2945 O ATOM 13707 CB LEU A1003 -0.122 -1.653 -39.904 1.00 67.51 C ANISOU13707 CB LEU A1003 7393 10718 7539 1808 1163 -2946 C ATOM 13708 CG LEU A1003 -0.682 -1.712 -41.326 1.00 64.49 C ANISOU13708 CG LEU A1003 7050 10371 7080 1712 1203 -3020 C ATOM 13709 CD1 LEU A1003 -1.946 -0.874 -41.469 1.00 63.40 C ANISOU13709 CD1 LEU A1003 6982 10234 6874 1617 1150 -2948 C ATOM 13710 CD2 LEU A1003 0.381 -1.240 -42.305 1.00 67.48 C ANISOU13710 CD2 LEU A1003 7350 10909 7380 1660 1250 -3094 C ATOM 13711 H LEU A1003 0.328 -1.268 -37.570 1.00 88.25 H ATOM 13712 HA LEU A1003 -1.901 -1.577 -38.881 1.00 84.11 H ATOM 13713 HB2 LEU A1003 0.182 -0.744 -39.759 1.00 81.01 H ATOM 13714 HB3 LEU A1003 0.642 -2.250 -39.877 1.00 81.01 H ATOM 13715 HG LEU A1003 -0.904 -2.632 -41.541 1.00 77.38 H ATOM 13716 HD11 LEU A1003 -2.266 -0.940 -42.382 1.00 76.08 H ATOM 13717 HD12 LEU A1003 -2.619 -1.211 -40.857 1.00 76.08 H ATOM 13718 HD13 LEU A1003 -1.738 0.049 -41.257 1.00 76.08 H ATOM 13719 HD21 LEU A1003 0.020 -1.280 -43.205 1.00 80.98 H ATOM 13720 HD22 LEU A1003 0.627 -0.328 -42.087 1.00 80.98 H ATOM 13721 HD23 LEU A1003 1.156 -1.819 -42.233 1.00 80.98 H ATOM 13722 N SER A1004 -0.532 -4.244 -37.911 1.00 68.97 N ANISOU13722 N SER A1004 7652 10553 8000 2099 1222 -2882 N ATOM 13723 CA SER A1004 -0.677 -5.689 -37.758 1.00 72.23 C ANISOU13723 CA SER A1004 8097 10803 8542 2207 1309 -2908 C ATOM 13724 C SER A1004 -2.031 -6.063 -37.156 1.00 72.80 C ANISOU13724 C SER A1004 8263 10713 8686 2229 1312 -2826 C ATOM 13725 O SER A1004 -2.465 -7.211 -37.257 1.00 71.19 O ANISOU13725 O SER A1004 8100 10357 8593 2289 1394 -2858 O ATOM 13726 CB SER A1004 0.451 -6.244 -36.883 1.00 74.51 C ANISOU13726 CB SER A1004 8316 11081 8912 2350 1336 -2884 C ATOM 13727 OG SER A1004 0.148 -7.547 -36.417 1.00 79.16 O ANISOU13727 OG SER A1004 8946 11484 9648 2471 1424 -2860 O ATOM 13728 H SER A1004 0.090 -3.906 -37.422 1.00 82.76 H ATOM 13729 HA SER A1004 -0.613 -6.107 -38.631 1.00 86.67 H ATOM 13730 HB2 SER A1004 1.267 -6.280 -37.407 1.00 89.41 H ATOM 13731 HB3 SER A1004 0.575 -5.658 -36.120 1.00 89.41 H ATOM 13732 HG SER A1004 0.040 -8.067 -37.068 1.00 95.00 H ATOM 13733 N GLU A1005 -2.695 -5.096 -36.531 1.00 96.23 N ANISOU13733 N GLU A1005 11259 13707 11598 2183 1229 -2724 N ATOM 13734 CA GLU A1005 -3.993 -5.340 -35.907 1.00 96.44 C ANISOU13734 CA GLU A1005 11366 13588 11690 2202 1233 -2636 C ATOM 13735 C GLU A1005 -5.109 -5.503 -36.943 1.00 96.61 C ANISOU13735 C GLU A1005 11447 13567 11695 2106 1250 -2708 C ATOM 13736 O GLU A1005 -6.204 -5.963 -36.612 1.00 97.61 O ANISOU13736 O GLU A1005 11633 13553 11900 2128 1275 -2667 O ATOM 13737 CB GLU A1005 -4.345 -4.200 -34.947 1.00 88.21 C ANISOU13737 CB GLU A1005 10334 12599 10582 2184 1137 -2513 C ATOM 13738 CG GLU A1005 -3.414 -4.078 -33.751 1.00 88.65 C ANISOU13738 CG GLU A1005 10334 12699 10652 2295 1100 -2445 C ATOM 13739 CD GLU A1005 -3.655 -5.149 -32.699 1.00 90.38 C ANISOU13739 CD GLU A1005 10575 12757 11007 2442 1161 -2362 C ATOM 13740 OE1 GLU A1005 -2.966 -5.121 -31.657 1.00 93.13 O ANISOU13740 OE1 GLU A1005 10878 13147 11361 2549 1123 -2301 O ATOM 13741 OE2 GLU A1005 -4.533 -6.013 -32.908 1.00 90.97 O ANISOU13741 OE2 GLU A1005 10708 12668 11188 2455 1247 -2360 O ATOM 13742 H GLU A1005 -2.416 -4.286 -36.454 1.00115.48 H ATOM 13743 HA GLU A1005 -3.943 -6.160 -35.391 1.00115.73 H ATOM 13744 HB2 GLU A1005 -4.311 -3.362 -35.434 1.00105.85 H ATOM 13745 HB3 GLU A1005 -5.242 -4.345 -34.609 1.00105.85 H ATOM 13746 HG2 GLU A1005 -2.497 -4.159 -34.056 1.00106.39 H ATOM 13747 HG3 GLU A1005 -3.550 -3.213 -33.333 1.00106.39 H ATOM 13748 N PHE A1006 -4.826 -5.126 -38.188 1.00 62.88 N ANISOU13748 N PHE A1006 7149 9422 7319 2004 1235 -2817 N ATOM 13749 CA PHE A1006 -5.822 -5.161 -39.258 1.00 62.71 C ANISOU13749 CA PHE A1006 7168 9406 7253 1906 1230 -2900 C ATOM 13750 C PHE A1006 -5.625 -6.343 -40.204 1.00 71.76 C ANISOU13750 C PHE A1006 8307 10508 8452 1925 1304 -3059 C ATOM 13751 O PHE A1006 -6.537 -6.700 -40.950 1.00 73.41 O ANISOU13751 O PHE A1006 8546 10687 8660 1871 1304 -3150 O ATOM 13752 CB PHE A1006 -5.784 -3.855 -40.056 1.00 64.08 C ANISOU13752 CB PHE A1006 7321 9763 7264 1774 1164 -2905 C ATOM 13753 CG PHE A1006 -6.226 -2.651 -39.272 1.00 64.71 C ANISOU13753 CG PHE A1006 7419 9876 7293 1740 1091 -2765 C ATOM 13754 CD1 PHE A1006 -5.353 -2.011 -38.405 1.00 68.51 C ANISOU13754 CD1 PHE A1006 7857 10410 7766 1778 1060 -2687 C ATOM 13755 CD2 PHE A1006 -7.513 -2.153 -39.406 1.00 55.57 C ANISOU13755 CD2 PHE A1006 6314 8702 6097 1671 1050 -2723 C ATOM 13756 CE1 PHE A1006 -5.757 -0.901 -37.684 1.00 58.77 C ANISOU13756 CE1 PHE A1006 6637 9204 6487 1748 992 -2573 C ATOM 13757 CE2 PHE A1006 -7.922 -1.042 -38.689 1.00 53.34 C ANISOU13757 CE2 PHE A1006 6051 8445 5772 1644 989 -2596 C ATOM 13758 CZ PHE A1006 -7.044 -0.417 -37.826 1.00 52.82 C ANISOU13758 CZ PHE A1006 5947 8424 5700 1682 961 -2523 C ATOM 13759 H PHE A1006 -4.055 -4.842 -38.442 1.00 75.45 H ATOM 13760 HA PHE A1006 -6.704 -5.241 -38.861 1.00 75.25 H ATOM 13761 HB2 PHE A1006 -4.874 -3.698 -40.353 1.00 76.90 H ATOM 13762 HB3 PHE A1006 -6.370 -3.941 -40.824 1.00 76.90 H ATOM 13763 HD1 PHE A1006 -4.486 -2.333 -38.305 1.00 82.22 H ATOM 13764 HD2 PHE A1006 -8.109 -2.571 -39.985 1.00 66.68 H ATOM 13765 HE1 PHE A1006 -5.163 -0.481 -37.105 1.00 70.52 H ATOM 13766 HE2 PHE A1006 -8.788 -0.719 -38.786 1.00 64.01 H ATOM 13767 HZ PHE A1006 -7.317 0.330 -37.343 1.00 63.39 H ATOM 13768 N SER A1007 -4.438 -6.944 -40.180 1.00 84.13 N ANISOU13768 N SER A1007 9825 12075 10064 2004 1364 -3103 N ATOM 13769 CA SER A1007 -4.132 -8.069 -41.064 1.00 86.18 C ANISOU13769 CA SER A1007 10075 12294 10377 2032 1441 -3260 C ATOM 13770 C SER A1007 -4.925 -9.310 -40.663 1.00 87.33 C ANISOU13770 C SER A1007 10269 12221 10690 2118 1507 -3277 C ATOM 13771 O SER A1007 -5.113 -10.224 -41.467 1.00 82.37 O ANISOU13771 O SER A1007 9646 11537 10113 2120 1555 -3427 O ATOM 13772 CB SER A1007 -2.629 -8.374 -41.056 1.00 82.85 C ANISOU13772 CB SER A1007 9585 11925 9970 2108 1495 -3291 C ATOM 13773 OG SER A1007 -2.141 -8.530 -39.735 1.00 80.09 O ANISOU13773 OG SER A1007 9219 11497 9713 2226 1512 -3164 O ATOM 13774 H SER A1007 -3.791 -6.720 -39.661 1.00100.95 H ATOM 13775 HA SER A1007 -4.383 -7.834 -41.971 1.00103.42 H ATOM 13776 HB2 SER A1007 -2.473 -9.196 -41.547 1.00 99.42 H ATOM 13777 HB3 SER A1007 -2.157 -7.641 -41.481 1.00 99.42 H ATOM 13778 HG SER A1007 -1.317 -8.696 -39.751 1.00 96.10 H ATOM 13779 N SER A1008 -5.387 -9.332 -39.416 1.00108.23 N ANISOU13779 N SER A1008 12950 14745 13429 2193 1513 -3125 N ATOM 13780 CA SER A1008 -6.227 -10.414 -38.914 1.00104.50 C ANISOU13780 CA SER A1008 12525 14049 13129 2281 1588 -3106 C ATOM 13781 C SER A1008 -7.484 -10.560 -39.761 1.00100.10 C ANISOU13781 C SER A1008 12000 13468 12567 2185 1555 -3225 C ATOM 13782 O SER A1008 -7.943 -11.669 -40.034 1.00101.22 O ANISOU13782 O SER A1008 12155 13463 12841 2228 1617 -3325 O ATOM 13783 CB SER A1008 -6.639 -10.138 -37.463 1.00 99.05 C ANISOU13783 CB SER A1008 11864 13263 12508 2356 1591 -2903 C ATOM 13784 OG SER A1008 -5.526 -9.790 -36.659 1.00 98.72 O ANISOU13784 OG SER A1008 11775 13286 12449 2423 1586 -2806 O ATOM 13785 H SER A1008 -5.225 -8.721 -38.832 1.00129.88 H ATOM 13786 HA SER A1008 -5.735 -11.250 -38.943 1.00125.39 H ATOM 13787 HB2 SER A1008 -7.275 -9.405 -37.453 1.00118.86 H ATOM 13788 HB3 SER A1008 -7.052 -10.936 -37.098 1.00118.86 H ATOM 13789 HG SER A1008 -5.776 -9.643 -35.871 1.00118.47 H ATOM 13790 N LYS A1009 -8.029 -9.426 -40.183 1.00100.99 N ANISOU13790 N LYS A1009 12115 13726 12531 2055 1454 -3220 N ATOM 13791 CA LYS A1009 -9.359 -9.384 -40.776 1.00100.26 C ANISOU13791 CA LYS A1009 12044 13620 12430 1965 1407 -3302 C ATOM 13792 C LYS A1009 -9.419 -9.898 -42.220 1.00102.73 C ANISOU13792 C LYS A1009 12326 14002 12706 1887 1400 -3533 C ATOM 13793 O LYS A1009 -10.330 -10.648 -42.561 1.00110.18 O ANISOU13793 O LYS A1009 13271 14840 13751 1872 1408 -3654 O ATOM 13794 CB LYS A1009 -9.909 -7.958 -40.692 1.00 93.39 C ANISOU13794 CB LYS A1009 11185 12885 11412 1865 1307 -3200 C ATOM 13795 CG LYS A1009 -11.425 -7.847 -40.825 1.00 92.16 C ANISOU13795 CG LYS A1009 11055 12683 11278 1805 1263 -3222 C ATOM 13796 CD LYS A1009 -12.140 -8.466 -39.624 1.00 90.02 C ANISOU13796 CD LYS A1009 10824 12191 11191 1911 1321 -3111 C ATOM 13797 CE LYS A1009 -13.641 -8.222 -39.666 1.00 92.00 C ANISOU13797 CE LYS A1009 11089 12401 11465 1852 1274 -3118 C ATOM 13798 NZ LYS A1009 -14.290 -8.490 -38.351 1.00 92.19 N ANISOU13798 NZ LYS A1009 11154 12234 11641 1958 1331 -2952 N ATOM 13799 H LYS A1009 -7.644 -8.658 -40.136 1.00121.19 H ATOM 13800 HA LYS A1009 -9.943 -9.950 -40.247 1.00120.31 H ATOM 13801 HB2 LYS A1009 -9.662 -7.582 -39.833 1.00112.06 H ATOM 13802 HB3 LYS A1009 -9.513 -7.432 -41.404 1.00112.06 H ATOM 13803 HG2 LYS A1009 -11.674 -6.911 -40.878 1.00110.59 H ATOM 13804 HG3 LYS A1009 -11.711 -8.316 -41.624 1.00110.59 H ATOM 13805 HD2 LYS A1009 -11.990 -9.425 -39.623 1.00108.03 H ATOM 13806 HD3 LYS A1009 -11.792 -8.073 -38.808 1.00108.03 H ATOM 13807 HE2 LYS A1009 -13.806 -7.295 -39.901 1.00110.40 H ATOM 13808 HE3 LYS A1009 -14.041 -8.810 -40.326 1.00110.40 H ATOM 13809 HZ1 LYS A1009 -15.165 -8.339 -38.408 1.00110.63 H ATOM 13810 HZ2 LYS A1009 -14.157 -9.338 -38.115 1.00110.63 H ATOM 13811 HZ3 LYS A1009 -13.943 -7.958 -37.727 1.00110.63 H ATOM 13812 N LEU A1010 -8.459 -9.506 -43.057 1.00122.28 N ANISOU13812 N LEU A1010 14764 16651 15045 1838 1387 -3601 N ATOM 13813 CA LEU A1010 -8.473 -9.872 -44.477 1.00131.10 C ANISOU13813 CA LEU A1010 15851 17866 16096 1762 1380 -3814 C ATOM 13814 C LEU A1010 -7.077 -9.722 -45.093 1.00129.85 C ANISOU13814 C LEU A1010 15653 17847 15836 1768 1414 -3857 C ATOM 13815 O LEU A1010 -6.325 -8.847 -44.659 1.00119.98 O ANISOU13815 O LEU A1010 14391 16687 14508 1773 1401 -3722 O ATOM 13816 CB LEU A1010 -9.438 -8.947 -45.222 1.00134.91 C ANISOU13816 CB LEU A1010 16334 18497 16429 1629 1283 -3841 C ATOM 13817 CG LEU A1010 -10.956 -9.126 -45.073 1.00137.70 C ANISOU13817 CG LEU A1010 16704 18756 16859 1591 1238 -3873 C ATOM 13818 CD1 LEU A1010 -11.660 -8.166 -46.021 1.00132.98 C ANISOU13818 CD1 LEU A1010 16094 18356 16077 1463 1146 -3910 C ATOM 13819 CD2 LEU A1010 -11.453 -10.550 -45.336 1.00144.46 C ANISOU13819 CD2 LEU A1010 17544 19445 17898 1621 1284 -4063 C ATOM 13820 H LEU A1010 -7.784 -9.025 -42.828 1.00146.73 H ATOM 13821 HA LEU A1010 -8.768 -10.790 -44.582 1.00157.32 H ATOM 13822 HB2 LEU A1010 -9.242 -8.039 -44.942 1.00161.90 H ATOM 13823 HB3 LEU A1010 -9.245 -9.028 -46.169 1.00161.90 H ATOM 13824 HG LEU A1010 -11.210 -8.886 -44.168 1.00165.24 H ATOM 13825 HD11 LEU A1010 -12.619 -8.278 -45.928 1.00159.58 H ATOM 13826 HD12 LEU A1010 -11.409 -7.257 -45.793 1.00159.58 H ATOM 13827 HD13 LEU A1010 -11.389 -8.366 -46.931 1.00159.58 H ATOM 13828 HD21 LEU A1010 -11.030 -11.153 -44.705 1.00173.35 H ATOM 13829 HD22 LEU A1010 -12.416 -10.574 -45.221 1.00173.35 H ATOM 13830 HD23 LEU A1010 -11.221 -10.804 -46.243 1.00173.35 H ATOM 13831 N LEU A1011 -6.694 -10.536 -46.087 1.00126.48 N ANISOU13831 N LEU A1011 15200 17443 15415 1767 1458 -4049 N ATOM 13832 CA LEU A1011 -7.427 -11.705 -46.595 1.00127.83 C ANISOU13832 CA LEU A1011 15370 17494 15704 1768 1480 -4242 C ATOM 13833 C LEU A1011 -6.458 -12.525 -47.453 1.00126.55 C ANISOU13833 C LEU A1011 15175 17362 15546 1803 1553 -4415 C ATOM 13834 O LEU A1011 -5.612 -11.955 -48.142 1.00120.89 O ANISOU13834 O LEU A1011 14432 16828 14673 1770 1554 -4429 O ATOM 13835 CB LEU A1011 -8.627 -11.302 -47.452 1.00124.62 C ANISOU13835 CB LEU A1011 14960 17189 15202 1640 1391 -4345 C ATOM 13836 CG LEU A1011 -9.271 -12.429 -48.269 1.00124.33 C ANISOU13836 CG LEU A1011 14898 17081 15262 1614 1399 -4599 C ATOM 13837 CD1 LEU A1011 -9.941 -13.428 -47.336 1.00121.55 C ANISOU13837 CD1 LEU A1011 14560 16454 15169 1687 1443 -4600 C ATOM 13838 CD2 LEU A1011 -10.261 -11.877 -49.266 1.00125.45 C ANISOU13838 CD2 LEU A1011 15019 17386 15258 1486 1301 -4706 C ATOM 13839 H LEU A1011 -5.956 -10.417 -46.512 1.00151.78 H ATOM 13840 HA LEU A1011 -7.735 -12.252 -45.856 1.00153.39 H ATOM 13841 HB2 LEU A1011 -9.311 -10.940 -46.868 1.00149.55 H ATOM 13842 HB3 LEU A1011 -8.340 -10.618 -48.077 1.00149.55 H ATOM 13843 HG LEU A1011 -8.579 -12.897 -48.762 1.00149.20 H ATOM 13844 HD11 LEU A1011 -10.344 -14.134 -47.866 1.00145.86 H ATOM 13845 HD12 LEU A1011 -9.273 -13.801 -46.740 1.00145.86 H ATOM 13846 HD13 LEU A1011 -10.624 -12.970 -46.822 1.00145.86 H ATOM 13847 HD21 LEU A1011 -10.649 -12.613 -49.765 1.00150.54 H ATOM 13848 HD22 LEU A1011 -10.956 -11.398 -48.788 1.00150.54 H ATOM 13849 HD23 LEU A1011 -9.799 -11.275 -49.870 1.00150.54 H ATOM 13850 N ARG A1012 -6.609 -13.848 -47.432 1.00113.22 N ANISOU13850 N ARG A1012 13485 15491 14042 1869 1619 -4549 N ATOM 13851 CA ARG A1012 -5.680 -14.769 -48.102 1.00115.70 C ANISOU13851 CA ARG A1012 13771 15796 14394 1925 1703 -4713 C ATOM 13852 C ARG A1012 -5.227 -14.344 -49.504 1.00115.13 C ANISOU13852 C ARG A1012 13666 15961 14115 1838 1679 -4855 C ATOM 13853 O ARG A1012 -4.030 -14.197 -49.749 1.00112.60 O ANISOU13853 O ARG A1012 13326 15738 13721 1880 1733 -4839 O ATOM 13854 CB ARG A1012 -6.290 -16.169 -48.167 1.00121.47 C ANISOU13854 CB ARG A1012 14500 16309 15343 1965 1753 -4886 C ATOM 13855 CG ARG A1012 -6.513 -16.796 -46.805 1.00125.73 C ANISOU13855 CG ARG A1012 15072 16592 16108 2088 1815 -4739 C ATOM 13856 CD ARG A1012 -6.791 -18.287 -46.918 1.00133.60 C ANISOU13856 CD ARG A1012 16058 17361 17344 2149 1894 -4912 C ATOM 13857 NE ARG A1012 -7.736 -18.753 -45.906 1.00135.91 N ANISOU13857 NE ARG A1012 16375 17417 17845 2202 1913 -4814 N ATOM 13858 CZ ARG A1012 -8.111 -20.020 -45.754 1.00134.72 C ANISOU13858 CZ ARG A1012 16215 17024 17948 2263 1987 -4919 C ATOM 13859 NH1 ARG A1012 -7.620 -20.966 -46.545 1.00140.08 N ANISOU13859 NH1 ARG A1012 16861 17661 18703 2278 2046 -5136 N ATOM 13860 NH2 ARG A1012 -8.977 -20.344 -44.805 1.00127.22 N ANISOU13860 NH2 ARG A1012 15286 15868 17183 2311 2007 -4803 N ATOM 13861 H ARG A1012 -7.254 -14.248 -47.029 1.00135.87 H ATOM 13862 HA ARG A1012 -4.881 -14.833 -47.556 1.00138.84 H ATOM 13863 HB2 ARG A1012 -7.149 -16.116 -48.615 1.00145.76 H ATOM 13864 HB3 ARG A1012 -5.693 -16.748 -48.667 1.00145.76 H ATOM 13865 HG2 ARG A1012 -5.718 -16.676 -46.263 1.00150.88 H ATOM 13866 HG3 ARG A1012 -7.277 -16.376 -46.380 1.00150.88 H ATOM 13867 HD2 ARG A1012 -7.169 -18.474 -47.792 1.00160.33 H ATOM 13868 HD3 ARG A1012 -5.961 -18.775 -46.802 1.00160.33 H ATOM 13869 HE ARG A1012 -8.072 -18.168 -45.372 1.00163.09 H ATOM 13870 HH11 ARG A1012 -7.057 -20.761 -47.162 1.00168.10 H ATOM 13871 HH12 ARG A1012 -7.865 -21.784 -46.441 1.00168.10 H ATOM 13872 HH21 ARG A1012 -9.298 -19.735 -44.289 1.00152.66 H ATOM 13873 HH22 ARG A1012 -9.219 -21.163 -44.705 1.00152.66 H ATOM 13874 N GLN A1013 -6.174 -14.164 -50.423 1.00124.12 N ANISOU13874 N GLN A1013 14798 17200 15163 1726 1605 -4994 N ATOM 13875 CA GLN A1013 -5.843 -13.714 -51.775 1.00123.47 C ANISOU13875 CA GLN A1013 14691 17359 14863 1652 1584 -5113 C ATOM 13876 C GLN A1013 -5.228 -12.315 -51.725 1.00119.95 C ANISOU13876 C GLN A1013 14248 17103 14225 1621 1559 -4916 C ATOM 13877 O GLN A1013 -4.175 -12.065 -52.317 1.00108.49 O ANISOU13877 O GLN A1013 12774 15788 12659 1635 1609 -4931 O ATOM 13878 CB GLN A1013 -7.087 -13.697 -52.674 1.00121.46 C ANISOU13878 CB GLN A1013 14425 17186 14537 1544 1496 -5276 C ATOM 13879 CG GLN A1013 -6.794 -13.289 -54.123 1.00121.75 C ANISOU13879 CG GLN A1013 14442 17483 14336 1483 1480 -5401 C ATOM 13880 CD GLN A1013 -8.044 -13.134 -54.973 1.00122.86 C ANISOU13880 CD GLN A1013 14567 17736 14377 1382 1381 -5538 C ATOM 13881 OE1 GLN A1013 -9.144 -13.506 -54.564 1.00122.78 O ANISOU13881 OE1 GLN A1013 14550 17595 14505 1352 1328 -5585 O ATOM 13882 NE2 GLN A1013 -7.876 -12.576 -56.169 1.00119.81 N ANISOU13882 NE2 GLN A1013 14172 17601 13751 1334 1359 -5599 N ATOM 13883 H GLN A1013 -7.013 -14.295 -50.290 1.00148.94 H ATOM 13884 HA GLN A1013 -5.193 -14.319 -52.165 1.00148.16 H ATOM 13885 HB2 GLN A1013 -7.474 -14.587 -52.689 1.00145.75 H ATOM 13886 HB3 GLN A1013 -7.727 -13.066 -52.311 1.00145.75 H ATOM 13887 HG2 GLN A1013 -6.328 -12.438 -54.121 1.00146.10 H ATOM 13888 HG3 GLN A1013 -6.237 -13.969 -54.534 1.00146.10 H ATOM 13889 HE21 GLN A1013 -7.092 -12.326 -56.421 1.00143.78 H ATOM 13890 HE22 GLN A1013 -8.551 -12.464 -56.691 1.00143.78 H ATOM 13891 N ASP A1014 -5.895 -11.417 -51.002 1.00111.15 N ANISOU13891 N ASP A1014 13156 15986 13089 1581 1488 -4736 N ATOM 13892 CA ASP A1014 -5.467 -10.024 -50.881 1.00101.83 C ANISOU13892 CA ASP A1014 11976 14965 11748 1540 1458 -4547 C ATOM 13893 C ASP A1014 -4.209 -9.884 -50.018 1.00100.09 C ANISOU13893 C ASP A1014 11741 14699 11588 1626 1522 -4410 C ATOM 13894 O ASP A1014 -3.541 -8.851 -50.058 1.00 94.73 O ANISOU13894 O ASP A1014 11043 14159 10790 1600 1518 -4293 O ATOM 13895 CB ASP A1014 -6.592 -9.166 -50.281 1.00 95.60 C ANISOU13895 CB ASP A1014 11218 14166 10941 1480 1367 -4402 C ATOM 13896 CG ASP A1014 -7.734 -8.914 -51.254 1.00100.99 C ANISOU13896 CG ASP A1014 11902 14966 11505 1382 1292 -4507 C ATOM 13897 OD1 ASP A1014 -8.574 -9.818 -51.444 1.00103.59 O ANISOU13897 OD1 ASP A1014 12226 15198 11935 1374 1273 -4666 O ATOM 13898 OD2 ASP A1014 -7.805 -7.798 -51.810 1.00102.76 O ANISOU13898 OD2 ASP A1014 12127 15378 11541 1314 1252 -4428 O ATOM 13899 H ASP A1014 -6.613 -11.594 -50.564 1.00133.38 H ATOM 13900 HA ASP A1014 -5.265 -9.678 -51.764 1.00122.19 H ATOM 13901 HB2 ASP A1014 -6.955 -9.621 -49.505 1.00114.72 H ATOM 13902 HB3 ASP A1014 -6.226 -8.306 -50.020 1.00114.72 H ATOM 13903 N LYS A1015 -3.893 -10.915 -49.235 1.00100.57 N ANISOU13903 N LYS A1015 11805 14567 11840 1733 1583 -4423 N ATOM 13904 CA LYS A1015 -2.693 -10.899 -48.398 1.00 94.55 C ANISOU13904 CA LYS A1015 11019 13764 11142 1829 1643 -4305 C ATOM 13905 C LYS A1015 -1.454 -10.969 -49.280 1.00102.82 C ANISOU13905 C LYS A1015 12018 14947 12102 1844 1711 -4399 C ATOM 13906 O LYS A1015 -0.449 -10.310 -49.005 1.00102.54 O ANISOU13906 O LYS A1015 11943 15000 12019 1863 1731 -4297 O ATOM 13907 CB LYS A1015 -2.678 -12.062 -47.398 1.00 94.64 C ANISOU13907 CB LYS A1015 11048 13535 11376 1956 1705 -4292 C ATOM 13908 CG LYS A1015 -3.386 -11.779 -46.073 1.00 96.30 C ANISOU13908 CG LYS A1015 11297 13615 11678 1986 1664 -4109 C ATOM 13909 CD LYS A1015 -2.938 -12.730 -44.979 1.00101.06 C ANISOU13909 CD LYS A1015 11907 14018 12475 2142 1749 -4038 C ATOM 13910 CE LYS A1015 -4.034 -12.941 -43.948 1.00100.12 C ANISOU13910 CE LYS A1015 11840 13719 12482 2179 1734 -3925 C ATOM 13911 NZ LYS A1015 -3.513 -13.632 -42.741 1.00102.82 N ANISOU13911 NZ LYS A1015 12190 13892 12987 2343 1821 -3796 N ATOM 13912 H LYS A1015 -4.356 -11.637 -49.170 1.00120.68 H ATOM 13913 HA LYS A1015 -2.663 -10.068 -47.898 1.00113.46 H ATOM 13914 HB2 LYS A1015 -3.115 -12.825 -47.806 1.00113.57 H ATOM 13915 HB3 LYS A1015 -1.756 -12.284 -47.196 1.00113.57 H ATOM 13916 HG2 LYS A1015 -3.182 -10.874 -45.789 1.00115.56 H ATOM 13917 HG3 LYS A1015 -4.342 -11.884 -46.193 1.00115.56 H ATOM 13918 HD2 LYS A1015 -2.720 -13.590 -45.371 1.00121.27 H ATOM 13919 HD3 LYS A1015 -2.163 -12.359 -44.529 1.00121.27 H ATOM 13920 HE2 LYS A1015 -4.389 -12.080 -43.676 1.00120.14 H ATOM 13921 HE3 LYS A1015 -4.737 -13.488 -44.333 1.00120.14 H ATOM 13922 HZ1 LYS A1015 -4.168 -13.747 -42.149 1.00123.39 H ATOM 13923 HZ2 LYS A1015 -3.183 -14.428 -42.965 1.00123.39 H ATOM 13924 HZ3 LYS A1015 -2.867 -13.147 -42.368 1.00123.39 H ATOM 13925 N ARG A1016 -1.528 -11.774 -50.336 1.00112.33 N ANISOU13925 N ARG A1016 13220 16168 13291 1837 1749 -4605 N ATOM 13926 CA ARG A1016 -0.458 -11.837 -51.324 1.00114.24 C ANISOU13926 CA ARG A1016 13421 16554 13431 1847 1819 -4710 C ATOM 13927 C ARG A1016 -0.268 -10.447 -51.916 1.00110.44 C ANISOU13927 C ARG A1016 12923 16302 12737 1752 1780 -4625 C ATOM 13928 O ARG A1016 0.852 -9.947 -52.008 1.00108.99 O ANISOU13928 O ARG A1016 12693 16224 12494 1772 1831 -4570 O ATOM 13929 CB ARG A1016 -0.798 -12.832 -52.440 1.00122.76 C ANISOU13929 CB ARG A1016 14507 17632 14505 1838 1849 -4958 C ATOM 13930 CG ARG A1016 0.311 -13.000 -53.485 1.00125.49 C ANISOU13930 CG ARG A1016 14815 18120 14745 1862 1935 -5081 C ATOM 13931 CD ARG A1016 -0.204 -13.558 -54.806 1.00126.87 C ANISOU13931 CD ARG A1016 15000 18373 14833 1816 1934 -5319 C ATOM 13932 NE ARG A1016 0.000 -15.000 -54.927 1.00136.23 N ANISOU13932 NE ARG A1016 16181 19402 16179 1899 2009 -5509 N ATOM 13933 CZ ARG A1016 0.027 -15.661 -56.082 1.00137.48 C ANISOU13933 CZ ARG A1016 16333 19626 16278 1893 2044 -5744 C ATOM 13934 NH1 ARG A1016 -0.132 -15.015 -57.231 1.00138.63 N ANISOU13934 NH1 ARG A1016 16477 20004 16192 1814 2012 -5810 N ATOM 13935 NH2 ARG A1016 0.218 -16.972 -56.094 1.00130.68 N ANISOU13935 NH2 ARG A1016 15465 18598 15587 1973 2116 -5912 N ATOM 13936 H ARG A1016 -2.190 -12.296 -50.503 1.00134.79 H ATOM 13937 HA ARG A1016 0.369 -12.113 -50.898 1.00137.09 H ATOM 13938 HB2 ARG A1016 -0.964 -13.701 -52.042 1.00147.31 H ATOM 13939 HB3 ARG A1016 -1.594 -12.524 -52.900 1.00147.31 H ATOM 13940 HG2 ARG A1016 0.713 -12.135 -53.662 1.00150.59 H ATOM 13941 HG3 ARG A1016 0.979 -13.613 -53.141 1.00150.59 H ATOM 13942 HD2 ARG A1016 -1.156 -13.384 -54.873 1.00152.25 H ATOM 13943 HD3 ARG A1016 0.265 -13.126 -55.537 1.00152.25 H ATOM 13944 HE ARG A1016 0.111 -15.452 -54.203 1.00163.47 H ATOM 13945 HH11 ARG A1016 -0.256 -14.164 -57.232 1.00166.36 H ATOM 13946 HH12 ARG A1016 -0.113 -15.447 -57.974 1.00166.36 H ATOM 13947 HH21 ARG A1016 0.323 -17.398 -55.355 1.00156.81 H ATOM 13948 HH22 ARG A1016 0.237 -17.397 -56.842 1.00156.81 H ATOM 13949 N THR A1017 -1.381 -9.827 -52.301 1.00105.74 N ANISOU13949 N THR A1017 12360 15779 12038 1653 1695 -4612 N ATOM 13950 CA THR A1017 -1.371 -8.507 -52.926 1.00105.59 C ANISOU13950 CA THR A1017 12335 15970 11816 1565 1663 -4525 C ATOM 13951 C THR A1017 -0.746 -7.459 -52.001 1.00106.13 C ANISOU13951 C THR A1017 12379 16054 11892 1567 1656 -4315 C ATOM 13952 O THR A1017 -0.036 -6.561 -52.458 1.00101.38 O ANISOU13952 O THR A1017 11743 15611 11165 1535 1686 -4256 O ATOM 13953 CB THR A1017 -2.803 -8.054 -53.295 1.00101.09 C ANISOU13953 CB THR A1017 11805 15447 11157 1473 1566 -4524 C ATOM 13954 OG1 THR A1017 -3.516 -9.138 -53.904 1.00 98.06 O ANISOU13954 OG1 THR A1017 11434 15011 10812 1473 1555 -4731 O ATOM 13955 CG2 THR A1017 -2.768 -6.872 -54.253 1.00102.58 C ANISOU13955 CG2 THR A1017 11991 15868 11117 1395 1556 -4470 C ATOM 13956 H THR A1017 -2.170 -10.158 -52.209 1.00126.89 H ATOM 13957 HA THR A1017 -0.846 -8.545 -53.741 1.00126.71 H ATOM 13958 HB THR A1017 -3.268 -7.778 -52.490 1.00121.31 H ATOM 13959 HG1 THR A1017 -4.294 -8.893 -54.105 1.00117.67 H ATOM 13960 HG21 THR A1017 -3.672 -6.600 -54.475 1.00123.10 H ATOM 13961 HG22 THR A1017 -2.306 -6.126 -53.841 1.00123.10 H ATOM 13962 HG23 THR A1017 -2.304 -7.120 -55.068 1.00123.10 H ATOM 13963 N VAL A1018 -1.016 -7.580 -50.703 1.00 92.34 N ANISOU13963 N VAL A1018 10647 14145 10295 1609 1619 -4207 N ATOM 13964 CA VAL A1018 -0.452 -6.671 -49.704 1.00 86.23 C ANISOU13964 CA VAL A1018 9844 13375 9543 1619 1602 -4025 C ATOM 13965 C VAL A1018 1.049 -6.892 -49.577 1.00 83.95 C ANISOU13965 C VAL A1018 9486 13115 9296 1695 1685 -4039 C ATOM 13966 O VAL A1018 1.826 -5.938 -49.542 1.00 78.51 O ANISOU13966 O VAL A1018 8745 12545 8541 1670 1696 -3957 O ATOM 13967 CB VAL A1018 -1.139 -6.849 -48.316 1.00 81.72 C ANISOU13967 CB VAL A1018 9309 12622 9118 1660 1547 -3914 C ATOM 13968 CG1 VAL A1018 -0.167 -6.579 -47.148 1.00 80.15 C ANISOU13968 CG1 VAL A1018 9065 12384 9004 1734 1559 -3790 C ATOM 13969 CG2 VAL A1018 -2.358 -5.944 -48.210 1.00 73.91 C ANISOU13969 CG2 VAL A1018 8366 11659 8057 1569 1457 -3819 C ATOM 13970 H VAL A1018 -1.528 -8.186 -50.371 1.00110.81 H ATOM 13971 HA VAL A1018 -0.596 -5.756 -49.994 1.00103.47 H ATOM 13972 HB VAL A1018 -1.445 -7.766 -48.238 1.00 98.06 H ATOM 13973 HG11 VAL A1018 -0.640 -6.703 -46.310 1.00 96.18 H ATOM 13974 HG12 VAL A1018 0.575 -7.202 -47.204 1.00 96.18 H ATOM 13975 HG13 VAL A1018 0.160 -5.668 -47.213 1.00 96.18 H ATOM 13976 HG21 VAL A1018 -2.769 -6.070 -47.341 1.00 88.69 H ATOM 13977 HG22 VAL A1018 -2.076 -5.021 -48.312 1.00 88.69 H ATOM 13978 HG23 VAL A1018 -2.986 -6.177 -48.911 1.00 88.69 H ATOM 13979 N TYR A1019 1.444 -8.159 -49.507 1.00103.95 N ANISOU13979 N TYR A1019 12014 15536 11947 1790 1748 -4148 N ATOM 13980 CA TYR A1019 2.847 -8.523 -49.381 1.00107.88 C ANISOU13980 CA TYR A1019 12441 16048 12498 1878 1834 -4173 C ATOM 13981 C TYR A1019 3.612 -8.028 -50.606 1.00113.21 C ANISOU13981 C TYR A1019 13071 16923 13019 1831 1893 -4244 C ATOM 13982 O TYR A1019 4.711 -7.487 -50.482 1.00113.56 O ANISOU13982 O TYR A1019 13042 17059 13046 1848 1934 -4193 O ATOM 13983 CB TYR A1019 2.984 -10.042 -49.230 1.00106.57 C ANISOU13983 CB TYR A1019 12289 15717 12485 1991 1901 -4287 C ATOM 13984 CG TYR A1019 4.272 -10.499 -48.571 1.00108.45 C ANISOU13984 CG TYR A1019 12460 15910 12834 2114 1975 -4260 C ATOM 13985 CD1 TYR A1019 5.510 -10.080 -49.043 1.00111.06 C ANISOU13985 CD1 TYR A1019 12710 16392 13095 2120 2033 -4279 C ATOM 13986 CD2 TYR A1019 4.247 -11.349 -47.472 1.00106.37 C ANISOU13986 CD2 TYR A1019 12210 15456 12749 2231 1994 -4208 C ATOM 13987 CE1 TYR A1019 6.684 -10.498 -48.444 1.00113.99 C ANISOU13987 CE1 TYR A1019 13008 16733 13572 2236 2096 -4260 C ATOM 13988 CE2 TYR A1019 5.417 -11.772 -46.866 1.00107.14 C ANISOU13988 CE2 TYR A1019 12240 15521 12945 2353 2061 -4177 C ATOM 13989 CZ TYR A1019 6.631 -11.343 -47.355 1.00112.47 C ANISOU13989 CZ TYR A1019 12828 16356 13549 2353 2106 -4208 C ATOM 13990 OH TYR A1019 7.800 -11.758 -46.756 1.00114.77 O ANISOU13990 OH TYR A1019 13041 16625 13941 2478 2168 -4183 O ATOM 13991 H TYR A1019 0.910 -8.833 -49.532 1.00124.74 H ATOM 13992 HA TYR A1019 3.222 -8.101 -48.593 1.00129.45 H ATOM 13993 HB2 TYR A1019 2.247 -10.367 -48.690 1.00127.88 H ATOM 13994 HB3 TYR A1019 2.946 -10.445 -50.111 1.00127.88 H ATOM 13995 HD1 TYR A1019 5.550 -9.511 -49.777 1.00133.27 H ATOM 13996 HD2 TYR A1019 3.429 -11.641 -47.140 1.00127.64 H ATOM 13997 HE1 TYR A1019 7.505 -10.209 -48.772 1.00136.79 H ATOM 13998 HE2 TYR A1019 5.383 -12.341 -46.131 1.00128.56 H ATOM 13999 HH TYR A1019 8.460 -11.424 -47.153 1.00137.72 H ATOM 14000 N VAL A1020 3.017 -8.202 -51.783 1.00118.34 N ANISOU14000 N VAL A1020 13761 17647 13556 1773 1899 -4364 N ATOM 14001 CA VAL A1020 3.614 -7.714 -53.025 1.00119.07 C ANISOU14001 CA VAL A1020 13823 17939 13478 1731 1962 -4425 C ATOM 14002 C VAL A1020 3.833 -6.203 -52.961 1.00117.15 C ANISOU14002 C VAL A1020 13551 17836 13126 1654 1939 -4269 C ATOM 14003 O VAL A1020 4.810 -5.690 -53.502 1.00119.82 O ANISOU14003 O VAL A1020 13831 18314 13383 1650 2016 -4265 O ATOM 14004 CB VAL A1020 2.740 -8.071 -54.259 1.00117.67 C ANISOU14004 CB VAL A1020 13701 17830 13177 1679 1951 -4573 C ATOM 14005 CG1 VAL A1020 3.179 -7.292 -55.504 1.00115.53 C ANISOU14005 CG1 VAL A1020 13412 17790 12694 1627 2007 -4592 C ATOM 14006 CG2 VAL A1020 2.802 -9.568 -54.537 1.00115.83 C ANISOU14006 CG2 VAL A1020 13479 17484 13047 1758 2003 -4766 C ATOM 14007 H VAL A1020 2.264 -8.601 -51.891 1.00142.01 H ATOM 14008 HA VAL A1020 4.480 -8.134 -53.143 1.00142.88 H ATOM 14009 HB VAL A1020 1.818 -7.840 -54.070 1.00141.20 H ATOM 14010 HG11 VAL A1020 2.611 -7.543 -56.250 1.00138.63 H ATOM 14011 HG12 VAL A1020 3.094 -6.342 -55.328 1.00138.63 H ATOM 14012 HG13 VAL A1020 4.103 -7.510 -55.704 1.00138.63 H ATOM 14013 HG21 VAL A1020 2.251 -9.768 -55.310 1.00139.00 H ATOM 14014 HG22 VAL A1020 3.723 -9.818 -54.714 1.00139.00 H ATOM 14015 HG23 VAL A1020 2.472 -10.047 -53.761 1.00139.00 H ATOM 14016 N TYR A1021 2.923 -5.497 -52.297 1.00120.35 N ANISOU14016 N TYR A1021 13993 18199 13537 1596 1842 -4142 N ATOM 14017 CA TYR A1021 3.035 -4.050 -52.167 1.00113.39 C ANISOU14017 CA TYR A1021 13087 17429 12568 1523 1820 -3994 C ATOM 14018 C TYR A1021 4.050 -3.692 -51.084 1.00109.85 C ANISOU14018 C TYR A1021 12560 16947 12230 1568 1830 -3902 C ATOM 14019 O TYR A1021 4.666 -2.627 -51.126 1.00108.71 O ANISOU14019 O TYR A1021 12359 16917 12029 1526 1856 -3824 O ATOM 14020 CB TYR A1021 1.672 -3.429 -51.849 1.00108.53 C ANISOU14020 CB TYR A1021 12538 16777 11920 1450 1716 -3897 C ATOM 14021 CG TYR A1021 1.651 -1.928 -52.008 1.00110.86 C ANISOU14021 CG TYR A1021 12821 17202 12099 1366 1708 -3762 C ATOM 14022 CD1 TYR A1021 1.995 -1.095 -50.953 1.00106.77 C ANISOU14022 CD1 TYR A1021 12264 16652 11652 1359 1678 -3629 C ATOM 14023 CD2 TYR A1021 1.296 -1.343 -53.217 1.00115.38 C ANISOU14023 CD2 TYR A1021 13419 17931 12490 1301 1735 -3770 C ATOM 14024 CE1 TYR A1021 1.983 0.278 -51.094 1.00103.54 C ANISOU14024 CE1 TYR A1021 11840 16350 11151 1283 1682 -3514 C ATOM 14025 CE2 TYR A1021 1.280 0.031 -53.368 1.00114.61 C ANISOU14025 CE2 TYR A1021 13312 17942 12292 1232 1745 -3637 C ATOM 14026 CZ TYR A1021 1.626 0.836 -52.301 1.00110.77 C ANISOU14026 CZ TYR A1021 12785 17407 11894 1220 1722 -3512 C ATOM 14027 OH TYR A1021 1.615 2.206 -52.434 1.00112.03 O ANISOU14027 OH TYR A1021 12934 17664 11970 1151 1743 -3387 O ATOM 14028 H TYR A1021 2.231 -5.833 -51.913 1.00144.42 H ATOM 14029 HA TYR A1021 3.346 -3.679 -53.007 1.00136.07 H ATOM 14030 HB2 TYR A1021 1.008 -3.803 -52.450 1.00130.23 H ATOM 14031 HB3 TYR A1021 1.439 -3.635 -50.930 1.00130.23 H ATOM 14032 HD1 TYR A1021 2.238 -1.468 -50.137 1.00128.12 H ATOM 14033 HD2 TYR A1021 1.063 -1.885 -53.937 1.00138.46 H ATOM 14034 HE1 TYR A1021 2.215 0.823 -50.377 1.00124.25 H ATOM 14035 HE2 TYR A1021 1.039 0.410 -54.182 1.00137.53 H ATOM 14036 HH TYR A1021 1.381 2.417 -53.213 1.00134.44 H ATOM 14037 N LEU A1022 4.225 -4.593 -50.122 1.00 89.14 N ANISOU14037 N LEU A1022 9931 14171 9768 1658 1814 -3917 N ATOM 14038 CA LEU A1022 5.169 -4.385 -49.031 1.00 90.09 C ANISOU14038 CA LEU A1022 9972 14262 9995 1718 1812 -3843 C ATOM 14039 C LEU A1022 6.607 -4.505 -49.533 1.00101.64 C ANISOU14039 C LEU A1022 11338 15831 11451 1763 1917 -3914 C ATOM 14040 O LEU A1022 7.474 -3.716 -49.151 1.00100.16 O ANISOU14040 O LEU A1022 11060 15725 11271 1756 1928 -3854 O ATOM 14041 CB LEU A1022 4.911 -5.398 -47.911 1.00 86.54 C ANISOU14041 CB LEU A1022 9550 13621 9710 1819 1777 -3833 C ATOM 14042 CG LEU A1022 5.924 -5.458 -46.763 1.00 86.05 C ANISOU14042 CG LEU A1022 9405 13527 9765 1912 1777 -3777 C ATOM 14043 CD1 LEU A1022 5.878 -4.201 -45.904 1.00 86.15 C ANISOU14043 CD1 LEU A1022 9385 13589 9759 1861 1692 -3644 C ATOM 14044 CD2 LEU A1022 5.679 -6.695 -45.919 1.00 84.55 C ANISOU14044 CD2 LEU A1022 9253 13148 9725 2031 1779 -3782 C ATOM 14045 H LEU A1022 3.803 -5.341 -50.079 1.00106.97 H ATOM 14046 HA LEU A1022 5.047 -3.494 -48.668 1.00108.10 H ATOM 14047 HB2 LEU A1022 4.048 -5.196 -47.517 1.00103.85 H ATOM 14048 HB3 LEU A1022 4.880 -6.282 -48.308 1.00103.85 H ATOM 14049 HG LEU A1022 6.816 -5.527 -47.138 1.00103.27 H ATOM 14050 HD11 LEU A1022 6.532 -4.282 -45.192 1.00103.38 H ATOM 14051 HD12 LEU A1022 6.083 -3.432 -46.458 1.00103.38 H ATOM 14052 HD13 LEU A1022 4.988 -4.110 -45.527 1.00103.38 H ATOM 14053 HD21 LEU A1022 6.327 -6.718 -45.198 1.00101.46 H ATOM 14054 HD22 LEU A1022 4.781 -6.656 -45.556 1.00101.46 H ATOM 14055 HD23 LEU A1022 5.777 -7.482 -46.478 1.00101.46 H ATOM 14056 N GLU A1023 6.854 -5.491 -50.392 1.00136.13 N ANISOU14056 N GLU A1023 15718 20197 15807 1809 1997 -4050 N ATOM 14057 CA GLU A1023 8.199 -5.755 -50.905 1.00136.25 C ANISOU14057 CA GLU A1023 15644 20302 15821 1865 2110 -4128 C ATOM 14058 C GLU A1023 8.690 -4.658 -51.853 1.00136.31 C ANISOU14058 C GLU A1023 15606 20509 15677 1783 2172 -4110 C ATOM 14059 O GLU A1023 9.872 -4.618 -52.201 1.00141.05 O ANISOU14059 O GLU A1023 16116 21203 16275 1819 2270 -4149 O ATOM 14060 CB GLU A1023 8.265 -7.128 -51.591 1.00139.36 C ANISOU14060 CB GLU A1023 16073 20634 16243 1940 2185 -4287 C ATOM 14061 CG GLU A1023 7.233 -7.336 -52.694 1.00146.09 C ANISOU14061 CG GLU A1023 17018 21518 16971 1875 2176 -4379 C ATOM 14062 CD GLU A1023 7.261 -8.737 -53.284 1.00148.68 C ANISOU14062 CD GLU A1023 17377 21772 17344 1951 2243 -4556 C ATOM 14063 OE1 GLU A1023 7.646 -9.684 -52.565 1.00147.22 O ANISOU14063 OE1 GLU A1023 17174 21440 17323 2055 2269 -4582 O ATOM 14064 OE2 GLU A1023 6.889 -8.893 -54.468 1.00148.73 O ANISOU14064 OE2 GLU A1023 17423 21867 17221 1910 2271 -4672 O ATOM 14065 H GLU A1023 6.254 -6.028 -50.696 1.00163.35 H ATOM 14066 HA GLU A1023 8.811 -5.779 -50.152 1.00163.50 H ATOM 14067 HB2 GLU A1023 9.144 -7.235 -51.986 1.00167.23 H ATOM 14068 HB3 GLU A1023 8.122 -7.815 -50.922 1.00167.23 H ATOM 14069 HG2 GLU A1023 6.347 -7.183 -52.330 1.00175.31 H ATOM 14070 HG3 GLU A1023 7.408 -6.706 -53.411 1.00175.31 H ATOM 14071 N LYS A1024 7.789 -3.769 -52.266 1.00103.96 N ANISOU14071 N LYS A1024 11568 16475 11457 1679 2126 -4045 N ATOM 14072 CA LYS A1024 8.181 -2.587 -53.031 1.00105.56 C ANISOU14072 CA LYS A1024 11731 16857 11521 1602 2190 -3993 C ATOM 14073 C LYS A1024 8.953 -1.619 -52.136 1.00107.36 C ANISOU14073 C LYS A1024 11856 17115 11822 1587 2182 -3887 C ATOM 14074 O LYS A1024 9.608 -0.697 -52.623 1.00105.72 O ANISOU14074 O LYS A1024 11580 17045 11543 1540 2262 -3849 O ATOM 14075 CB LYS A1024 6.957 -1.858 -53.594 1.00 97.00 C ANISOU14075 CB LYS A1024 10737 15823 10295 1504 2138 -3932 C ATOM 14076 CG LYS A1024 6.029 -2.696 -54.455 1.00100.49 C ANISOU14076 CG LYS A1024 11276 16251 10656 1506 2122 -4042 C ATOM 14077 CD LYS A1024 4.799 -1.881 -54.842 1.00104.67 C ANISOU14077 CD LYS A1024 11882 16833 11055 1414 2055 -3964 C ATOM 14078 CE LYS A1024 3.918 -2.576 -55.873 1.00101.52 C ANISOU14078 CE LYS A1024 11561 16468 10544 1407 2040 -4087 C ATOM 14079 NZ LYS A1024 4.247 -4.013 -56.077 1.00 96.90 N ANISOU14079 NZ LYS A1024 10975 15808 10036 1489 2076 -4263 N ATOM 14080 H LYS A1024 6.944 -3.828 -52.116 1.00124.75 H ATOM 14081 HA LYS A1024 8.752 -2.850 -53.769 1.00126.67 H ATOM 14082 HB2 LYS A1024 6.434 -1.518 -52.850 1.00116.40 H ATOM 14083 HB3 LYS A1024 7.265 -1.116 -54.137 1.00116.40 H ATOM 14084 HG2 LYS A1024 6.491 -2.963 -55.265 1.00120.59 H ATOM 14085 HG3 LYS A1024 5.738 -3.476 -53.956 1.00120.59 H ATOM 14086 HD2 LYS A1024 4.263 -1.723 -54.049 1.00125.61 H ATOM 14087 HD3 LYS A1024 5.088 -1.035 -55.219 1.00125.61 H ATOM 14088 HE2 LYS A1024 2.994 -2.522 -55.582 1.00121.82 H ATOM 14089 HE3 LYS A1024 4.020 -2.125 -56.726 1.00121.82 H ATOM 14090 HZ1 LYS A1024 3.703 -4.365 -56.686 1.00116.28 H ATOM 14091 HZ2 LYS A1024 5.087 -4.095 -56.356 1.00116.28 H ATOM 14092 HZ3 LYS A1024 4.151 -4.457 -55.312 1.00116.28 H ATOM 14093 N PHE A1025 8.862 -1.837 -50.826 1.00 91.27 N ANISOU14093 N PHE A1025 9803 14949 9925 1629 2088 -3843 N ATOM 14094 CA PHE A1025 9.434 -0.930 -49.837 1.00 86.92 C ANISOU14094 CA PHE A1025 9158 14421 9446 1615 2050 -3755 C ATOM 14095 C PHE A1025 10.580 -1.576 -49.069 1.00 84.93 C ANISOU14095 C PHE A1025 8799 14137 9334 1723 2066 -3802 C ATOM 14096 O PHE A1025 11.591 -0.929 -48.794 1.00 81.25 O ANISOU14096 O PHE A1025 8206 13762 8901 1719 2098 -3789 O ATOM 14097 CB PHE A1025 8.349 -0.483 -48.855 1.00 78.78 C ANISOU14097 CB PHE A1025 8194 13291 8448 1578 1917 -3652 C ATOM 14098 CG PHE A1025 7.301 0.393 -49.474 1.00 70.52 C ANISOU14098 CG PHE A1025 7231 12290 7273 1470 1898 -3583 C ATOM 14099 CD1 PHE A1025 6.288 -0.155 -50.241 1.00 70.64 C ANISOU14099 CD1 PHE A1025 7358 12275 7208 1453 1889 -3621 C ATOM 14100 CD2 PHE A1025 7.330 1.764 -49.289 1.00 69.58 C ANISOU14100 CD2 PHE A1025 7072 12247 7117 1388 1893 -3487 C ATOM 14101 CE1 PHE A1025 5.321 0.649 -50.814 1.00 73.39 C ANISOU14101 CE1 PHE A1025 7776 12677 7432 1362 1868 -3555 C ATOM 14102 CE2 PHE A1025 6.368 2.575 -49.860 1.00 68.84 C ANISOU14102 CE2 PHE A1025 7057 12195 6906 1298 1885 -3413 C ATOM 14103 CZ PHE A1025 5.361 2.016 -50.623 1.00 71.31 C ANISOU14103 CZ PHE A1025 7479 12484 7129 1288 1869 -3442 C ATOM 14104 H PHE A1025 8.466 -2.518 -50.480 1.00109.52 H ATOM 14105 HA PHE A1025 9.778 -0.143 -50.288 1.00104.30 H ATOM 14106 HB2 PHE A1025 7.907 -1.269 -48.499 1.00 94.54 H ATOM 14107 HB3 PHE A1025 8.766 0.016 -48.135 1.00 94.54 H ATOM 14108 HD1 PHE A1025 6.258 -1.075 -50.372 1.00 84.77 H ATOM 14109 HD2 PHE A1025 8.007 2.145 -48.777 1.00 83.49 H ATOM 14110 HE1 PHE A1025 4.645 0.270 -51.327 1.00 88.07 H ATOM 14111 HE2 PHE A1025 6.397 3.495 -49.729 1.00 82.61 H ATOM 14112 HZ PHE A1025 4.711 2.560 -51.008 1.00 85.57 H HETATM14113 N MSE A1026 10.420 -2.848 -48.716 1.00127.46 N ANISOU14113 N MSE A1026 14230 19394 14806 1821 2047 -3857 N HETATM14114 CA MSE A1026 11.446 -3.551 -47.959 1.00127.75 C ANISOU14114 CA MSE A1026 14173 19391 14976 1940 2063 -3892 C HETATM14115 C MSE A1026 12.418 -4.268 -48.892 1.00137.02 C ANISOU14115 C MSE A1026 15293 20625 16144 2000 2199 -4006 C HETATM14116 O MSE A1026 12.042 -4.687 -49.988 1.00135.65 O ANISOU14116 O MSE A1026 15193 20465 15883 1978 2263 -4078 O HETATM14117 CB MSE A1026 10.813 -4.543 -46.983 1.00120.44 C ANISOU14117 CB MSE A1026 13319 18283 14161 2031 1990 -3872 C HETATM14118 CG MSE A1026 10.093 -5.712 -47.633 1.00121.64 C ANISOU14118 CG MSE A1026 13583 18324 14312 2063 2031 -3952 C HETATM14119 SE MSE A1026 9.614 -7.086 -46.334 1.00139.18 SE ANISOU14119 SE MSE A1026 15864 20304 16715 2209 1988 -3925 SE HETATM14120 CE MSE A1026 11.337 -7.295 -45.444 1.00115.15 C ANISOU14120 CE MSE A1026 12653 17307 13790 2348 2024 -3918 C HETATM14121 H MSE A1026 9.728 -3.323 -48.903 1.00152.95 H HETATM14122 HA MSE A1026 11.943 -2.903 -47.436 1.00153.30 H HETATM14123 HB2 MSE A1026 11.512 -4.908 -46.417 1.00144.53 H HETATM14124 HB3 MSE A1026 10.167 -4.069 -46.437 1.00144.53 H HETATM14125 HG2 MSE A1026 9.278 -5.392 -48.049 1.00145.97 H HETATM14126 HG3 MSE A1026 10.674 -6.114 -48.298 1.00145.97 H HETATM14127 HE1 MSE A1026 11.254 -7.967 -44.750 1.00138.18 H HETATM14128 HE2 MSE A1026 11.997 -7.573 -46.097 1.00138.18 H HETATM14129 HE3 MSE A1026 11.595 -6.445 -45.053 1.00138.18 H ATOM 14130 N THR A1027 13.662 -4.411 -48.441 1.00 97.72 N ANISOU14130 N THR A1027 10183 15690 11258 2080 2239 -4028 N ATOM 14131 CA THR A1027 14.721 -5.013 -49.246 1.00 93.09 C ANISOU14131 CA THR A1027 9525 15169 10678 2144 2377 -4130 C ATOM 14132 C THR A1027 15.164 -6.351 -48.660 1.00 93.42 C ANISOU14132 C THR A1027 9550 15087 10860 2298 2395 -4180 C ATOM 14133 O THR A1027 14.625 -6.804 -47.651 1.00 91.44 O ANISOU14133 O THR A1027 9347 14700 10695 2354 2306 -4129 O ATOM 14134 CB THR A1027 15.931 -4.069 -49.357 1.00 92.56 C ANISOU14134 CB THR A1027 9296 15268 10606 2114 2439 -4120 C ATOM 14135 OG1 THR A1027 16.460 -3.799 -48.052 1.00 83.79 O ANISOU14135 OG1 THR A1027 8078 14148 9612 2161 2352 -4073 O ATOM 14136 CG2 THR A1027 15.518 -2.763 -50.011 1.00 92.11 C ANISOU14136 CG2 THR A1027 9257 15325 10417 1969 2451 -4063 C ATOM 14137 H THR A1027 13.922 -4.162 -47.659 1.00117.27 H ATOM 14138 HA THR A1027 14.383 -5.174 -50.140 1.00111.71 H ATOM 14139 HB THR A1027 16.616 -4.484 -49.904 1.00111.08 H ATOM 14140 HG1 THR A1027 17.120 -3.284 -48.111 1.00100.55 H ATOM 14141 HG21 THR A1027 16.283 -2.170 -50.079 1.00110.53 H ATOM 14142 HG22 THR A1027 15.171 -2.933 -50.900 1.00110.53 H ATOM 14143 HG23 THR A1027 14.830 -2.330 -49.481 1.00110.53 H ATOM 14144 N PHE A1028 16.152 -6.977 -49.291 1.00 98.92 N ANISOU14144 N PHE A1028 10177 15828 11579 2373 2521 -4272 N ATOM 14145 CA PHE A1028 16.584 -8.317 -48.901 1.00100.26 C ANISOU14145 CA PHE A1028 10337 15877 11882 2527 2565 -4325 C ATOM 14146 C PHE A1028 17.295 -8.328 -47.547 1.00 97.70 C ANISOU14146 C PHE A1028 9897 15530 11693 2624 2504 -4258 C ATOM 14147 O PHE A1028 16.931 -9.097 -46.658 1.00 97.04 O ANISOU14147 O PHE A1028 9861 15299 11712 2720 2455 -4220 O ATOM 14148 CB PHE A1028 17.497 -8.915 -49.973 1.00100.88 C ANISOU14148 CB PHE A1028 10365 16020 11945 2584 2725 -4443 C ATOM 14149 CG PHE A1028 17.823 -10.365 -49.752 1.00 96.02 C ANISOU14149 CG PHE A1028 9759 15265 11461 2743 2791 -4508 C ATOM 14150 CD1 PHE A1028 16.926 -11.353 -50.121 1.00 94.41 C ANISOU14150 CD1 PHE A1028 9694 14915 11261 2769 2808 -4574 C ATOM 14151 CD2 PHE A1028 19.027 -10.740 -49.178 1.00 98.03 C ANISOU14151 CD2 PHE A1028 9876 15532 11841 2870 2840 -4505 C ATOM 14152 CE1 PHE A1028 17.222 -12.689 -49.920 1.00 95.44 C ANISOU14152 CE1 PHE A1028 9833 14903 11526 2919 2884 -4633 C ATOM 14153 CE2 PHE A1028 19.329 -12.074 -48.976 1.00 99.08 C ANISOU14153 CE2 PHE A1028 10018 15528 12102 3026 2914 -4553 C ATOM 14154 CZ PHE A1028 18.426 -13.049 -49.348 1.00 99.79 C ANISOU14154 CZ PHE A1028 10253 15461 12201 3051 2942 -4615 C ATOM 14155 H PHE A1028 16.591 -6.647 -49.953 1.00118.70 H ATOM 14156 HA PHE A1028 15.802 -8.887 -48.828 1.00120.32 H ATOM 14157 HB2 PHE A1028 17.060 -8.837 -50.835 1.00121.06 H ATOM 14158 HB3 PHE A1028 18.332 -8.422 -49.982 1.00121.06 H ATOM 14159 HD1 PHE A1028 16.114 -11.116 -50.507 1.00113.29 H ATOM 14160 HD2 PHE A1028 19.639 -10.086 -48.926 1.00117.64 H ATOM 14161 HE1 PHE A1028 16.611 -13.344 -50.172 1.00114.53 H ATOM 14162 HE2 PHE A1028 20.141 -12.314 -48.589 1.00118.90 H ATOM 14163 HZ PHE A1028 18.627 -13.947 -49.212 1.00119.74 H ATOM 14164 N GLN A1029 18.308 -7.479 -47.392 1.00106.24 N ANISOU14164 N GLN A1029 10825 16764 12776 2604 2510 -4244 N ATOM 14165 CA GLN A1029 19.040 -7.391 -46.129 1.00107.11 C ANISOU14165 CA GLN A1029 10807 16889 13002 2692 2438 -4195 C ATOM 14166 C GLN A1029 18.136 -6.803 -45.046 1.00109.93 C ANISOU14166 C GLN A1029 11221 17194 13353 2647 2276 -4095 C ATOM 14167 O GLN A1029 18.463 -6.830 -43.860 1.00111.11 O ANISOU14167 O GLN A1029 11299 17332 13585 2731 2190 -4047 O ATOM 14168 CB GLN A1029 20.326 -6.566 -46.308 1.00111.55 C ANISOU14168 CB GLN A1029 11177 17639 13568 2668 2486 -4224 C ATOM 14169 CG GLN A1029 21.248 -6.466 -45.081 1.00118.10 C ANISOU14169 CG GLN A1029 11842 18517 14514 2765 2411 -4200 C ATOM 14170 CD GLN A1029 21.958 -7.766 -44.742 1.00119.68 C ANISOU14170 CD GLN A1029 11993 18641 14838 2952 2471 -4230 C ATOM 14171 OE1 GLN A1029 21.544 -8.847 -45.160 1.00118.44 O ANISOU14171 OE1 GLN A1029 11951 18348 14701 3018 2545 -4254 O ATOM 14172 NE2 GLN A1029 23.043 -7.662 -43.983 1.00120.32 N ANISOU14172 NE2 GLN A1029 11894 18812 15010 3040 2440 -4232 N ATOM 14173 H GLN A1029 18.592 -6.943 -48.002 1.00127.48 H ATOM 14174 HA GLN A1029 19.296 -8.284 -45.851 1.00128.54 H ATOM 14175 HB2 GLN A1029 20.845 -6.963 -47.026 1.00133.86 H ATOM 14176 HB3 GLN A1029 20.076 -5.662 -46.555 1.00133.86 H ATOM 14177 HG2 GLN A1029 21.925 -5.794 -45.252 1.00141.72 H ATOM 14178 HG3 GLN A1029 20.716 -6.209 -44.311 1.00141.72 H ATOM 14179 HE21 GLN A1029 23.306 -6.889 -43.712 1.00144.39 H ATOM 14180 HE22 GLN A1029 23.482 -8.368 -43.762 1.00144.39 H HETATM14181 N MSE A1030 16.987 -6.280 -45.465 1.00150.70 N ANISOU14181 N MSE A1030 16514 22331 18413 2522 2236 -4063 N HETATM14182 CA MSE A1030 15.949 -5.870 -44.531 1.00146.49 C ANISOU14182 CA MSE A1030 16065 21722 17874 2484 2096 -3967 C HETATM14183 C MSE A1030 15.173 -7.108 -44.089 1.00143.80 C ANISOU14183 C MSE A1030 15848 21184 17606 2585 2087 -3946 C HETATM14184 O MSE A1030 14.995 -7.356 -42.895 1.00137.90 O ANISOU14184 O MSE A1030 15103 20357 16935 2669 2006 -3873 O HETATM14185 CB MSE A1030 15.011 -4.862 -45.198 1.00145.82 C ANISOU14185 CB MSE A1030 16066 21682 17658 2318 2069 -3937 C HETATM14186 CG MSE A1030 14.318 -3.925 -44.232 1.00147.68 C ANISOU14186 CG MSE A1030 16323 21910 17877 2256 1930 -3840 C HETATM14187 SE MSE A1030 13.715 -2.276 -45.076 1.00160.09 SE ANISOU14187 SE MSE A1030 17922 23605 19299 2049 1926 -3801 SE HETATM14188 CE MSE A1030 15.318 -1.194 -44.821 1.00130.75 C ANISOU14188 CE MSE A1030 13970 20085 15623 2029 1955 -3833 C HETATM14189 H MSE A1030 16.785 -6.153 -46.291 1.00180.83 H HETATM14190 HA MSE A1030 16.356 -5.448 -43.758 1.00175.79 H HETATM14191 HB2 MSE A1030 15.525 -4.320 -45.817 1.00174.99 H HETATM14192 HB3 MSE A1030 14.324 -5.348 -45.681 1.00174.99 H HETATM14193 HG2 MSE A1030 13.542 -4.373 -43.860 1.00177.21 H HETATM14194 HG3 MSE A1030 14.936 -3.690 -43.522 1.00177.21 H HETATM14195 HE1 MSE A1030 15.169 -0.314 -45.202 1.00156.90 H HETATM14196 HE2 MSE A1030 15.500 -1.118 -43.872 1.00156.90 H HETATM14197 HE3 MSE A1030 16.064 -1.626 -45.267 1.00156.90 H ATOM 14198 N SER A1031 14.733 -7.888 -45.072 1.00102.18 N ANISOU14198 N SER A1031 10675 15838 12312 2580 2178 -4014 N ATOM 14199 CA SER A1031 13.992 -9.128 -44.843 1.00 97.56 C ANISOU14199 CA SER A1031 10205 15056 11807 2668 2198 -4016 C ATOM 14200 C SER A1031 14.767 -10.125 -43.996 1.00 99.31 C ANISOU14200 C SER A1031 10360 15192 12182 2850 2238 -4002 C ATOM 14201 O SER A1031 14.200 -10.831 -43.162 1.00100.17 O ANISOU14201 O SER A1031 10534 15141 12384 2938 2215 -3937 O ATOM 14202 CB SER A1031 13.656 -9.772 -46.197 1.00 97.45 C ANISOU14202 CB SER A1031 10273 15013 11739 2636 2301 -4132 C ATOM 14203 OG SER A1031 13.345 -11.148 -46.066 1.00100.93 O ANISOU14203 OG SER A1031 10785 15272 12292 2751 2361 -4170 O ATOM 14204 H SER A1031 14.854 -7.716 -45.906 1.00122.62 H ATOM 14205 HA SER A1031 13.160 -8.924 -44.388 1.00117.07 H ATOM 14206 HB2 SER A1031 12.891 -9.314 -46.580 1.00116.93 H ATOM 14207 HB3 SER A1031 14.422 -9.679 -46.785 1.00116.93 H ATOM 14208 HG SER A1031 12.681 -11.246 -45.561 1.00121.12 H ATOM 14209 N LEU A1032 16.075 -10.162 -44.202 1.00127.70 N ANISOU14209 N LEU A1032 13818 18896 15807 2910 2306 -4055 N ATOM 14210 CA LEU A1032 16.883 -11.278 -43.745 1.00131.38 C ANISOU14210 CA LEU A1032 14220 19283 16415 3091 2384 -4066 C ATOM 14211 C LEU A1032 17.321 -11.158 -42.289 1.00131.01 C ANISOU14211 C LEU A1032 14082 19241 16454 3196 2293 -3965 C ATOM 14212 O LEU A1032 17.308 -12.145 -41.553 1.00133.62 O ANISOU14212 O LEU A1032 14430 19431 16909 3346 2321 -3914 O ATOM 14213 CB LEU A1032 18.096 -11.411 -44.657 1.00130.89 C ANISOU14213 CB LEU A1032 14045 19338 16348 3117 2505 -4171 C ATOM 14214 CG LEU A1032 19.113 -12.492 -44.316 1.00138.28 C ANISOU14214 CG LEU A1032 14891 20217 17431 3307 2601 -4191 C ATOM 14215 CD1 LEU A1032 18.500 -13.886 -44.341 1.00139.81 C ANISOU14215 CD1 LEU A1032 15208 20187 17725 3414 2685 -4203 C ATOM 14216 CD2 LEU A1032 20.239 -12.384 -45.307 1.00145.32 C ANISOU14216 CD2 LEU A1032 15670 21252 18293 3303 2715 -4294 C ATOM 14217 H LEU A1032 16.520 -9.548 -44.606 1.00153.24 H ATOM 14218 HA LEU A1032 16.362 -12.092 -43.828 1.00157.66 H ATOM 14219 HB2 LEU A1032 17.777 -11.594 -45.555 1.00157.07 H ATOM 14220 HB3 LEU A1032 18.569 -10.565 -44.654 1.00157.07 H ATOM 14221 HG LEU A1032 19.470 -12.330 -43.429 1.00165.93 H ATOM 14222 HD11 LEU A1032 19.185 -14.536 -44.119 1.00167.77 H ATOM 14223 HD12 LEU A1032 17.782 -13.926 -43.691 1.00167.77 H ATOM 14224 HD13 LEU A1032 18.153 -14.062 -45.230 1.00167.77 H ATOM 14225 HD21 LEU A1032 20.900 -13.065 -45.108 1.00174.39 H ATOM 14226 HD22 LEU A1032 19.886 -12.516 -46.201 1.00174.39 H ATOM 14227 HD23 LEU A1032 20.638 -11.503 -45.236 1.00174.39 H ATOM 14228 N ARG A1033 17.705 -9.959 -41.867 1.00123.54 N ANISOU14228 N ARG A1033 13037 18460 15444 3125 2188 -3937 N ATOM 14229 CA ARG A1033 18.162 -9.773 -40.495 1.00130.68 C ANISOU14229 CA ARG A1033 13843 19402 16409 3225 2084 -3860 C ATOM 14230 C ARG A1033 16.968 -9.662 -39.549 1.00133.21 C ANISOU14230 C ARG A1033 14283 19612 16718 3218 1973 -3750 C ATOM 14231 O ARG A1033 15.974 -9.002 -39.858 1.00131.09 O ANISOU14231 O ARG A1033 14119 19332 16358 3077 1922 -3733 O ATOM 14232 CB ARG A1033 19.076 -8.550 -40.377 1.00134.43 C ANISOU14232 CB ARG A1033 14151 20099 16828 3158 2014 -3893 C ATOM 14233 CG ARG A1033 18.352 -7.219 -40.264 1.00132.54 C ANISOU14233 CG ARG A1033 13950 19935 16475 2993 1898 -3860 C ATOM 14234 CD ARG A1033 19.335 -6.065 -40.213 1.00132.27 C ANISOU14234 CD ARG A1033 13737 20110 16410 2929 1855 -3909 C ATOM 14235 NE ARG A1033 19.582 -5.499 -41.536 1.00136.17 N ANISOU14235 NE ARG A1033 14208 20691 16840 2795 1958 -3978 N ATOM 14236 CZ ARG A1033 20.498 -4.572 -41.794 1.00139.77 C ANISOU14236 CZ ARG A1033 14504 21317 17284 2727 1975 -4030 C ATOM 14237 NH1 ARG A1033 21.267 -4.099 -40.821 1.00139.37 N ANISOU14237 NH1 ARG A1033 14295 21375 17284 2775 1881 -4040 N ATOM 14238 NH2 ARG A1033 20.647 -4.116 -43.029 1.00141.67 N ANISOU14238 NH2 ARG A1033 14739 21626 17464 2613 2089 -4075 N ATOM 14239 H ARG A1033 17.711 -9.246 -42.347 1.00148.25 H ATOM 14240 HA ARG A1033 18.677 -10.552 -40.231 1.00156.82 H ATOM 14241 HB2 ARG A1033 19.627 -8.651 -39.585 1.00161.32 H ATOM 14242 HB3 ARG A1033 19.642 -8.509 -41.164 1.00161.32 H ATOM 14243 HG2 ARG A1033 17.780 -7.098 -41.038 1.00159.05 H ATOM 14244 HG3 ARG A1033 17.826 -7.208 -39.450 1.00159.05 H ATOM 14245 HD2 ARG A1033 18.974 -5.365 -39.647 1.00158.73 H ATOM 14246 HD3 ARG A1033 20.180 -6.382 -39.857 1.00158.73 H ATOM 14247 HE ARG A1033 19.103 -5.785 -42.191 1.00163.41 H ATOM 14248 HH11 ARG A1033 21.173 -4.392 -40.018 1.00167.24 H ATOM 14249 HH12 ARG A1033 21.858 -3.499 -40.994 1.00167.24 H ATOM 14250 HH21 ARG A1033 20.152 -4.421 -43.662 1.00170.01 H ATOM 14251 HH22 ARG A1033 21.241 -3.517 -43.197 1.00170.01 H ATOM 14252 N ARG A1034 17.077 -10.326 -38.401 1.00130.96 N ANISOU14252 N ARG A1034 13981 19248 16531 3377 1943 -3671 N ATOM 14253 CA ARG A1034 16.000 -10.380 -37.417 1.00127.90 C ANISOU14253 CA ARG A1034 13702 18743 16150 3401 1858 -3555 C ATOM 14254 C ARG A1034 16.530 -10.166 -36.003 1.00125.41 C ANISOU14254 C ARG A1034 13285 18510 15857 3526 1741 -3481 C ATOM 14255 O ARG A1034 17.010 -11.103 -35.365 1.00126.07 O ANISOU14255 O ARG A1034 13323 18528 16052 3704 1784 -3436 O ATOM 14256 CB ARG A1034 15.302 -11.739 -37.487 1.00127.80 C ANISOU14256 CB ARG A1034 13815 18490 16254 3492 1976 -3517 C ATOM 14257 CG ARG A1034 14.646 -12.044 -38.826 1.00127.55 C ANISOU14257 CG ARG A1034 13898 18373 16191 3381 2076 -3602 C ATOM 14258 CD ARG A1034 14.378 -13.532 -38.975 1.00128.91 C ANISOU14258 CD ARG A1034 14146 18326 16508 3505 2222 -3603 C ATOM 14259 NE ARG A1034 13.017 -13.818 -39.419 1.00132.89 N ANISOU14259 NE ARG A1034 14815 18679 17000 3423 2245 -3605 N ATOM 14260 CZ ARG A1034 12.501 -15.041 -39.491 1.00135.48 C ANISOU14260 CZ ARG A1034 15229 18793 17453 3513 2361 -3602 C ATOM 14261 NH1 ARG A1034 13.233 -16.093 -39.146 1.00142.82 N ANISOU14261 NH1 ARG A1034 16104 19626 18536 3691 2475 -3584 N ATOM 14262 NH2 ARG A1034 11.252 -15.217 -39.903 1.00123.70 N ANISOU14262 NH2 ARG A1034 13875 17184 15943 3430 2366 -3617 N ATOM 14263 H ARG A1034 17.780 -10.762 -38.165 1.00157.16 H ATOM 14264 HA ARG A1034 15.349 -9.688 -37.610 1.00153.48 H ATOM 14265 HB2 ARG A1034 15.957 -12.433 -37.315 1.00153.36 H ATOM 14266 HB3 ARG A1034 14.610 -11.767 -36.807 1.00153.36 H ATOM 14267 HG2 ARG A1034 13.800 -11.574 -38.885 1.00153.06 H ATOM 14268 HG3 ARG A1034 15.237 -11.767 -39.544 1.00153.06 H ATOM 14269 HD2 ARG A1034 14.991 -13.900 -39.631 1.00154.69 H ATOM 14270 HD3 ARG A1034 14.511 -13.965 -38.117 1.00154.69 H ATOM 14271 HE ARG A1034 12.545 -13.164 -39.715 1.00159.47 H ATOM 14272 HH11 ARG A1034 14.043 -15.984 -38.878 1.00171.39 H ATOM 14273 HH12 ARG A1034 12.898 -16.884 -39.193 1.00171.39 H ATOM 14274 HH21 ARG A1034 10.774 -14.538 -40.127 1.00148.44 H ATOM 14275 HH22 ARG A1034 10.922 -16.009 -39.949 1.00148.44 H ATOM 14276 N GLU A1035 16.434 -8.933 -35.513 1.00147.20 N ANISOU14276 N GLU A1035 16006 21414 18508 3439 1595 -3471 N ATOM 14277 CA GLU A1035 16.851 -8.619 -34.151 1.00148.79 C ANISOU14277 CA GLU A1035 16117 21718 18698 3552 1460 -3415 C ATOM 14278 C GLU A1035 16.214 -7.318 -33.670 1.00142.27 C ANISOU14278 C GLU A1035 15320 20987 17748 3432 1308 -3394 C ATOM 14279 O GLU A1035 15.526 -7.291 -32.650 1.00140.28 O ANISOU14279 O GLU A1035 15138 20689 17473 3490 1219 -3297 O ATOM 14280 CB GLU A1035 18.381 -8.544 -34.049 1.00155.60 C ANISOU14280 CB GLU A1035 16774 22757 19590 3638 1452 -3494 C ATOM 14281 CG GLU A1035 19.031 -7.268 -34.601 1.00155.27 C ANISOU14281 CG GLU A1035 16609 22920 19467 3489 1404 -3605 C ATOM 14282 CD GLU A1035 18.999 -7.178 -36.118 1.00158.70 C ANISOU14282 CD GLU A1035 17076 23330 19891 3344 1538 -3681 C ATOM 14283 OE1 GLU A1035 18.686 -8.193 -36.776 1.00158.24 O ANISOU14283 OE1 GLU A1035 17115 23118 19892 3378 1668 -3675 O ATOM 14284 OE2 GLU A1035 19.295 -6.089 -36.653 1.00161.67 O ANISOU14284 OE2 GLU A1035 17380 23845 20202 3201 1518 -3751 O ATOM 14285 H GLU A1035 16.130 -8.259 -35.952 1.00176.64 H ATOM 14286 HA GLU A1035 16.550 -9.329 -33.562 1.00178.55 H ATOM 14287 HB2 GLU A1035 18.629 -8.612 -33.114 1.00186.72 H ATOM 14288 HB3 GLU A1035 18.757 -9.293 -34.537 1.00186.72 H ATOM 14289 HG2 GLU A1035 18.560 -6.497 -34.248 1.00186.33 H ATOM 14290 HG3 GLU A1035 19.960 -7.242 -34.322 1.00186.33 H ATOM 14291 N VAL A1037 13.544 -5.098 -32.440 1.00 95.53 N ANISOU14291 N VAL A1037 9641 15056 11599 3199 1031 -3242 N ATOM 14292 CA VAL A1037 14.046 -3.809 -32.902 1.00 95.25 C ANISOU14292 CA VAL A1037 9502 15195 11494 3057 981 -3340 C ATOM 14293 C VAL A1037 13.649 -3.595 -34.363 1.00 93.30 C ANISOU14293 C VAL A1037 9317 14897 11237 2886 1091 -3383 C ATOM 14294 O VAL A1037 13.223 -2.506 -34.746 1.00 83.60 O ANISOU14294 O VAL A1037 8104 13721 9939 2733 1058 -3397 O ATOM 14295 CB VAL A1037 15.574 -3.712 -32.725 1.00 98.74 C ANISOU14295 CB VAL A1037 9740 15815 11961 3133 961 -3440 C ATOM 14296 CG1 VAL A1037 16.105 -2.380 -33.250 1.00 96.18 C ANISOU14296 CG1 VAL A1037 9296 15657 11590 2975 933 -3547 C ATOM 14297 CG2 VAL A1037 15.942 -3.893 -31.254 1.00 96.57 C ANISOU14297 CG2 VAL A1037 9404 15614 11673 3312 836 -3400 C ATOM 14298 HA VAL A1037 13.638 -3.104 -32.375 1.00114.30 H ATOM 14299 HB VAL A1037 15.997 -4.424 -33.230 1.00118.49 H ATOM 14300 HG11 VAL A1037 17.066 -2.352 -33.125 1.00115.41 H ATOM 14301 HG12 VAL A1037 15.892 -2.306 -34.194 1.00115.41 H ATOM 14302 HG13 VAL A1037 15.685 -1.657 -32.758 1.00115.41 H ATOM 14303 HG21 VAL A1037 16.905 -3.829 -31.160 1.00115.88 H ATOM 14304 HG22 VAL A1037 15.512 -3.196 -30.734 1.00115.88 H ATOM 14305 HG23 VAL A1037 15.636 -4.764 -30.957 1.00115.88 H ATOM 14306 N TRP A1038 13.801 -4.640 -35.171 1.00 95.56 N ANISOU14306 N TRP A1038 9636 15084 11589 2921 1225 -3404 N ATOM 14307 CA TRP A1038 13.174 -4.703 -36.486 1.00 93.63 C ANISOU14307 CA TRP A1038 9490 14762 11322 2789 1327 -3430 C ATOM 14308 C TRP A1038 11.959 -5.617 -36.363 1.00 89.78 C ANISOU14308 C TRP A1038 9173 14066 10874 2827 1363 -3348 C ATOM 14309 O TRP A1038 11.376 -6.038 -37.362 1.00 89.03 O ANISOU14309 O TRP A1038 9171 13877 10778 2760 1453 -3374 O ATOM 14310 CB TRP A1038 14.144 -5.247 -37.542 1.00 97.68 C ANISOU14310 CB TRP A1038 9925 15314 11875 2801 1458 -3529 C ATOM 14311 CG TRP A1038 15.245 -4.299 -37.898 1.00 98.61 C ANISOU14311 CG TRP A1038 9878 15629 11959 2734 1452 -3614 C ATOM 14312 CD1 TRP A1038 16.354 -4.022 -37.157 1.00101.14 C ANISOU14312 CD1 TRP A1038 10031 16085 12311 2814 1392 -3651 C ATOM 14313 CD2 TRP A1038 15.347 -3.506 -39.088 1.00 95.98 C ANISOU14313 CD2 TRP A1038 9524 15382 11560 2576 1517 -3674 C ATOM 14314 NE1 TRP A1038 17.139 -3.101 -37.807 1.00102.92 N ANISOU14314 NE1 TRP A1038 10128 16468 12510 2707 1421 -3735 N ATOM 14315 CE2 TRP A1038 16.544 -2.769 -38.995 1.00 98.89 C ANISOU14315 CE2 TRP A1038 9707 15927 11940 2563 1506 -3742 C ATOM 14316 CE3 TRP A1038 14.542 -3.346 -40.221 1.00 91.22 C ANISOU14316 CE3 TRP A1038 9038 14733 10890 2450 1587 -3675 C ATOM 14317 CZ2 TRP A1038 16.955 -1.885 -39.991 1.00 98.77 C ANISOU14317 CZ2 TRP A1038 9621 16026 11880 2426 1578 -3800 C ATOM 14318 CZ3 TRP A1038 14.953 -2.467 -41.207 1.00 92.08 C ANISOU14318 CZ3 TRP A1038 9082 14968 10937 2324 1650 -3728 C ATOM 14319 CH2 TRP A1038 16.148 -1.749 -41.086 1.00 98.24 C ANISOU14319 CH2 TRP A1038 9680 15909 11740 2312 1654 -3784 C ATOM 14320 H TRP A1038 14.269 -5.335 -34.976 1.00114.68 H ATOM 14321 HA TRP A1038 12.878 -3.819 -36.755 1.00112.35 H ATOM 14322 HB2 TRP A1038 14.551 -6.060 -37.203 1.00117.22 H ATOM 14323 HB3 TRP A1038 13.647 -5.442 -38.352 1.00117.22 H ATOM 14324 HD1 TRP A1038 16.549 -4.398 -36.329 1.00121.36 H ATOM 14325 HE1 TRP A1038 17.884 -2.786 -37.517 1.00123.51 H ATOM 14326 HE3 TRP A1038 13.746 -3.819 -40.308 1.00109.47 H ATOM 14327 HZ2 TRP A1038 17.749 -1.407 -39.914 1.00118.52 H ATOM 14328 HZ3 TRP A1038 14.426 -2.352 -41.965 1.00110.50 H ATOM 14329 HH2 TRP A1038 16.399 -1.166 -41.767 1.00117.89 H ATOM 14330 N LEU A1039 11.587 -5.916 -35.120 1.00 89.28 N ANISOU14330 N LEU A1039 9143 13937 10844 2940 1292 -3253 N ATOM 14331 CA LEU A1039 10.509 -6.857 -34.824 1.00 87.45 C ANISOU14331 CA LEU A1039 9053 13496 10677 2998 1338 -3165 C ATOM 14332 C LEU A1039 9.118 -6.473 -35.350 1.00 87.14 C ANISOU14332 C LEU A1039 9157 13367 10586 2854 1336 -3134 C ATOM 14333 O LEU A1039 8.315 -7.361 -35.639 1.00 88.01 O ANISOU14333 O LEU A1039 9374 13305 10762 2870 1418 -3111 O ATOM 14334 CB LEU A1039 10.428 -7.099 -33.315 1.00 90.65 C ANISOU14334 CB LEU A1039 9454 13875 11114 3149 1260 -3058 C ATOM 14335 CG LEU A1039 11.354 -8.184 -32.761 1.00 94.27 C ANISOU14335 CG LEU A1039 9831 14306 11679 3345 1315 -3045 C ATOM 14336 CD1 LEU A1039 11.403 -8.129 -31.242 1.00 92.52 C ANISOU14336 CD1 LEU A1039 9583 14126 11444 3488 1204 -2944 C ATOM 14337 CD2 LEU A1039 10.922 -9.574 -33.220 1.00 95.64 C ANISOU14337 CD2 LEU A1039 10090 14256 11992 3406 1476 -3026 C ATOM 14338 H LEU A1039 11.951 -5.579 -34.418 1.00107.14 H ATOM 14339 HA LEU A1039 10.738 -7.705 -35.234 1.00104.94 H ATOM 14340 HB2 LEU A1039 10.648 -6.271 -32.860 1.00108.78 H ATOM 14341 HB3 LEU A1039 9.518 -7.355 -33.096 1.00108.78 H ATOM 14342 HG LEU A1039 12.252 -8.028 -33.092 1.00113.12 H ATOM 14343 HD11 LEU A1039 11.995 -8.826 -30.920 1.00111.02 H ATOM 14344 HD12 LEU A1039 11.734 -7.260 -30.969 1.00111.02 H ATOM 14345 HD13 LEU A1039 10.508 -8.268 -30.893 1.00111.02 H ATOM 14346 HD21 LEU A1039 11.531 -10.232 -32.850 1.00114.76 H ATOM 14347 HD22 LEU A1039 10.020 -9.744 -32.906 1.00114.76 H ATOM 14348 HD23 LEU A1039 10.947 -9.608 -34.189 1.00114.76 H ATOM 14349 N PRO A1040 8.811 -5.165 -35.451 1.00 83.04 N ANISOU14349 N PRO A1040 8634 12959 9959 2720 1245 -3133 N ATOM 14350 CA PRO A1040 7.504 -4.805 -36.015 1.00 76.17 C ANISOU14350 CA PRO A1040 7892 12009 9040 2588 1246 -3102 C ATOM 14351 C PRO A1040 7.286 -5.383 -37.412 1.00 75.90 C ANISOU14351 C PRO A1040 7909 11918 9011 2519 1360 -3182 C ATOM 14352 O PRO A1040 6.196 -5.857 -37.736 1.00 71.84 O ANISOU14352 O PRO A1040 7512 11271 8514 2488 1395 -3161 O ATOM 14353 CB PRO A1040 7.570 -3.279 -36.098 1.00 72.94 C ANISOU14353 CB PRO A1040 7434 11756 8525 2459 1157 -3110 C ATOM 14354 CG PRO A1040 8.525 -2.878 -35.046 1.00 68.98 C ANISOU14354 CG PRO A1040 6810 11375 8024 2548 1072 -3112 C ATOM 14355 CD PRO A1040 9.531 -3.982 -34.940 1.00 81.97 C ANISOU14355 CD PRO A1040 8381 13010 9753 2692 1137 -3154 C ATOM 14356 HA PRO A1040 6.783 -5.075 -35.425 1.00 91.40 H ATOM 14357 HB2 PRO A1040 7.892 -3.013 -36.974 1.00 87.53 H ATOM 14358 HB3 PRO A1040 6.692 -2.904 -35.926 1.00 87.53 H ATOM 14359 HG2 PRO A1040 8.959 -2.048 -35.302 1.00 82.78 H ATOM 14360 HG3 PRO A1040 8.053 -2.768 -34.206 1.00 82.78 H ATOM 14361 HD2 PRO A1040 10.302 -3.791 -35.497 1.00 98.36 H ATOM 14362 HD3 PRO A1040 9.787 -4.118 -34.014 1.00 98.36 H ATOM 14363 N LEU A1041 8.335 -5.341 -38.224 1.00 94.24 N ANISOU14363 N LEU A1041 10137 14352 11317 2501 1417 -3282 N ATOM 14364 CA LEU A1041 8.264 -5.770 -39.615 1.00 93.58 C ANISOU14364 CA LEU A1041 10090 14255 11212 2435 1519 -3374 C ATOM 14365 C LEU A1041 8.087 -7.281 -39.742 1.00 91.93 C ANISOU14365 C LEU A1041 9940 13878 11111 2545 1617 -3403 C ATOM 14366 O LEU A1041 7.326 -7.755 -40.586 1.00 91.16 O ANISOU14366 O LEU A1041 9933 13700 11003 2494 1671 -3451 O ATOM 14367 CB LEU A1041 9.526 -5.317 -40.349 1.00 92.35 C ANISOU14367 CB LEU A1041 9806 14268 11014 2402 1563 -3465 C ATOM 14368 CG LEU A1041 9.710 -5.738 -41.805 1.00 85.89 C ANISOU14368 CG LEU A1041 9002 13472 10159 2353 1676 -3572 C ATOM 14369 CD1 LEU A1041 8.656 -5.110 -42.713 1.00 79.67 C ANISOU14369 CD1 LEU A1041 8309 12700 9260 2203 1665 -3572 C ATOM 14370 CD2 LEU A1041 11.113 -5.356 -42.242 1.00 87.39 C ANISOU14370 CD2 LEU A1041 9047 13825 10334 2354 1727 -3644 C ATOM 14371 H LEU A1041 9.114 -5.063 -37.988 1.00113.09 H ATOM 14372 HA LEU A1041 7.502 -5.343 -40.038 1.00112.30 H ATOM 14373 HB2 LEU A1041 9.547 -4.348 -40.332 1.00110.82 H ATOM 14374 HB3 LEU A1041 10.291 -5.658 -39.860 1.00110.82 H ATOM 14375 HG LEU A1041 9.627 -6.702 -41.870 1.00103.06 H ATOM 14376 HD11 LEU A1041 8.810 -5.403 -43.624 1.00 95.60 H ATOM 14377 HD12 LEU A1041 7.777 -5.394 -42.418 1.00 95.60 H ATOM 14378 HD13 LEU A1041 8.728 -4.144 -42.658 1.00 95.60 H ATOM 14379 HD21 LEU A1041 11.238 -5.620 -43.167 1.00104.87 H ATOM 14380 HD22 LEU A1041 11.221 -4.396 -42.154 1.00104.87 H ATOM 14381 HD23 LEU A1041 11.755 -5.814 -41.677 1.00104.87 H HETATM14382 N MSE A1042 8.792 -8.035 -38.905 1.00125.14 N ANISOU14382 N MSE A1042 14089 18035 15424 2700 1643 -3378 N HETATM14383 CA MSE A1042 8.667 -9.486 -38.900 1.00130.01 C ANISOU14383 CA MSE A1042 14756 18474 16169 2822 1752 -3390 C HETATM14384 C MSE A1042 7.269 -9.892 -38.455 1.00129.79 C ANISOU14384 C MSE A1042 14859 18266 16190 2822 1745 -3310 C HETATM14385 O MSE A1042 6.634 -10.744 -39.074 1.00132.21 O ANISOU14385 O MSE A1042 15248 18438 16549 2822 1829 -3361 O HETATM14386 CB MSE A1042 9.686 -10.106 -37.951 1.00136.13 C ANISOU14386 CB MSE A1042 15435 19237 17052 2998 1777 -3351 C HETATM14387 CG MSE A1042 11.122 -9.749 -38.253 1.00145.26 C ANISOU14387 CG MSE A1042 16443 20571 18178 3015 1782 -3427 C HETATM14388 SE MSE A1042 12.259 -10.107 -36.713 1.00165.50 SE ANISOU14388 SE MSE A1042 18868 23172 20841 3228 1742 -3349 SE HETATM14389 CE MSE A1042 11.724 -11.952 -36.354 1.00146.96 C ANISOU14389 CE MSE A1042 16616 20529 18692 3403 1892 -3284 C HETATM14390 H MSE A1042 9.351 -7.728 -38.328 1.00150.17 H HETATM14391 HA MSE A1042 8.833 -9.827 -39.793 1.00156.02 H HETATM14392 HB2 MSE A1042 9.492 -9.805 -37.049 1.00163.36 H HETATM14393 HB3 MSE A1042 9.607 -11.071 -37.997 1.00163.36 H HETATM14394 HG2 MSE A1042 11.437 -10.284 -38.998 1.00174.31 H HETATM14395 HG3 MSE A1042 11.182 -8.805 -38.465 1.00174.31 H HETATM14396 HE1 MSE A1042 12.221 -12.281 -35.588 1.00176.35 H HETATM14397 HE2 MSE A1042 10.773 -11.973 -36.165 1.00176.35 H HETATM14398 HE3 MSE A1042 11.920 -12.495 -37.134 1.00176.35 H ATOM 14399 N SER A1043 6.803 -9.275 -37.373 1.00 99.83 N ANISOU14399 N SER A1043 11079 14474 12378 2827 1646 -3193 N ATOM 14400 CA SER A1043 5.496 -9.581 -36.802 1.00 94.26 C ANISOU14400 CA SER A1043 10487 13604 11726 2835 1640 -3099 C ATOM 14401 C SER A1043 4.379 -9.347 -37.810 1.00 94.98 C ANISOU14401 C SER A1043 10675 13662 11749 2689 1641 -3152 C ATOM 14402 O SER A1043 3.456 -10.153 -37.925 1.00 99.34 O ANISOU14402 O SER A1043 11316 14047 12382 2708 1702 -3150 O ATOM 14403 CB SER A1043 5.252 -8.724 -35.560 1.00 92.29 C ANISOU14403 CB SER A1043 10227 13407 11432 2848 1518 -2977 C ATOM 14404 OG SER A1043 6.168 -9.045 -34.527 1.00 92.42 O ANISOU14404 OG SER A1043 10157 13450 11509 3002 1506 -2925 O ATOM 14405 H SER A1043 7.233 -8.665 -36.946 1.00119.79 H ATOM 14406 HA SER A1043 5.474 -10.514 -36.536 1.00113.12 H ATOM 14407 HB2 SER A1043 5.359 -7.790 -35.796 1.00110.75 H ATOM 14408 HB3 SER A1043 4.350 -8.883 -35.241 1.00110.75 H ATOM 14409 HG SER A1043 6.955 -8.911 -34.789 1.00110.91 H ATOM 14410 N TYR A1044 4.462 -8.230 -38.527 1.00108.26 N ANISOU14410 N TYR A1044 12334 15510 13292 2549 1574 -3199 N ATOM 14411 CA TYR A1044 3.503 -7.914 -39.580 1.00108.37 C ANISOU14411 CA TYR A1044 12423 15530 13223 2410 1567 -3254 C ATOM 14412 C TYR A1044 3.553 -8.969 -40.684 1.00116.62 C ANISOU14412 C TYR A1044 13491 16515 14306 2421 1672 -3389 C ATOM 14413 O TYR A1044 2.546 -9.251 -41.335 1.00116.81 O ANISOU14413 O TYR A1044 13594 16474 14316 2358 1682 -3441 O ATOM 14414 CB TYR A1044 3.804 -6.529 -40.167 1.00106.70 C ANISOU14414 CB TYR A1044 12162 15515 12863 2275 1499 -3271 C ATOM 14415 CG TYR A1044 2.810 -6.045 -41.209 1.00101.23 C ANISOU14415 CG TYR A1044 11540 14854 12071 2133 1482 -3308 C ATOM 14416 CD1 TYR A1044 1.495 -6.492 -41.212 1.00 99.20 C ANISOU14416 CD1 TYR A1044 11384 14463 11844 2115 1477 -3292 C ATOM 14417 CD2 TYR A1044 3.192 -5.140 -42.193 1.00 97.08 C ANISOU14417 CD2 TYR A1044 10970 14494 11421 2022 1478 -3357 C ATOM 14418 CE1 TYR A1044 0.590 -6.053 -42.163 1.00 94.37 C ANISOU14418 CE1 TYR A1044 10824 13896 11137 1992 1453 -3331 C ATOM 14419 CE2 TYR A1044 2.293 -4.693 -43.146 1.00 92.38 C ANISOU14419 CE2 TYR A1044 10434 13939 10725 1903 1465 -3382 C ATOM 14420 CZ TYR A1044 0.995 -5.153 -43.126 1.00 90.57 C ANISOU14420 CZ TYR A1044 10301 13588 10523 1890 1445 -3372 C ATOM 14421 OH TYR A1044 0.100 -4.714 -44.073 1.00 91.84 O ANISOU14421 OH TYR A1044 10512 13804 10581 1778 1423 -3403 O ATOM 14422 H TYR A1044 5.072 -7.633 -38.421 1.00129.92 H ATOM 14423 HA TYR A1044 2.607 -7.902 -39.208 1.00130.05 H ATOM 14424 HB2 TYR A1044 3.808 -5.882 -39.444 1.00128.04 H ATOM 14425 HB3 TYR A1044 4.678 -6.555 -40.586 1.00128.04 H ATOM 14426 HD1 TYR A1044 1.217 -7.099 -40.564 1.00119.04 H ATOM 14427 HD2 TYR A1044 4.068 -4.827 -42.210 1.00116.50 H ATOM 14428 HE1 TYR A1044 -0.287 -6.361 -42.151 1.00113.25 H ATOM 14429 HE2 TYR A1044 2.564 -4.088 -43.798 1.00110.85 H ATOM 14430 HH TYR A1044 0.475 -4.173 -44.594 1.00110.21 H ATOM 14431 N ARG A1045 4.729 -9.560 -40.881 1.00 92.32 N ANISOU14431 N ARG A1045 10339 13464 11275 2508 1747 -3455 N ATOM 14432 CA ARG A1045 4.935 -10.522 -41.960 1.00 89.64 C ANISOU14432 CA ARG A1045 10011 13086 10963 2526 1850 -3598 C ATOM 14433 C ARG A1045 4.399 -11.916 -41.632 1.00 90.54 C ANISOU14433 C ARG A1045 10191 12973 11236 2641 1935 -3605 C ATOM 14434 O ARG A1045 3.876 -12.599 -42.511 1.00 96.21 O ANISOU14434 O ARG A1045 10963 13626 11968 2616 1985 -3724 O ATOM 14435 CB ARG A1045 6.417 -10.603 -42.329 1.00 94.11 C ANISOU14435 CB ARG A1045 10467 13767 11521 2578 1908 -3667 C ATOM 14436 CG ARG A1045 6.860 -9.557 -43.341 1.00 97.78 C ANISOU14436 CG ARG A1045 10882 14441 11830 2447 1882 -3732 C ATOM 14437 CD ARG A1045 8.123 -9.996 -44.056 1.00103.21 C ANISOU14437 CD ARG A1045 11484 15208 12524 2500 1980 -3841 C ATOM 14438 NE ARG A1045 9.284 -10.026 -43.170 1.00104.68 N ANISOU14438 NE ARG A1045 11561 15426 12787 2613 1988 -3789 N ATOM 14439 CZ ARG A1045 10.387 -10.733 -43.402 1.00100.96 C ANISOU14439 CZ ARG A1045 11013 14967 12381 2715 2085 -3859 C ATOM 14440 NH1 ARG A1045 10.486 -11.488 -44.489 1.00 99.04 N ANISOU14440 NH1 ARG A1045 10797 14700 12135 2722 2187 -3987 N ATOM 14441 NH2 ARG A1045 11.392 -10.692 -42.537 1.00 97.59 N ANISOU14441 NH2 ARG A1045 10477 14581 12022 2817 2077 -3806 N ATOM 14442 H ARG A1045 5.428 -9.419 -40.401 1.00110.79 H ATOM 14443 HA ARG A1045 4.458 -10.208 -42.744 1.00107.57 H ATOM 14444 HB2 ARG A1045 6.946 -10.479 -41.526 1.00112.93 H ATOM 14445 HB3 ARG A1045 6.597 -11.477 -42.709 1.00112.93 H ATOM 14446 HG2 ARG A1045 6.161 -9.434 -44.003 1.00117.34 H ATOM 14447 HG3 ARG A1045 7.042 -8.722 -42.883 1.00117.34 H ATOM 14448 HD2 ARG A1045 7.993 -10.889 -44.412 1.00123.85 H ATOM 14449 HD3 ARG A1045 8.311 -9.375 -44.778 1.00123.85 H ATOM 14450 HE ARG A1045 9.252 -9.556 -42.451 1.00125.62 H ATOM 14451 HH11 ARG A1045 9.837 -11.517 -45.052 1.00118.85 H ATOM 14452 HH12 ARG A1045 11.201 -11.944 -44.631 1.00118.85 H ATOM 14453 HH21 ARG A1045 11.331 -10.206 -41.830 1.00117.11 H ATOM 14454 HH22 ARG A1045 12.104 -11.152 -42.684 1.00117.11 H ATOM 14455 N ASN A1046 4.533 -12.340 -40.377 1.00110.74 N ANISOU14455 N ASN A1046 12741 15415 13919 2772 1955 -3482 N ATOM 14456 CA ASN A1046 3.968 -13.617 -39.944 1.00118.01 C ANISOU14456 CA ASN A1046 13725 16102 15009 2892 2051 -3455 C ATOM 14457 C ASN A1046 2.474 -13.691 -40.226 1.00118.77 C ANISOU14457 C ASN A1046 13926 16097 15103 2808 2025 -3471 C ATOM 14458 O ASN A1046 1.946 -14.744 -40.586 1.00120.86 O ANISOU14458 O ASN A1046 14245 16206 15470 2854 2105 -3545 O ATOM 14459 CB ASN A1046 4.203 -13.838 -38.449 1.00119.94 C ANISOU14459 CB ASN A1046 13944 16254 15373 3033 2066 -3285 C ATOM 14460 CG ASN A1046 5.641 -14.186 -38.130 1.00122.69 C ANISOU14460 CG ASN A1046 14184 16655 15778 3159 2119 -3282 C ATOM 14461 OD1 ASN A1046 6.540 -13.362 -38.284 1.00127.87 O ANISOU14461 OD1 ASN A1046 14752 17507 16327 3114 2051 -3313 O ATOM 14462 ND2 ASN A1046 5.864 -15.412 -37.676 1.00118.85 N ANISOU14462 ND2 ASN A1046 13697 15990 15469 3325 2249 -3241 N ATOM 14463 H ASN A1046 4.946 -11.908 -39.758 1.00132.88 H ATOM 14464 HA ASN A1046 4.403 -14.337 -40.428 1.00141.61 H ATOM 14465 HB2 ASN A1046 3.977 -13.026 -37.970 1.00143.93 H ATOM 14466 HB3 ASN A1046 3.643 -14.570 -38.146 1.00143.93 H ATOM 14467 HD21 ASN A1046 6.664 -15.659 -37.480 1.00142.62 H ATOM 14468 HD22 ASN A1046 5.209 -15.961 -37.578 1.00142.62 H ATOM 14469 N SER A1047 1.803 -12.556 -40.072 1.00 99.74 N ANISOU14469 N SER A1047 11538 13780 12579 2687 1910 -3409 N ATOM 14470 CA SER A1047 0.354 -12.494 -40.179 1.00 94.07 C ANISOU14470 CA SER A1047 10907 12976 11858 2610 1872 -3402 C ATOM 14471 C SER A1047 -0.113 -12.445 -41.628 1.00100.68 C ANISOU14471 C SER A1047 11766 13890 12599 2481 1851 -3578 C ATOM 14472 O SER A1047 -1.314 -12.485 -41.897 1.00104.82 O ANISOU14472 O SER A1047 12349 14354 13123 2413 1818 -3609 O ATOM 14473 CB SER A1047 -0.158 -11.259 -39.448 1.00 89.86 C ANISOU14473 CB SER A1047 10385 12520 11238 2537 1759 -3265 C ATOM 14474 OG SER A1047 0.398 -10.084 -40.011 1.00 85.72 O ANISOU14474 OG SER A1047 9808 12213 10549 2424 1678 -3296 O ATOM 14475 H SER A1047 2.171 -11.797 -39.902 1.00119.69 H ATOM 14476 HA SER A1047 -0.032 -13.279 -39.761 1.00112.88 H ATOM 14477 HB2 SER A1047 -1.124 -11.222 -39.527 1.00107.83 H ATOM 14478 HB3 SER A1047 0.098 -11.315 -38.514 1.00107.83 H ATOM 14479 HG SER A1047 1.235 -10.105 -39.950 1.00102.86 H ATOM 14480 N LEU A1048 0.829 -12.349 -42.559 1.00 84.18 N ANISOU14480 N LEU A1048 9620 11940 10426 2450 1870 -3694 N ATOM 14481 CA LEU A1048 0.486 -12.289 -43.976 1.00 79.56 C ANISOU14481 CA LEU A1048 9045 11450 9735 2334 1856 -3863 C ATOM 14482 C LEU A1048 0.822 -13.599 -44.690 1.00 77.50 C ANISOU14482 C LEU A1048 8780 11102 9563 2405 1959 -4033 C ATOM 14483 O LEU A1048 1.697 -14.352 -44.253 1.00 75.71 O ANISOU14483 O LEU A1048 8524 10794 9449 2540 2048 -4019 O ATOM 14484 CB LEU A1048 1.196 -11.112 -44.652 1.00 74.32 C ANISOU14484 CB LEU A1048 8324 11023 8891 2233 1808 -3872 C ATOM 14485 CG LEU A1048 0.794 -9.708 -44.188 1.00 65.88 C ANISOU14485 CG LEU A1048 7258 10057 7718 2140 1702 -3732 C ATOM 14486 CD1 LEU A1048 1.776 -8.663 -44.693 1.00 65.82 C ANISOU14486 CD1 LEU A1048 7176 10258 7575 2076 1685 -3728 C ATOM 14487 CD2 LEU A1048 -0.623 -9.371 -44.640 1.00 64.88 C ANISOU14487 CD2 LEU A1048 7198 9925 7528 2030 1636 -3749 C TER 14488 LEU A1048 ATOM 14489 N LYS B 321 -16.799 -37.679 -24.828 1.00 83.04 N ANISOU14489 N LYS B 321 9070 11135 11348 -37 1899 -1642 N ATOM 14490 CA LYS B 321 -17.195 -37.199 -23.509 1.00 89.64 C ANISOU14490 CA LYS B 321 9909 11914 12238 -18 1828 -1506 C ATOM 14491 C LYS B 321 -18.665 -36.779 -23.489 1.00 86.36 C ANISOU14491 C LYS B 321 9533 11576 11702 -25 1804 -1429 C ATOM 14492 O LYS B 321 -19.116 -36.010 -24.339 1.00 81.42 O ANISOU14492 O LYS B 321 8964 11065 10906 -39 1848 -1393 O ATOM 14493 CB LYS B 321 -16.291 -36.046 -23.071 1.00 93.15 C ANISOU14493 CB LYS B 321 10374 12346 12674 -6 1843 -1395 C ATOM 14494 CG LYS B 321 -14.901 -36.505 -22.663 1.00 97.06 C ANISOU14494 CG LYS B 321 10814 12736 13329 5 1840 -1457 C ATOM 14495 CD LYS B 321 -14.015 -35.349 -22.219 1.00 95.72 C ANISOU14495 CD LYS B 321 10656 12553 13159 15 1851 -1357 C ATOM 14496 CE LYS B 321 -13.496 -34.536 -23.399 1.00 92.76 C ANISOU14496 CE LYS B 321 10312 12274 12657 -6 1948 -1356 C ATOM 14497 NZ LYS B 321 -12.731 -33.335 -22.956 1.00 89.88 N ANISOU14497 NZ LYS B 321 9956 11897 12297 0 1957 -1255 N ATOM 14498 HA LYS B 321 -17.086 -37.920 -22.870 1.00107.57 H ATOM 14499 HB2 LYS B 321 -16.196 -35.422 -23.808 1.00111.78 H ATOM 14500 HB3 LYS B 321 -16.695 -35.601 -22.310 1.00111.78 H ATOM 14501 HG2 LYS B 321 -14.977 -37.128 -21.924 1.00116.47 H ATOM 14502 HG3 LYS B 321 -14.475 -36.937 -23.420 1.00116.47 H ATOM 14503 HD2 LYS B 321 -14.529 -34.757 -21.647 1.00114.86 H ATOM 14504 HD3 LYS B 321 -13.252 -35.701 -21.735 1.00114.86 H ATOM 14505 HE2 LYS B 321 -12.906 -35.090 -23.933 1.00111.31 H ATOM 14506 HE3 LYS B 321 -14.247 -34.235 -23.934 1.00111.31 H ATOM 14507 HZ1 LYS B 321 -12.441 -32.881 -23.665 1.00107.85 H ATOM 14508 HZ2 LYS B 321 -13.253 -32.805 -22.467 1.00107.85 H ATOM 14509 HZ3 LYS B 321 -12.031 -33.584 -22.466 1.00107.85 H ATOM 14510 N ARG B 322 -19.392 -37.287 -22.497 1.00 77.61 N ANISOU14510 N ARG B 322 8397 10403 10690 -15 1732 -1400 N ATOM 14511 CA ARG B 322 -20.846 -37.167 -22.435 1.00 73.12 C ANISOU14511 CA ARG B 322 7845 9896 10041 -26 1703 -1352 C ATOM 14512 C ARG B 322 -21.323 -35.716 -22.381 1.00 73.16 C ANISOU14512 C ARG B 322 7917 9987 9894 -22 1711 -1199 C ATOM 14513 O ARG B 322 -20.769 -34.891 -21.651 1.00 69.07 O ANISOU14513 O ARG B 322 7416 9433 9394 -2 1698 -1089 O ATOM 14514 CB ARG B 322 -21.381 -37.919 -21.211 1.00 71.77 C ANISOU14514 CB ARG B 322 7624 9622 10023 -12 1628 -1327 C ATOM 14515 CG ARG B 322 -21.028 -39.405 -21.161 1.00 69.35 C ANISOU14515 CG ARG B 322 7247 9212 9889 -12 1609 -1470 C ATOM 14516 CD ARG B 322 -21.961 -40.234 -22.029 1.00 73.83 C ANISOU14516 CD ARG B 322 7787 9832 10432 -39 1618 -1598 C ATOM 14517 NE ARG B 322 -23.352 -40.150 -21.583 1.00 75.94 N ANISOU14517 NE ARG B 322 8047 10131 10676 -48 1577 -1527 N ATOM 14518 CZ ARG B 322 -23.922 -40.965 -20.697 1.00 71.70 C ANISOU14518 CZ ARG B 322 7453 9498 10290 -45 1521 -1517 C ATOM 14519 NH1 ARG B 322 -23.232 -41.953 -20.140 1.00 68.16 N ANISOU14519 NH1 ARG B 322 6954 8912 10030 -27 1492 -1572 N ATOM 14520 NH2 ARG B 322 -25.195 -40.793 -20.368 1.00 68.97 N ANISOU14520 NH2 ARG B 322 7125 9185 9896 -60 1468 -1426 N ATOM 14521 H ARG B 322 -19.056 -37.717 -21.832 1.00 93.13 H ATOM 14522 HA ARG B 322 -21.228 -37.576 -23.227 1.00 87.74 H ATOM 14523 HB2 ARG B 322 -21.019 -37.506 -20.412 1.00 86.12 H ATOM 14524 HB3 ARG B 322 -22.348 -37.848 -21.204 1.00 86.12 H ATOM 14525 HG2 ARG B 322 -20.122 -39.530 -21.484 1.00 83.21 H ATOM 14526 HG3 ARG B 322 -21.104 -39.721 -20.247 1.00 83.21 H ATOM 14527 HD2 ARG B 322 -21.917 -39.910 -22.943 1.00 88.59 H ATOM 14528 HD3 ARG B 322 -21.688 -41.164 -21.992 1.00 88.59 H ATOM 14529 HE ARG B 322 -23.839 -39.526 -21.919 1.00 91.13 H ATOM 14530 HH11 ARG B 322 -22.406 -42.072 -20.348 1.00 81.79 H ATOM 14531 HH12 ARG B 322 -23.611 -42.473 -19.569 1.00 81.79 H ATOM 14532 HH21 ARG B 322 -25.650 -40.156 -20.725 1.00 82.77 H ATOM 14533 HH22 ARG B 322 -25.566 -41.318 -19.796 1.00 82.77 H ATOM 14534 N LYS B 323 -22.368 -35.421 -23.148 1.00 64.83 N ANISOU14534 N LYS B 323 6896 9045 8693 -41 1727 -1198 N ATOM 14535 CA LYS B 323 -22.971 -34.091 -23.159 1.00 66.23 C ANISOU14535 CA LYS B 323 7136 9304 8725 -38 1728 -1057 C ATOM 14536 C LYS B 323 -23.898 -33.935 -21.953 1.00 61.36 C ANISOU14536 C LYS B 323 6505 8653 8157 -25 1658 -951 C ATOM 14537 O LYS B 323 -24.411 -32.847 -21.685 1.00 59.54 O ANISOU14537 O LYS B 323 6318 8469 7836 -16 1646 -824 O ATOM 14538 CB LYS B 323 -23.751 -33.868 -24.461 1.00 67.16 C ANISOU14538 CB LYS B 323 7299 9559 8662 -61 1765 -1102 C ATOM 14539 CG LYS B 323 -23.003 -34.284 -25.728 1.00 71.13 C ANISOU14539 CG LYS B 323 7812 10103 9110 -74 1834 -1232 C ATOM 14540 CD LYS B 323 -22.687 -33.095 -26.620 1.00 73.22 C ANISOU14540 CD LYS B 323 8156 10458 9205 -74 1896 -1159 C ATOM 14541 CE LYS B 323 -21.860 -33.516 -27.830 1.00 77.73 C ANISOU14541 CE LYS B 323 8738 11068 9728 -84 1970 -1282 C ATOM 14542 NZ LYS B 323 -22.567 -34.498 -28.701 1.00 82.47 N ANISOU14542 NZ LYS B 323 9330 11738 10267 -103 1966 -1436 N ATOM 14543 H LYS B 323 -22.752 -35.980 -23.678 1.00 77.80 H ATOM 14544 HA LYS B 323 -22.273 -33.420 -23.100 1.00 79.48 H ATOM 14545 HB2 LYS B 323 -24.573 -34.382 -24.422 1.00 80.60 H ATOM 14546 HB3 LYS B 323 -23.960 -32.924 -24.539 1.00 80.60 H ATOM 14547 HG2 LYS B 323 -22.166 -34.706 -25.479 1.00 85.36 H ATOM 14548 HG3 LYS B 323 -23.553 -34.903 -26.233 1.00 85.36 H ATOM 14549 HD2 LYS B 323 -23.516 -32.703 -26.939 1.00 87.86 H ATOM 14550 HD3 LYS B 323 -22.178 -32.441 -26.116 1.00 87.86 H ATOM 14551 HE2 LYS B 323 -21.660 -32.731 -28.364 1.00 93.28 H ATOM 14552 HE3 LYS B 323 -21.037 -33.927 -27.522 1.00 93.28 H ATOM 14553 HZ1 LYS B 323 -22.757 -35.234 -28.238 1.00 98.96 H ATOM 14554 HZ2 LYS B 323 -23.325 -34.144 -29.005 1.00 98.96 H ATOM 14555 HZ3 LYS B 323 -22.052 -34.717 -29.393 1.00 98.96 H ATOM 14556 N LEU B 324 -24.098 -35.034 -21.230 1.00 39.33 N ANISOU14556 N LEU B 324 3652 5776 5517 -24 1614 -1003 N ATOM 14557 CA LEU B 324 -24.933 -35.057 -20.036 1.00 32.57 C ANISOU14557 CA LEU B 324 2775 4875 4726 -13 1551 -908 C ATOM 14558 C LEU B 324 -24.360 -34.126 -18.965 1.00 34.15 C ANISOU14558 C LEU B 324 3003 5023 4948 21 1525 -771 C ATOM 14559 O LEU B 324 -23.160 -34.148 -18.693 1.00 46.48 O ANISOU14559 O LEU B 324 4559 6517 6583 38 1532 -787 O ATOM 14560 CB LEU B 324 -25.016 -36.494 -19.510 1.00 32.58 C ANISOU14560 CB LEU B 324 2702 4773 4905 -16 1517 -994 C ATOM 14561 CG LEU B 324 -25.965 -36.801 -18.349 1.00 33.31 C ANISOU14561 CG LEU B 324 2761 4810 5083 -11 1457 -910 C ATOM 14562 CD1 LEU B 324 -27.440 -36.620 -18.749 1.00 33.14 C ANISOU14562 CD1 LEU B 324 2759 4881 4951 -37 1426 -877 C ATOM 14563 CD2 LEU B 324 -25.703 -38.214 -17.811 1.00 32.33 C ANISOU14563 CD2 LEU B 324 2568 4557 5159 -8 1427 -988 C ATOM 14564 H LEU B 324 -23.751 -35.798 -21.418 1.00 47.20 H ATOM 14565 HA LEU B 324 -25.828 -34.757 -20.259 1.00 39.09 H ATOM 14566 HB2 LEU B 324 -25.284 -37.063 -20.248 1.00 39.10 H ATOM 14567 HB3 LEU B 324 -24.127 -36.753 -19.220 1.00 39.10 H ATOM 14568 HG LEU B 324 -25.781 -36.177 -17.630 1.00 39.97 H ATOM 14569 HD11 LEU B 324 -28.001 -36.825 -17.985 1.00 39.77 H ATOM 14570 HD12 LEU B 324 -27.580 -35.701 -19.027 1.00 39.77 H ATOM 14571 HD13 LEU B 324 -27.644 -37.222 -19.481 1.00 39.77 H ATOM 14572 HD21 LEU B 324 -26.313 -38.390 -17.078 1.00 38.80 H ATOM 14573 HD22 LEU B 324 -25.849 -38.855 -18.524 1.00 38.80 H ATOM 14574 HD23 LEU B 324 -24.786 -38.268 -17.500 1.00 38.80 H ATOM 14575 N ILE B 325 -25.216 -33.309 -18.357 1.00 41.78 N ANISOU14575 N ILE B 325 3996 6025 5852 32 1494 -645 N ATOM 14576 CA ILE B 325 -24.781 -32.375 -17.319 1.00 32.76 C ANISOU14576 CA ILE B 325 2881 4846 4721 67 1463 -523 C ATOM 14577 C ILE B 325 -24.683 -33.066 -15.956 1.00 34.42 C ANISOU14577 C ILE B 325 3054 4945 5081 89 1406 -498 C ATOM 14578 O ILE B 325 -25.694 -33.470 -15.383 1.00 44.60 O ANISOU14578 O ILE B 325 4323 6223 6400 88 1373 -460 O ATOM 14579 CB ILE B 325 -25.736 -31.174 -17.209 1.00 25.76 C ANISOU14579 CB ILE B 325 2038 4043 3705 74 1450 -402 C ATOM 14580 CG1 ILE B 325 -25.858 -30.475 -18.565 1.00 26.34 C ANISOU14580 CG1 ILE B 325 2155 4222 3629 55 1506 -416 C ATOM 14581 CG2 ILE B 325 -25.241 -30.194 -16.157 1.00 24.92 C ANISOU14581 CG2 ILE B 325 1956 3904 3610 108 1414 -298 C ATOM 14582 CD1 ILE B 325 -26.925 -29.410 -18.617 1.00 32.79 C ANISOU14582 CD1 ILE B 325 3014 5122 4322 60 1494 -311 C ATOM 14583 H ILE B 325 -26.058 -33.275 -18.529 1.00 50.13 H ATOM 14584 HA ILE B 325 -23.901 -32.038 -17.548 1.00 39.32 H ATOM 14585 HB ILE B 325 -26.612 -31.497 -16.946 1.00 30.91 H ATOM 14586 HG12 ILE B 325 -25.010 -30.053 -18.774 1.00 31.60 H ATOM 14587 HG13 ILE B 325 -26.069 -31.138 -19.240 1.00 31.60 H ATOM 14588 HG21 ILE B 325 -25.858 -29.447 -16.106 1.00 29.91 H ATOM 14589 HG22 ILE B 325 -25.198 -30.646 -15.300 1.00 29.91 H ATOM 14590 HG23 ILE B 325 -24.359 -29.878 -16.410 1.00 29.91 H ATOM 14591 HD11 ILE B 325 -26.937 -29.018 -19.504 1.00 39.34 H ATOM 14592 HD12 ILE B 325 -27.785 -29.815 -18.423 1.00 39.34 H ATOM 14593 HD13 ILE B 325 -26.724 -28.728 -17.957 1.00 39.34 H ATOM 14594 N VAL B 326 -23.459 -33.197 -15.448 1.00 28.50 N ANISOU14594 N VAL B 326 2293 4111 4425 111 1397 -519 N ATOM 14595 CA VAL B 326 -23.212 -33.799 -14.139 1.00 25.61 C ANISOU14595 CA VAL B 326 1899 3635 4199 140 1343 -493 C ATOM 14596 C VAL B 326 -22.581 -32.760 -13.221 1.00 24.93 C ANISOU14596 C VAL B 326 1842 3527 4102 175 1312 -405 C ATOM 14597 O VAL B 326 -21.616 -32.102 -13.595 1.00 33.14 O ANISOU14597 O VAL B 326 2896 4578 5116 176 1336 -423 O ATOM 14598 CB VAL B 326 -22.282 -35.023 -14.247 1.00 26.40 C ANISOU14598 CB VAL B 326 1948 3637 4445 139 1346 -611 C ATOM 14599 CG1 VAL B 326 -22.141 -35.710 -12.895 1.00 29.31 C ANISOU14599 CG1 VAL B 326 2288 3887 4961 173 1287 -575 C ATOM 14600 CG2 VAL B 326 -22.825 -36.004 -15.272 1.00 30.87 C ANISOU14600 CG2 VAL B 326 2482 4228 5021 103 1378 -721 C ATOM 14601 H VAL B 326 -22.743 -32.941 -15.850 1.00 34.20 H ATOM 14602 HA VAL B 326 -24.054 -34.084 -13.750 1.00 30.74 H ATOM 14603 HB VAL B 326 -21.402 -34.735 -14.536 1.00 31.68 H ATOM 14604 HG11 VAL B 326 -21.553 -36.475 -12.990 1.00 35.17 H ATOM 14605 HG12 VAL B 326 -21.767 -35.081 -12.259 1.00 35.17 H ATOM 14606 HG13 VAL B 326 -23.017 -36.001 -12.597 1.00 35.17 H ATOM 14607 HG21 VAL B 326 -22.228 -36.766 -15.326 1.00 37.05 H ATOM 14608 HG22 VAL B 326 -23.708 -36.293 -14.994 1.00 37.05 H ATOM 14609 HG23 VAL B 326 -22.877 -35.562 -16.134 1.00 37.05 H ATOM 14610 N ASP B 327 -23.128 -32.619 -12.018 1.00 24.25 N ANISOU14610 N ASP B 327 1764 3409 4040 202 1262 -313 N ATOM 14611 CA ASP B 327 -22.656 -31.613 -11.074 1.00 23.61 C ANISOU14611 CA ASP B 327 1713 3312 3948 238 1227 -237 C ATOM 14612 C ASP B 327 -21.697 -32.229 -10.070 1.00 23.73 C ANISOU14612 C ASP B 327 1700 3208 4109 274 1188 -256 C ATOM 14613 O ASP B 327 -21.992 -33.261 -9.473 1.00 26.10 O ANISOU14613 O ASP B 327 1970 3438 4507 286 1163 -256 O ATOM 14614 CB ASP B 327 -23.835 -30.978 -10.332 1.00 22.87 C ANISOU14614 CB ASP B 327 1651 3260 3779 251 1195 -125 C ATOM 14615 CG ASP B 327 -24.718 -30.141 -11.241 1.00 26.01 C ANISOU14615 CG ASP B 327 2080 3775 4028 222 1222 -99 C ATOM 14616 OD1 ASP B 327 -24.179 -29.327 -12.017 1.00 24.49 O ANISOU14616 OD1 ASP B 327 1908 3633 3766 209 1253 -119 O ATOM 14617 OD2 ASP B 327 -25.954 -30.300 -11.190 1.00 29.02 O ANISOU14617 OD2 ASP B 327 2463 4196 4366 212 1214 -56 O ATOM 14618 H ASP B 327 -23.779 -33.097 -11.723 1.00 29.10 H ATOM 14619 HA ASP B 327 -22.186 -30.914 -11.556 1.00 28.34 H ATOM 14620 HB2 ASP B 327 -24.382 -31.681 -9.947 1.00 27.45 H ATOM 14621 HB3 ASP B 327 -23.494 -30.401 -9.631 1.00 27.45 H ATOM 14622 N SER B 328 -20.542 -31.595 -9.891 1.00 35.44 N ANISOU14622 N SER B 328 3187 4665 5614 291 1182 -271 N ATOM 14623 CA SER B 328 -19.561 -32.056 -8.919 1.00 29.50 C ANISOU14623 CA SER B 328 2409 3803 4998 330 1137 -289 C ATOM 14624 C SER B 328 -20.011 -31.677 -7.520 1.00 29.57 C ANISOU14624 C SER B 328 2439 3786 5011 377 1079 -187 C ATOM 14625 O SER B 328 -19.851 -32.452 -6.578 1.00 24.37 O ANISOU14625 O SER B 328 1760 3041 4458 414 1034 -173 O ATOM 14626 CB SER B 328 -18.204 -31.428 -9.211 1.00 31.52 C ANISOU14626 CB SER B 328 2657 4044 5275 329 1150 -339 C ATOM 14627 OG SER B 328 -17.922 -31.498 -10.596 1.00 47.94 O ANISOU14627 OG SER B 328 4729 6173 7312 285 1216 -414 O ATOM 14628 H SER B 328 -20.303 -30.892 -10.325 1.00 42.53 H ATOM 14629 HA SER B 328 -19.476 -33.021 -8.969 1.00 35.41 H ATOM 14630 HB2 SER B 328 -18.218 -30.498 -8.937 1.00 37.82 H ATOM 14631 HB3 SER B 328 -17.519 -31.910 -8.723 1.00 37.82 H ATOM 14632 HG SER B 328 -17.174 -31.152 -10.754 1.00 57.52 H ATOM 14633 N VAL B 329 -20.588 -30.481 -7.407 1.00 31.82 N ANISOU14633 N VAL B 329 2766 4145 5178 378 1080 -114 N ATOM 14634 CA VAL B 329 -21.068 -29.943 -6.138 1.00 30.16 C ANISOU14634 CA VAL B 329 2584 3924 4950 423 1031 -17 C ATOM 14635 C VAL B 329 -22.560 -29.675 -6.243 1.00 26.41 C ANISOU14635 C VAL B 329 2140 3527 4365 406 1043 57 C ATOM 14636 O VAL B 329 -22.998 -28.880 -7.070 1.00 32.83 O ANISOU14636 O VAL B 329 2979 4424 5070 373 1073 59 O ATOM 14637 CB VAL B 329 -20.308 -28.650 -5.772 1.00 27.25 C ANISOU14637 CB VAL B 329 2236 3560 4557 445 1012 -3 C ATOM 14638 CG1 VAL B 329 -21.052 -27.829 -4.706 1.00 27.84 C ANISOU14638 CG1 VAL B 329 2352 3655 4571 485 972 97 C ATOM 14639 CG2 VAL B 329 -18.914 -29.001 -5.297 1.00 22.22 C ANISOU14639 CG2 VAL B 329 1565 2831 4046 473 979 -61 C ATOM 14640 H VAL B 329 -20.715 -29.950 -8.071 1.00 38.18 H ATOM 14641 HA VAL B 329 -20.922 -30.595 -5.434 1.00 36.19 H ATOM 14642 HB VAL B 329 -20.223 -28.100 -6.566 1.00 32.69 H ATOM 14643 HG11 VAL B 329 -20.539 -27.030 -4.510 1.00 33.41 H ATOM 14644 HG12 VAL B 329 -21.926 -27.586 -5.049 1.00 33.41 H ATOM 14645 HG13 VAL B 329 -21.148 -28.366 -3.905 1.00 33.41 H ATOM 14646 HG21 VAL B 329 -18.444 -28.184 -5.069 1.00 26.66 H ATOM 14647 HG22 VAL B 329 -18.982 -29.573 -4.517 1.00 26.66 H ATOM 14648 HG23 VAL B 329 -18.447 -29.465 -6.009 1.00 26.66 H ATOM 14649 N LYS B 330 -23.332 -30.336 -5.389 1.00 27.39 N ANISOU14649 N LYS B 330 2264 3623 4522 430 1019 121 N ATOM 14650 CA LYS B 330 -24.786 -30.303 -5.482 1.00 22.60 C ANISOU14650 CA LYS B 330 1677 3082 3829 410 1030 186 C ATOM 14651 C LYS B 330 -25.422 -29.299 -4.520 1.00 25.74 C ANISOU14651 C LYS B 330 2123 3512 4144 446 998 287 C ATOM 14652 O LYS B 330 -26.521 -28.815 -4.775 1.00 33.69 O ANISOU14652 O LYS B 330 3158 4592 5051 426 1005 331 O ATOM 14653 CB LYS B 330 -25.352 -31.693 -5.193 1.00 21.66 C ANISOU14653 CB LYS B 330 1520 2912 3797 407 1032 200 C ATOM 14654 CG LYS B 330 -24.873 -32.788 -6.146 1.00 25.87 C ANISOU14654 CG LYS B 330 2003 3406 4422 370 1062 92 C ATOM 14655 CD LYS B 330 -25.401 -34.163 -5.741 1.00 28.27 C ANISOU14655 CD LYS B 330 2264 3639 4840 368 1057 108 C ATOM 14656 CE LYS B 330 -24.843 -34.613 -4.396 1.00 27.66 C ANISOU14656 CE LYS B 330 2181 3458 4870 428 1010 162 C ATOM 14657 NZ LYS B 330 -25.319 -35.970 -4.016 1.00 37.10 N ANISOU14657 NZ LYS B 330 3371 4575 6151 414 978 182 N ATOM 14658 H LYS B 330 -23.035 -30.816 -4.740 1.00 32.87 H ATOM 14659 HA LYS B 330 -25.039 -30.056 -6.385 1.00 27.12 H ATOM 14660 HB2 LYS B 330 -25.093 -31.952 -4.295 1.00 25.99 H ATOM 14661 HB3 LYS B 330 -26.319 -31.652 -5.255 1.00 25.99 H ATOM 14662 HG2 LYS B 330 -25.191 -32.593 -7.041 1.00 31.05 H ATOM 14663 HG3 LYS B 330 -23.903 -32.820 -6.134 1.00 31.05 H ATOM 14664 HD2 LYS B 330 -26.367 -34.125 -5.670 1.00 33.93 H ATOM 14665 HD3 LYS B 330 -25.139 -34.815 -6.410 1.00 33.93 H ATOM 14666 HE2 LYS B 330 -23.875 -34.636 -4.446 1.00 33.19 H ATOM 14667 HE3 LYS B 330 -25.127 -33.990 -3.709 1.00 33.19 H ATOM 14668 HZ1 LYS B 330 -26.207 -35.975 -3.958 1.00 44.52 H ATOM 14669 HZ2 LYS B 330 -25.066 -36.563 -4.629 1.00 44.52 H ATOM 14670 HZ3 LYS B 330 -24.976 -36.202 -3.229 1.00 44.52 H ATOM 14671 N GLU B 331 -24.722 -28.986 -3.431 1.00 25.72 N ANISOU14671 N GLU B 331 2129 3456 4186 503 960 317 N ATOM 14672 CA GLU B 331 -25.266 -28.157 -2.356 1.00 27.60 C ANISOU14672 CA GLU B 331 2411 3717 4358 549 927 410 C ATOM 14673 C GLU B 331 -24.347 -27.004 -2.003 1.00 28.43 C ANISOU14673 C GLU B 331 2535 3811 4455 581 899 394 C ATOM 14674 O GLU B 331 -23.130 -27.136 -2.048 1.00 35.39 O ANISOU14674 O GLU B 331 3389 4636 5420 590 888 329 O ATOM 14675 CB GLU B 331 -25.478 -28.996 -1.091 1.00 34.25 C ANISOU14675 CB GLU B 331 3247 4505 5262 603 900 482 C ATOM 14676 CG GLU B 331 -26.501 -30.113 -1.235 1.00 40.97 C ANISOU14676 CG GLU B 331 4075 5359 6132 574 928 519 C ATOM 14677 CD GLU B 331 -26.712 -30.887 0.060 1.00 46.60 C ANISOU14677 CD GLU B 331 4788 6015 6902 628 903 607 C ATOM 14678 OE1 GLU B 331 -27.078 -30.257 1.080 1.00 44.08 O ANISOU14678 OE1 GLU B 331 4513 5723 6512 677 878 688 O ATOM 14679 OE2 GLU B 331 -26.520 -32.126 0.050 1.00 45.87 O ANISOU14679 OE2 GLU B 331 4678 5847 6903 609 890 585 O ATOM 14680 H GLU B 331 -23.915 -29.247 -3.289 1.00 30.86 H ATOM 14681 HA GLU B 331 -26.122 -27.794 -2.631 1.00 33.12 H ATOM 14682 HB2 GLU B 331 -24.633 -29.402 -0.843 1.00 41.10 H ATOM 14683 HB3 GLU B 331 -25.781 -28.411 -0.379 1.00 41.10 H ATOM 14684 HG2 GLU B 331 -27.352 -29.730 -1.498 1.00 49.16 H ATOM 14685 HG3 GLU B 331 -26.194 -30.737 -1.911 1.00 49.16 H ATOM 14686 N LEU B 332 -24.946 -25.871 -1.656 1.00 25.83 N ANISOU14686 N LEU B 332 2250 3533 4031 596 885 449 N ATOM 14687 CA LEU B 332 -24.230 -24.799 -0.986 1.00 24.96 C ANISOU14687 CA LEU B 332 2158 3404 3923 640 849 451 C ATOM 14688 C LEU B 332 -24.032 -25.244 0.457 1.00 21.49 C ANISOU14688 C LEU B 332 1723 2914 3527 713 798 497 C ATOM 14689 O LEU B 332 -24.980 -25.714 1.089 1.00 26.79 O ANISOU14689 O LEU B 332 2412 3604 4162 735 797 573 O ATOM 14690 CB LEU B 332 -25.056 -23.510 -1.007 1.00 19.95 C ANISOU14690 CB LEU B 332 1569 2834 3178 639 847 499 C ATOM 14691 CG LEU B 332 -25.514 -22.970 -2.362 1.00 18.72 C ANISOU14691 CG LEU B 332 1422 2735 2957 576 887 475 C ATOM 14692 CD1 LEU B 332 -26.275 -21.668 -2.180 1.00 21.96 C ANISOU14692 CD1 LEU B 332 1877 3192 3277 591 872 530 C ATOM 14693 CD2 LEU B 332 -24.336 -22.761 -3.286 1.00 24.05 C ANISOU14693 CD2 LEU B 332 2069 3389 3682 542 914 394 C ATOM 14694 H LEU B 332 -25.776 -25.699 -1.801 1.00 31.00 H ATOM 14695 HA LEU B 332 -23.368 -24.645 -1.404 1.00 29.96 H ATOM 14696 HB2 LEU B 332 -25.855 -23.661 -0.479 1.00 23.94 H ATOM 14697 HB3 LEU B 332 -24.528 -22.812 -0.589 1.00 23.94 H ATOM 14698 HG LEU B 332 -26.111 -23.613 -2.775 1.00 22.47 H ATOM 14699 HD11 LEU B 332 -26.556 -21.344 -3.050 1.00 26.36 H ATOM 14700 HD12 LEU B 332 -27.051 -21.832 -1.622 1.00 26.36 H ATOM 14701 HD13 LEU B 332 -25.693 -21.019 -1.756 1.00 26.36 H ATOM 14702 HD21 LEU B 332 -24.657 -22.419 -4.134 1.00 28.86 H ATOM 14703 HD22 LEU B 332 -23.726 -22.124 -2.881 1.00 28.86 H ATOM 14704 HD23 LEU B 332 -23.886 -23.610 -3.420 1.00 28.86 H ATOM 14705 N ASP B 333 -22.823 -25.106 0.992 1.00 29.66 N ANISOU14705 N ASP B 333 2744 3886 4638 752 754 454 N ATOM 14706 CA ASP B 333 -22.582 -25.565 2.357 1.00 29.71 C ANISOU14706 CA ASP B 333 2765 3842 4680 826 691 493 C ATOM 14707 C ASP B 333 -23.213 -24.594 3.352 1.00 35.28 C ANISOU14707 C ASP B 333 3525 4592 5288 877 658 562 C ATOM 14708 O ASP B 333 -23.614 -23.490 2.986 1.00 36.67 O ANISOU14708 O ASP B 333 3719 4821 5392 856 677 565 O ATOM 14709 CB ASP B 333 -21.088 -25.787 2.639 1.00 27.54 C ANISOU14709 CB ASP B 333 2463 3485 4517 852 636 415 C ATOM 14710 CG ASP B 333 -20.280 -24.501 2.610 1.00 43.29 C ANISOU14710 CG ASP B 333 4459 5482 6510 856 611 362 C ATOM 14711 OD1 ASP B 333 -20.368 -23.721 3.582 1.00 45.66 O ANISOU14711 OD1 ASP B 333 4796 5790 6763 908 557 392 O ATOM 14712 OD2 ASP B 333 -19.541 -24.282 1.623 1.00 53.24 O ANISOU14712 OD2 ASP B 333 5681 6733 7816 806 645 288 O ATOM 14713 H ASP B 333 -22.141 -24.760 0.599 1.00 35.59 H ATOM 14714 HA ASP B 333 -23.024 -26.421 2.471 1.00 35.65 H ATOM 14715 HB2 ASP B 333 -20.989 -26.182 3.520 1.00 33.05 H ATOM 14716 HB3 ASP B 333 -20.725 -26.383 1.966 1.00 33.05 H ATOM 14717 N SER B 334 -23.321 -25.022 4.605 1.00 54.24 N ANISOU14717 N SER B 334 5956 6969 7682 945 608 618 N ATOM 14718 CA SER B 334 -24.026 -24.250 5.620 1.00 48.19 C ANISOU14718 CA SER B 334 5248 6253 6811 996 581 684 C ATOM 14719 C SER B 334 -23.330 -22.931 5.952 1.00 49.11 C ANISOU14719 C SER B 334 5382 6364 6913 1020 529 630 C ATOM 14720 O SER B 334 -23.992 -21.939 6.261 1.00 59.39 O ANISOU14720 O SER B 334 6720 7721 8125 1034 529 660 O ATOM 14721 CB SER B 334 -24.185 -25.089 6.887 1.00 46.08 C ANISOU14721 CB SER B 334 5017 5958 6534 1064 537 754 C ATOM 14722 OG SER B 334 -24.933 -26.263 6.614 1.00 61.67 O ANISOU14722 OG SER B 334 6970 7933 8527 1043 590 816 O ATOM 14723 H SER B 334 -22.991 -25.762 4.894 1.00 65.08 H ATOM 14724 HA SER B 334 -24.914 -24.041 5.291 1.00 57.83 H ATOM 14725 HB2 SER B 334 -23.307 -25.341 7.213 1.00 55.30 H ATOM 14726 HB3 SER B 334 -24.652 -24.565 7.557 1.00 55.30 H ATOM 14727 HG SER B 334 -25.017 -26.719 7.314 1.00 74.00 H ATOM 14728 N LYS B 335 -22.001 -22.922 5.879 1.00 21.78 N ANISOU14728 N LYS B 335 1890 2835 3549 1024 483 546 N ATOM 14729 CA LYS B 335 -21.223 -21.730 6.203 1.00 20.03 C ANISOU14729 CA LYS B 335 1674 2598 3338 1046 428 486 C ATOM 14730 C LYS B 335 -21.486 -20.586 5.225 1.00 30.55 C ANISOU14730 C LYS B 335 2992 3973 4641 994 484 470 C ATOM 14731 O LYS B 335 -21.556 -19.426 5.634 1.00 35.68 O ANISOU14731 O LYS B 335 3666 4639 5251 1017 455 466 O ATOM 14732 CB LYS B 335 -19.723 -22.036 6.233 1.00 23.86 C ANISOU14732 CB LYS B 335 2119 3003 3943 1057 372 395 C ATOM 14733 CG LYS B 335 -19.278 -22.990 7.341 1.00 32.51 C ANISOU14733 CG LYS B 335 3238 4045 5071 1122 289 402 C ATOM 14734 CD LYS B 335 -17.943 -22.546 7.951 1.00 39.93 C ANISOU14734 CD LYS B 335 4169 4929 6073 1168 191 314 C ATOM 14735 CE LYS B 335 -17.248 -23.662 8.724 1.00 43.74 C ANISOU14735 CE LYS B 335 4663 5347 6610 1221 110 303 C ATOM 14736 NZ LYS B 335 -16.581 -24.640 7.818 1.00 43.38 N ANISOU14736 NZ LYS B 335 4558 5255 6669 1174 149 260 N ATOM 14737 H LYS B 335 -21.524 -23.598 5.643 1.00 26.13 H ATOM 14738 HA LYS B 335 -21.479 -21.425 7.088 1.00 24.03 H ATOM 14739 HB2 LYS B 335 -19.473 -22.437 5.385 1.00 28.63 H ATOM 14740 HB3 LYS B 335 -19.240 -21.203 6.353 1.00 28.63 H ATOM 14741 HG2 LYS B 335 -19.947 -22.999 8.044 1.00 39.02 H ATOM 14742 HG3 LYS B 335 -19.165 -23.880 6.973 1.00 39.02 H ATOM 14743 HD2 LYS B 335 -17.350 -22.260 7.239 1.00 47.92 H ATOM 14744 HD3 LYS B 335 -18.104 -21.812 8.564 1.00 47.92 H ATOM 14745 HE2 LYS B 335 -16.572 -23.275 9.302 1.00 52.49 H ATOM 14746 HE3 LYS B 335 -17.906 -24.140 9.253 1.00 52.49 H ATOM 14747 HZ1 LYS B 335 -16.186 -25.278 8.297 1.00 52.06 H ATOM 14748 HZ2 LYS B 335 -17.182 -25.015 7.279 1.00 52.06 H ATOM 14749 HZ3 LYS B 335 -15.967 -24.227 7.323 1.00 52.06 H ATOM 14750 N THR B 336 -21.619 -20.893 3.937 1.00 28.99 N ANISOU14750 N THR B 336 2760 3792 4464 924 560 458 N ATOM 14751 CA THR B 336 -21.848 -19.825 2.965 1.00 24.66 C ANISOU14751 CA THR B 336 2206 3283 3883 875 610 449 C ATOM 14752 C THR B 336 -23.259 -19.259 3.078 1.00 25.38 C ANISOU14752 C THR B 336 2343 3446 3855 879 631 527 C ATOM 14753 O THR B 336 -23.494 -18.117 2.694 1.00 36.11 O ANISOU14753 O THR B 336 3712 4830 5178 865 644 531 O ATOM 14754 CB THR B 336 -21.580 -20.237 1.485 1.00 23.70 C ANISOU14754 CB THR B 336 2043 3165 3798 798 682 410 C ATOM 14755 OG1 THR B 336 -22.798 -20.631 0.849 1.00 28.21 O ANISOU14755 OG1 THR B 336 2633 3796 4290 760 734 460 O ATOM 14756 CG2 THR B 336 -20.572 -21.352 1.388 1.00 30.67 C ANISOU14756 CG2 THR B 336 2883 3988 4784 793 673 349 C ATOM 14757 H THR B 336 -21.583 -21.686 3.607 1.00 34.79 H ATOM 14758 HA THR B 336 -21.236 -19.102 3.170 1.00 29.60 H ATOM 14759 HB THR B 336 -21.217 -19.472 1.012 1.00 28.44 H ATOM 14760 HG1 THR B 336 -22.648 -20.852 0.052 1.00 33.85 H ATOM 14761 HG21 THR B 336 -20.427 -21.586 0.458 1.00 36.81 H ATOM 14762 HG22 THR B 336 -19.730 -21.072 1.778 1.00 36.81 H ATOM 14763 HG23 THR B 336 -20.896 -22.133 1.862 1.00 36.81 H ATOM 14764 N ILE B 337 -24.194 -20.042 3.607 1.00 24.90 N ANISOU14764 N ILE B 337 2306 3414 3739 899 634 591 N ATOM 14765 CA ILE B 337 -25.534 -19.525 3.864 1.00 22.54 C ANISOU14765 CA ILE B 337 2049 3186 3330 909 649 661 C ATOM 14766 C ILE B 337 -25.452 -18.521 5.001 1.00 23.90 C ANISOU14766 C ILE B 337 2258 3358 3465 973 591 665 C ATOM 14767 O ILE B 337 -26.082 -17.470 4.953 1.00 25.35 O ANISOU14767 O ILE B 337 2464 3581 3586 976 596 683 O ATOM 14768 CB ILE B 337 -26.528 -20.637 4.243 1.00 19.31 C ANISOU14768 CB ILE B 337 1651 2808 2878 917 671 730 C ATOM 14769 CG1 ILE B 337 -26.642 -21.650 3.095 1.00 22.05 C ANISOU14769 CG1 ILE B 337 1959 3151 3267 849 722 713 C ATOM 14770 CG2 ILE B 337 -27.893 -20.033 4.624 1.00 18.27 C ANISOU14770 CG2 ILE B 337 1558 2750 2635 933 683 798 C ATOM 14771 CD1 ILE B 337 -28.042 -21.860 2.543 1.00 21.75 C ANISOU14771 CD1 ILE B 337 1931 3178 3157 807 764 761 C ATOM 14772 H ILE B 337 -24.081 -20.867 3.823 1.00 29.87 H ATOM 14773 HA ILE B 337 -25.865 -19.070 3.074 1.00 27.05 H ATOM 14774 HB ILE B 337 -26.178 -21.101 5.019 1.00 23.17 H ATOM 14775 HG12 ILE B 337 -26.083 -21.347 2.362 1.00 26.46 H ATOM 14776 HG13 ILE B 337 -26.322 -22.509 3.411 1.00 26.46 H ATOM 14777 HG21 ILE B 337 -28.502 -20.751 4.858 1.00 21.93 H ATOM 14778 HG22 ILE B 337 -27.775 -19.438 5.381 1.00 21.93 H ATOM 14779 HG23 ILE B 337 -28.241 -19.537 3.866 1.00 21.93 H ATOM 14780 HD11 ILE B 337 -28.004 -22.514 1.827 1.00 26.11 H ATOM 14781 HD12 ILE B 337 -28.617 -22.181 3.255 1.00 26.11 H ATOM 14782 HD13 ILE B 337 -28.377 -21.016 2.202 1.00 26.11 H ATOM 14783 N ARG B 338 -24.674 -18.860 6.025 1.00 25.87 N ANISOU14783 N ARG B 338 2516 3560 3755 1027 529 642 N ATOM 14784 CA ARG B 338 -24.437 -17.951 7.142 1.00 28.70 C ANISOU14784 CA ARG B 338 2911 3910 4084 1088 460 625 C ATOM 14785 C ARG B 338 -23.840 -16.637 6.646 1.00 27.93 C ANISOU14785 C ARG B 338 2794 3791 4028 1070 448 564 C ATOM 14786 O ARG B 338 -24.156 -15.566 7.161 1.00 31.66 O ANISOU14786 O ARG B 338 3295 4281 4453 1100 419 564 O ATOM 14787 CB ARG B 338 -23.505 -18.593 8.176 1.00 35.35 C ANISOU14787 CB ARG B 338 3762 4693 4977 1142 383 594 C ATOM 14788 CG ARG B 338 -24.221 -19.094 9.423 1.00 50.60 C ANISOU14788 CG ARG B 338 5751 6657 6818 1203 360 663 C ATOM 14789 CD ARG B 338 -23.314 -19.930 10.316 1.00 58.49 C ANISOU14789 CD ARG B 338 6764 7593 7867 1253 283 643 C ATOM 14790 NE ARG B 338 -23.308 -21.340 9.929 1.00 61.36 N ANISOU14790 NE ARG B 338 7103 7931 8279 1232 316 679 N ATOM 14791 CZ ARG B 338 -22.892 -22.332 10.712 1.00 68.54 C ANISOU14791 CZ ARG B 338 8035 8795 9213 1276 264 698 C ATOM 14792 NH1 ARG B 338 -22.444 -22.078 11.935 1.00 82.19 N ANISOU14792 NH1 ARG B 338 9814 10503 10911 1343 173 684 N ATOM 14793 NH2 ARG B 338 -22.927 -23.585 10.277 1.00 60.28 N ANISOU14793 NH2 ARG B 338 6962 7719 8223 1253 299 731 N ATOM 14794 H ARG B 338 -24.270 -19.615 6.098 1.00 31.05 H ATOM 14795 HA ARG B 338 -25.281 -17.754 7.577 1.00 34.44 H ATOM 14796 HB2 ARG B 338 -23.058 -19.351 7.766 1.00 42.42 H ATOM 14797 HB3 ARG B 338 -22.848 -17.937 8.455 1.00 42.42 H ATOM 14798 HG2 ARG B 338 -24.532 -18.333 9.938 1.00 60.72 H ATOM 14799 HG3 ARG B 338 -24.973 -19.647 9.157 1.00 60.72 H ATOM 14800 HD2 ARG B 338 -22.406 -19.595 10.249 1.00 70.19 H ATOM 14801 HD3 ARG B 338 -23.626 -19.869 11.232 1.00 70.19 H ATOM 14802 HE ARG B 338 -23.593 -21.541 9.143 1.00 73.63 H ATOM 14803 HH11 ARG B 338 -22.419 -21.268 12.225 1.00 98.62 H ATOM 14804 HH12 ARG B 338 -22.176 -22.723 12.438 1.00 98.62 H ATOM 14805 HH21 ARG B 338 -23.216 -23.758 9.485 1.00 72.34 H ATOM 14806 HH22 ARG B 338 -22.657 -24.225 10.784 1.00 72.34 H ATOM 14807 N ALA B 339 -22.981 -16.725 5.637 1.00 20.62 N ANISOU14807 N ALA B 339 1817 2826 3192 1021 473 514 N ATOM 14808 CA ALA B 339 -22.341 -15.542 5.078 1.00 25.33 C ANISOU14808 CA ALA B 339 2387 3398 3838 1002 474 465 C ATOM 14809 C ALA B 339 -23.326 -14.710 4.259 1.00 30.82 C ANISOU14809 C ALA B 339 3096 4149 4466 967 533 514 C ATOM 14810 O ALA B 339 -23.255 -13.479 4.253 1.00 26.47 O ANISOU14810 O ALA B 339 2547 3591 3917 977 519 503 O ATOM 14811 CB ALA B 339 -21.161 -15.947 4.227 1.00 19.09 C ANISOU14811 CB ALA B 339 1538 2558 3157 959 497 404 C ATOM 14812 H ALA B 339 -22.751 -17.462 5.256 1.00 24.75 H ATOM 14813 HA ALA B 339 -22.012 -14.989 5.804 1.00 30.39 H ATOM 14814 HB1 ALA B 339 -20.746 -15.149 3.863 1.00 22.91 H ATOM 14815 HB2 ALA B 339 -20.525 -16.429 4.778 1.00 22.91 H ATOM 14816 HB3 ALA B 339 -21.472 -16.517 3.506 1.00 22.91 H ATOM 14817 N GLN B 340 -24.244 -15.387 3.574 1.00 29.18 N ANISOU14817 N GLN B 340 2895 3992 4201 928 592 566 N ATOM 14818 CA GLN B 340 -25.244 -14.710 2.752 1.00 21.14 C ANISOU14818 CA GLN B 340 1891 3028 3114 896 638 612 C ATOM 14819 C GLN B 340 -26.169 -13.834 3.591 1.00 25.20 C ANISOU14819 C GLN B 340 2448 3579 3547 945 607 651 C ATOM 14820 O GLN B 340 -26.610 -12.779 3.133 1.00 33.65 O ANISOU14820 O GLN B 340 3526 4670 4590 939 620 669 O ATOM 14821 CB GLN B 340 -26.077 -15.722 1.959 1.00 17.82 C ANISOU14821 CB GLN B 340 1470 2651 2648 849 690 649 C ATOM 14822 CG GLN B 340 -25.385 -16.265 0.716 1.00 17.91 C ANISOU14822 CG GLN B 340 1444 2642 2719 784 736 606 C ATOM 14823 CD GLN B 340 -26.210 -17.301 -0.047 1.00 22.19 C ANISOU14823 CD GLN B 340 1988 3225 3219 736 774 625 C ATOM 14824 OE1 GLN B 340 -25.725 -17.892 -1.015 1.00 19.57 O ANISOU14824 OE1 GLN B 340 1629 2882 2925 685 810 582 O ATOM 14825 NE2 GLN B 340 -27.456 -17.525 0.380 1.00 24.16 N ANISOU14825 NE2 GLN B 340 2266 3522 3393 752 766 682 N ATOM 14826 H GLN B 340 -24.310 -16.244 3.569 1.00 35.02 H ATOM 14827 HA GLN B 340 -24.789 -14.137 2.115 1.00 25.37 H ATOM 14828 HB2 GLN B 340 -26.282 -16.475 2.535 1.00 21.38 H ATOM 14829 HB3 GLN B 340 -26.899 -15.294 1.676 1.00 21.38 H ATOM 14830 HG2 GLN B 340 -25.203 -15.528 0.113 1.00 21.49 H ATOM 14831 HG3 GLN B 340 -24.552 -16.686 0.981 1.00 21.49 H ATOM 14832 HE21 GLN B 340 -27.762 -17.094 1.059 1.00 29.00 H ATOM 14833 HE22 GLN B 340 -27.952 -18.101 -0.023 1.00 29.00 H ATOM 14834 N LEU B 341 -26.465 -14.272 4.813 1.00 25.22 N ANISOU14834 N LEU B 341 2480 3592 3511 996 568 665 N ATOM 14835 CA LEU B 341 -27.302 -13.494 5.721 1.00 25.83 C ANISOU14835 CA LEU B 341 2599 3708 3508 1046 540 691 C ATOM 14836 C LEU B 341 -26.542 -12.274 6.207 1.00 29.22 C ANISOU14836 C LEU B 341 3030 4091 3982 1080 483 633 C ATOM 14837 O LEU B 341 -27.130 -11.220 6.452 1.00 33.29 O ANISOU14837 O LEU B 341 3566 4627 4453 1103 471 640 O ATOM 14838 CB LEU B 341 -27.704 -14.318 6.945 1.00 25.01 C ANISOU14838 CB LEU B 341 2526 3627 3349 1095 519 720 C ATOM 14839 CG LEU B 341 -28.363 -15.682 6.748 1.00 25.47 C ANISOU14839 CG LEU B 341 2579 3719 3380 1073 567 778 C ATOM 14840 CD1 LEU B 341 -28.756 -16.242 8.106 1.00 24.15 C ANISOU14840 CD1 LEU B 341 2447 3576 3151 1136 548 817 C ATOM 14841 CD2 LEU B 341 -29.566 -15.608 5.820 1.00 28.88 C ANISOU14841 CD2 LEU B 341 3005 4207 3759 1028 621 825 C ATOM 14842 H LEU B 341 -26.192 -15.019 5.140 1.00 30.27 H ATOM 14843 HA LEU B 341 -28.105 -13.202 5.261 1.00 31.00 H ATOM 14844 HB2 LEU B 341 -26.903 -14.470 7.471 1.00 30.01 H ATOM 14845 HB3 LEU B 341 -28.323 -13.784 7.466 1.00 30.01 H ATOM 14846 HG LEU B 341 -27.718 -16.288 6.351 1.00 30.56 H ATOM 14847 HD11 LEU B 341 -29.174 -17.109 7.980 1.00 28.97 H ATOM 14848 HD12 LEU B 341 -27.959 -16.335 8.651 1.00 28.97 H ATOM 14849 HD13 LEU B 341 -29.379 -15.632 8.530 1.00 28.97 H ATOM 14850 HD21 LEU B 341 -29.948 -16.494 5.728 1.00 34.65 H ATOM 14851 HD22 LEU B 341 -30.222 -15.003 6.203 1.00 34.65 H ATOM 14852 HD23 LEU B 341 -29.277 -15.279 4.955 1.00 34.65 H ATOM 14853 N SER B 342 -25.229 -12.430 6.352 1.00 30.70 N ANISOU14853 N SER B 342 3190 4211 4265 1084 446 571 N ATOM 14854 CA SER B 342 -24.392 -11.407 6.963 1.00 29.79 C ANISOU14854 CA SER B 342 3071 4041 4208 1121 377 505 C ATOM 14855 C SER B 342 -24.120 -10.226 6.033 1.00 28.81 C ANISOU14855 C SER B 342 2917 3894 4137 1091 400 490 C ATOM 14856 O SER B 342 -23.866 -9.119 6.506 1.00 25.79 O ANISOU14856 O SER B 342 2537 3481 3782 1124 351 452 O ATOM 14857 CB SER B 342 -23.062 -12.015 7.417 1.00 32.28 C ANISOU14857 CB SER B 342 3359 4289 4617 1137 321 439 C ATOM 14858 OG SER B 342 -23.261 -13.233 8.115 1.00 34.78 O ANISOU14858 OG SER B 342 3700 4621 4893 1161 308 465 O ATOM 14859 H SER B 342 -24.795 -13.129 6.100 1.00 36.84 H ATOM 14860 HA SER B 342 -24.844 -11.064 7.750 1.00 35.75 H ATOM 14861 HB2 SER B 342 -22.513 -12.187 6.636 1.00 38.74 H ATOM 14862 HB3 SER B 342 -22.613 -11.386 8.003 1.00 38.74 H ATOM 14863 HG SER B 342 -23.734 -13.100 8.796 1.00 41.73 H ATOM 14864 N ASP B 343 -24.181 -10.457 4.721 1.00 21.71 N ANISOU14864 N ASP B 343 1989 3008 3252 1031 476 521 N ATOM 14865 CA ASP B 343 -23.802 -9.435 3.746 1.00 24.96 C ANISOU14865 CA ASP B 343 2369 3394 3720 1001 512 519 C ATOM 14866 C ASP B 343 -24.536 -9.589 2.411 1.00 28.72 C ANISOU14866 C ASP B 343 2842 3920 4149 947 597 585 C ATOM 14867 O ASP B 343 -24.220 -10.485 1.625 1.00 25.52 O ANISOU14867 O ASP B 343 2415 3518 3764 898 646 583 O ATOM 14868 CB ASP B 343 -22.289 -9.492 3.513 1.00 24.20 C ANISOU14868 CB ASP B 343 2220 3225 3749 984 504 452 C ATOM 14869 CG ASP B 343 -21.803 -8.439 2.534 1.00 29.76 C ANISOU14869 CG ASP B 343 2887 3897 4523 951 552 457 C ATOM 14870 OD1 ASP B 343 -22.450 -7.376 2.418 1.00 37.26 O ANISOU14870 OD1 ASP B 343 3855 4859 5443 966 556 495 O ATOM 14871 OD2 ASP B 343 -20.766 -8.677 1.881 1.00 31.87 O ANISOU14871 OD2 ASP B 343 3106 4123 4880 910 589 425 O ATOM 14872 H ASP B 343 -24.440 -11.198 4.370 1.00 26.05 H ATOM 14873 HA ASP B 343 -24.017 -8.561 4.107 1.00 29.95 H ATOM 14874 HB2 ASP B 343 -21.834 -9.348 4.358 1.00 29.04 H ATOM 14875 HB3 ASP B 343 -22.057 -10.364 3.156 1.00 29.04 H ATOM 14876 N TYR B 344 -25.499 -8.701 2.156 1.00 26.00 N ANISOU14876 N TYR B 344 2521 3612 3744 957 609 635 N ATOM 14877 CA TYR B 344 -26.258 -8.714 0.904 1.00 27.58 C ANISOU14877 CA TYR B 344 2723 3863 3894 914 677 697 C ATOM 14878 C TYR B 344 -26.024 -7.439 0.081 1.00 24.19 C ANISOU14878 C TYR B 344 2274 3409 3507 906 709 722 C ATOM 14879 O TYR B 344 -26.793 -7.118 -0.829 1.00 25.71 O ANISOU14879 O TYR B 344 2476 3646 3646 889 751 782 O ATOM 14880 CB TYR B 344 -27.756 -8.931 1.181 1.00 24.55 C ANISOU14880 CB TYR B 344 2379 3552 3397 932 669 748 C ATOM 14881 CG TYR B 344 -28.360 -8.019 2.234 1.00 27.90 C ANISOU14881 CG TYR B 344 2833 3984 3785 992 616 747 C ATOM 14882 CD1 TYR B 344 -28.797 -6.743 1.905 1.00 29.23 C ANISOU14882 CD1 TYR B 344 3005 4153 3948 1010 615 773 C ATOM 14883 CD2 TYR B 344 -28.512 -8.442 3.552 1.00 27.72 C ANISOU14883 CD2 TYR B 344 2835 3966 3731 1032 568 721 C ATOM 14884 CE1 TYR B 344 -29.357 -5.907 2.856 1.00 28.60 C ANISOU14884 CE1 TYR B 344 2951 4077 3838 1063 565 760 C ATOM 14885 CE2 TYR B 344 -29.073 -7.611 4.516 1.00 22.18 C ANISOU14885 CE2 TYR B 344 2162 3274 2989 1085 523 711 C ATOM 14886 CZ TYR B 344 -29.493 -6.340 4.159 1.00 24.17 C ANISOU14886 CZ TYR B 344 2416 3525 3243 1098 520 724 C ATOM 14887 OH TYR B 344 -30.054 -5.477 5.083 1.00 30.75 O ANISOU14887 OH TYR B 344 3274 4365 4043 1149 475 703 O ATOM 14888 H TYR B 344 -25.733 -8.074 2.697 1.00 31.19 H ATOM 14889 HA TYR B 344 -25.952 -9.463 0.370 1.00 33.10 H ATOM 14890 HB2 TYR B 344 -28.246 -8.787 0.356 1.00 29.46 H ATOM 14891 HB3 TYR B 344 -27.885 -9.845 1.479 1.00 29.46 H ATOM 14892 HD1 TYR B 344 -28.708 -6.442 1.029 1.00 35.08 H ATOM 14893 HD2 TYR B 344 -28.229 -9.295 3.793 1.00 33.26 H ATOM 14894 HE1 TYR B 344 -29.639 -5.054 2.618 1.00 34.32 H ATOM 14895 HE2 TYR B 344 -29.163 -7.905 5.393 1.00 26.61 H ATOM 14896 HH TYR B 344 -30.086 -5.844 5.837 1.00 36.90 H ATOM 14897 N SER B 345 -24.932 -6.739 0.379 1.00 25.91 N ANISOU14897 N SER B 345 2464 3555 3827 920 688 677 N ATOM 14898 CA SER B 345 -24.617 -5.472 -0.288 1.00 26.31 C ANISOU14898 CA SER B 345 2490 3567 3938 916 720 705 C ATOM 14899 C SER B 345 -24.413 -5.621 -1.798 1.00 24.62 C ANISOU14899 C SER B 345 2253 3369 3733 852 818 751 C ATOM 14900 O SER B 345 -24.504 -4.643 -2.540 1.00 31.32 O ANISOU14900 O SER B 345 3091 4208 4600 847 863 806 O ATOM 14901 CB SER B 345 -23.379 -4.821 0.342 1.00 27.18 C ANISOU14901 CB SER B 345 2566 3586 4174 935 677 637 C ATOM 14902 OG SER B 345 -22.393 -5.784 0.664 1.00 31.58 O ANISOU14902 OG SER B 345 3098 4115 4785 917 662 570 O ATOM 14903 H SER B 345 -24.352 -6.976 0.968 1.00 31.09 H ATOM 14904 HA SER B 345 -25.363 -4.866 -0.156 1.00 31.57 H ATOM 14905 HB2 SER B 345 -23.004 -4.186 -0.288 1.00 32.61 H ATOM 14906 HB3 SER B 345 -23.645 -4.361 1.154 1.00 32.61 H ATOM 14907 HG SER B 345 -22.151 -6.190 -0.031 1.00 37.89 H ATOM 14908 N ASP B 346 -24.155 -6.843 -2.252 1.00 19.27 N ANISOU14908 N ASP B 346 1571 2714 3037 802 851 726 N ATOM 14909 CA ASP B 346 -23.851 -7.088 -3.660 1.00 19.53 C ANISOU14909 CA ASP B 346 1592 2762 3067 731 936 745 C ATOM 14910 C ASP B 346 -25.097 -7.421 -4.478 1.00 21.57 C ANISOU14910 C ASP B 346 1893 3105 3198 710 958 802 C ATOM 14911 O ASP B 346 -25.028 -7.522 -5.704 1.00 21.36 O ANISOU14911 O ASP B 346 1873 3101 3141 652 1018 818 O ATOM 14912 CB ASP B 346 -22.827 -8.217 -3.798 1.00 20.38 C ANISOU14912 CB ASP B 346 1673 2844 3228 685 953 671 C ATOM 14913 CG ASP B 346 -23.305 -9.519 -3.185 1.00 31.50 C ANISOU14913 CG ASP B 346 3101 4286 4581 696 907 642 C ATOM 14914 OD1 ASP B 346 -24.075 -9.473 -2.197 1.00 21.26 O ANISOU14914 OD1 ASP B 346 1831 3009 3238 751 847 659 O ATOM 14915 OD2 ASP B 346 -22.905 -10.588 -3.695 1.00 39.42 O ANISOU14915 OD2 ASP B 346 4094 5296 5590 650 934 601 O ATOM 14916 H ASP B 346 -24.149 -7.551 -1.763 1.00 23.12 H ATOM 14917 HA ASP B 346 -23.458 -6.285 -4.037 1.00 23.44 H ATOM 14918 HB2 ASP B 346 -22.654 -8.374 -4.739 1.00 24.46 H ATOM 14919 HB3 ASP B 346 -22.008 -7.957 -3.348 1.00 24.46 H ATOM 14920 N ILE B 347 -26.224 -7.607 -3.794 1.00 21.56 N ANISOU14920 N ILE B 347 1921 3149 3121 754 905 823 N ATOM 14921 CA ILE B 347 -27.504 -7.847 -4.457 1.00 18.77 C ANISOU14921 CA ILE B 347 1601 2872 2657 742 910 873 C ATOM 14922 C ILE B 347 -28.501 -6.738 -4.102 1.00 22.39 C ANISOU14922 C ILE B 347 2075 3356 3076 804 881 935 C ATOM 14923 O ILE B 347 -29.713 -6.887 -4.269 1.00 29.76 O ANISOU14923 O ILE B 347 3031 4352 3924 815 863 971 O ATOM 14924 CB ILE B 347 -28.075 -9.232 -4.089 1.00 18.35 C ANISOU14924 CB ILE B 347 1565 2855 2554 730 879 842 C ATOM 14925 CG1 ILE B 347 -28.191 -9.383 -2.573 1.00 18.07 C ANISOU14925 CG1 ILE B 347 1533 2801 2531 787 821 823 C ATOM 14926 CG2 ILE B 347 -27.180 -10.334 -4.646 1.00 22.38 C ANISOU14926 CG2 ILE B 347 2058 3344 3101 669 912 781 C ATOM 14927 CD1 ILE B 347 -29.084 -10.523 -2.142 1.00 17.76 C ANISOU14927 CD1 ILE B 347 1513 2804 2430 785 796 823 C ATOM 14928 H ILE B 347 -26.275 -7.597 -2.936 1.00 25.87 H ATOM 14929 HA ILE B 347 -27.368 -7.828 -5.417 1.00 22.52 H ATOM 14930 HB ILE B 347 -28.959 -9.319 -4.480 1.00 22.03 H ATOM 14931 HG12 ILE B 347 -27.307 -9.544 -2.206 1.00 21.68 H ATOM 14932 HG13 ILE B 347 -28.556 -8.564 -2.203 1.00 21.68 H ATOM 14933 HG21 ILE B 347 -27.554 -11.196 -4.405 1.00 26.86 H ATOM 14934 HG22 ILE B 347 -27.138 -10.249 -5.611 1.00 26.86 H ATOM 14935 HG23 ILE B 347 -26.292 -10.240 -4.267 1.00 26.86 H ATOM 14936 HD11 ILE B 347 -29.108 -10.556 -1.173 1.00 21.31 H ATOM 14937 HD12 ILE B 347 -29.977 -10.373 -2.490 1.00 21.31 H ATOM 14938 HD13 ILE B 347 -28.727 -11.354 -2.493 1.00 21.31 H ATOM 14939 N VAL B 348 -27.966 -5.629 -3.600 1.00 28.07 N ANISOU14939 N VAL B 348 4019 2598 4048 -631 728 1419 N ATOM 14940 CA VAL B 348 -28.735 -4.423 -3.318 1.00 26.33 C ANISOU14940 CA VAL B 348 3760 2474 3771 -579 776 1446 C ATOM 14941 C VAL B 348 -28.036 -3.282 -4.057 1.00 24.94 C ANISOU14941 C VAL B 348 3638 2330 3506 -538 735 1364 C ATOM 14942 O VAL B 348 -26.867 -3.408 -4.407 1.00 24.95 O ANISOU14942 O VAL B 348 3700 2303 3477 -537 676 1302 O ATOM 14943 CB VAL B 348 -28.804 -4.175 -1.790 1.00 26.65 C ANISOU14943 CB VAL B 348 3792 2583 3749 -522 828 1500 C ATOM 14944 CG1 VAL B 348 -28.459 -2.735 -1.415 1.00 29.24 C ANISOU14944 CG1 VAL B 348 4159 2997 3953 -442 834 1462 C ATOM 14945 CG2 VAL B 348 -30.172 -4.557 -1.251 1.00 28.09 C ANISOU14945 CG2 VAL B 348 3875 2789 4009 -533 897 1608 C ATOM 14946 H VAL B 348 -27.131 -5.551 -3.409 1.00 33.68 H ATOM 14947 HA VAL B 348 -29.636 -4.516 -3.663 1.00 31.60 H ATOM 14948 HB VAL B 348 -28.152 -4.749 -1.358 1.00 31.97 H ATOM 14949 HG11 VAL B 348 -28.518 -2.637 -0.452 1.00 35.08 H ATOM 14950 HG12 VAL B 348 -27.557 -2.540 -1.714 1.00 35.08 H ATOM 14951 HG13 VAL B 348 -29.088 -2.137 -1.848 1.00 35.08 H ATOM 14952 HG21 VAL B 348 -30.192 -4.393 -0.295 1.00 33.71 H ATOM 14953 HG22 VAL B 348 -30.847 -4.018 -1.693 1.00 33.71 H ATOM 14954 HG23 VAL B 348 -30.330 -5.497 -1.430 1.00 33.71 H ATOM 14955 N THR B 349 -28.742 -2.188 -4.322 1.00 30.31 N ANISOU14955 N THR B 349 4291 3074 4152 -499 767 1371 N ATOM 14956 CA THR B 349 -28.145 -1.075 -5.052 1.00 26.44 C ANISOU14956 CA THR B 349 3846 2615 3587 -458 732 1300 C ATOM 14957 C THR B 349 -28.705 0.270 -4.620 1.00 23.34 C ANISOU14957 C THR B 349 3443 2309 3117 -385 780 1313 C ATOM 14958 O THR B 349 -29.543 0.352 -3.723 1.00 26.28 O ANISOU14958 O THR B 349 3774 2724 3488 -358 842 1379 O ATOM 14959 CB THR B 349 -28.363 -1.222 -6.564 1.00 30.03 C ANISOU14959 CB THR B 349 4288 3018 4104 -499 705 1273 C ATOM 14960 OG1 THR B 349 -27.742 -0.128 -7.248 1.00 36.04 O ANISOU14960 OG1 THR B 349 5089 3813 4790 -451 676 1211 O ATOM 14961 CG2 THR B 349 -29.844 -1.240 -6.889 1.00 33.09 C ANISOU14961 CG2 THR B 349 4586 3420 4568 -525 756 1341 C ATOM 14962 H THR B 349 -29.562 -2.066 -4.093 1.00 36.38 H ATOM 14963 HA THR B 349 -27.190 -1.067 -4.887 1.00 31.73 H ATOM 14964 HB THR B 349 -27.972 -2.057 -6.867 1.00 36.04 H ATOM 14965 HG1 THR B 349 -26.918 -0.120 -7.087 1.00 43.24 H ATOM 14966 HG21 THR B 349 -29.972 -1.334 -7.846 1.00 39.71 H ATOM 14967 HG22 THR B 349 -30.273 -1.985 -6.439 1.00 39.71 H ATOM 14968 HG23 THR B 349 -30.257 -0.414 -6.595 1.00 39.71 H ATOM 14969 N THR B 350 -28.225 1.320 -5.277 1.00 33.56 N ANISOU14969 N THR B 350 4774 3629 4350 -346 753 1253 N ATOM 14970 CA THR B 350 -28.694 2.675 -5.027 1.00 30.76 C ANISOU14970 CA THR B 350 4422 3343 3922 -271 794 1253 C ATOM 14971 C THR B 350 -29.907 2.969 -5.890 1.00 38.19 C ANISOU14971 C THR B 350 5304 4303 4902 -268 836 1292 C ATOM 14972 O THR B 350 -30.148 2.294 -6.890 1.00 44.09 O ANISOU14972 O THR B 350 6019 5006 5727 -327 818 1299 O ATOM 14973 CB THR B 350 -27.606 3.717 -5.346 1.00 27.67 C ANISOU14973 CB THR B 350 4091 2966 3456 -231 746 1172 C ATOM 14974 OG1 THR B 350 -26.941 3.357 -6.564 1.00 30.38 O ANISOU14974 OG1 THR B 350 4444 3267 3832 -269 689 1128 O ATOM 14975 CG2 THR B 350 -26.588 3.799 -4.213 1.00 31.42 C ANISOU14975 CG2 THR B 350 4607 3452 3881 -214 721 1151 C ATOM 14976 H THR B 350 -27.617 1.272 -5.882 1.00 40.28 H ATOM 14977 HA THR B 350 -28.946 2.766 -4.095 1.00 36.91 H ATOM 14978 HB THR B 350 -28.017 4.589 -5.450 1.00 33.20 H ATOM 14979 HG1 THR B 350 -26.346 3.922 -6.744 1.00 36.46 H ATOM 14980 HG21 THR B 350 -25.908 4.458 -4.425 1.00 37.71 H ATOM 14981 HG22 THR B 350 -27.029 4.056 -3.388 1.00 37.71 H ATOM 14982 HG23 THR B 350 -26.162 2.937 -4.087 1.00 37.71 H ATOM 14983 N LEU B 351 -30.661 3.988 -5.497 1.00 42.92 N ANISOU14983 N LEU B 351 5890 4968 5451 -195 892 1319 N ATOM 14984 CA LEU B 351 -31.882 4.363 -6.194 1.00 36.51 C ANISOU14984 CA LEU B 351 5007 4196 4668 -177 939 1371 C ATOM 14985 C LEU B 351 -31.558 5.060 -7.513 1.00 38.94 C ANISOU14985 C LEU B 351 5343 4499 4953 -167 907 1314 C ATOM 14986 O LEU B 351 -30.875 6.084 -7.527 1.00 41.64 O ANISOU14986 O LEU B 351 5753 4854 5214 -111 888 1250 O ATOM 14987 CB LEU B 351 -32.716 5.287 -5.305 1.00 35.83 C ANISOU14987 CB LEU B 351 4904 4187 4524 -83 1011 1418 C ATOM 14988 CG LEU B 351 -33.921 5.959 -5.953 1.00 36.20 C ANISOU14988 CG LEU B 351 4880 4298 4578 -36 1062 1471 C ATOM 14989 CD1 LEU B 351 -34.835 4.923 -6.565 1.00 47.52 C ANISOU14989 CD1 LEU B 351 6193 5733 6130 -116 1070 1554 C ATOM 14990 CD2 LEU B 351 -34.664 6.770 -4.917 1.00 36.61 C ANISOU14990 CD2 LEU B 351 4922 4420 4570 69 1134 1518 C ATOM 14991 H LEU B 351 -30.482 4.486 -4.819 1.00 51.51 H ATOM 14992 HA LEU B 351 -32.403 3.568 -6.386 1.00 43.81 H ATOM 14993 HB2 LEU B 351 -33.047 4.767 -4.556 1.00 43.00 H ATOM 14994 HB3 LEU B 351 -32.138 5.992 -4.975 1.00 43.00 H ATOM 14995 HG LEU B 351 -33.619 6.557 -6.655 1.00 43.45 H ATOM 14996 HD11 LEU B 351 -35.593 5.371 -6.970 1.00 57.02 H ATOM 14997 HD12 LEU B 351 -34.344 4.427 -7.238 1.00 57.02 H ATOM 14998 HD13 LEU B 351 -35.140 4.321 -5.868 1.00 57.02 H ATOM 14999 HD21 LEU B 351 -35.428 7.194 -5.338 1.00 43.94 H ATOM 15000 HD22 LEU B 351 -34.962 6.179 -4.208 1.00 43.94 H ATOM 15001 HD23 LEU B 351 -34.067 7.445 -4.557 1.00 43.94 H ATOM 15002 N ASP B 352 -32.049 4.504 -8.618 1.00 49.02 N ANISOU15002 N ASP B 352 6560 5756 6309 -222 900 1342 N ATOM 15003 CA ASP B 352 -31.878 5.119 -9.933 1.00 48.86 C ANISOU15003 CA ASP B 352 6555 5739 6269 -206 879 1305 C ATOM 15004 C ASP B 352 -33.066 6.036 -10.214 1.00 46.42 C ANISOU15004 C ASP B 352 6181 5517 5938 -141 939 1363 C ATOM 15005 O ASP B 352 -34.187 5.568 -10.411 1.00 46.38 O ANISOU15005 O ASP B 352 6064 5546 6010 -173 971 1451 O ATOM 15006 CB ASP B 352 -31.769 4.039 -11.016 1.00 50.70 C ANISOU15006 CB ASP B 352 6757 5903 6606 -296 840 1309 C ATOM 15007 CG ASP B 352 -31.492 4.614 -12.399 1.00 57.94 C ANISOU15007 CG ASP B 352 7694 6821 7498 -273 821 1275 C ATOM 15008 OD1 ASP B 352 -30.906 5.717 -12.492 1.00 64.10 O ANISOU15008 OD1 ASP B 352 8544 7637 8175 -198 816 1219 O ATOM 15009 OD2 ASP B 352 -31.852 3.951 -13.395 1.00 57.90 O ANISOU15009 OD2 ASP B 352 7631 6782 7589 -336 806 1307 O ATOM 15010 H ASP B 352 -32.488 3.765 -8.633 1.00 58.82 H ATOM 15011 HA ASP B 352 -31.067 5.650 -9.941 1.00 58.63 H ATOM 15012 HB2 ASP B 352 -31.043 3.438 -10.791 1.00 60.85 H ATOM 15013 HB3 ASP B 352 -32.605 3.549 -11.058 1.00 60.85 H ATOM 15014 N LEU B 353 -32.814 7.342 -10.219 1.00 22.42 N ANISOU15014 N LEU B 353 3203 2515 2800 -51 948 1316 N ATOM 15015 CA LEU B 353 -33.868 8.335 -10.398 1.00 22.92 C ANISOU15015 CA LEU B 353 3219 2662 2827 32 1005 1363 C ATOM 15016 C LEU B 353 -34.218 8.580 -11.855 1.00 22.91 C ANISOU15016 C LEU B 353 3173 2695 2838 34 1000 1379 C ATOM 15017 O LEU B 353 -33.366 8.469 -12.739 1.00 25.42 O ANISOU15017 O LEU B 353 3540 2968 3152 5 951 1323 O ATOM 15018 CB LEU B 353 -33.431 9.678 -9.822 1.00 22.39 C ANISOU15018 CB LEU B 353 3242 2606 2659 128 1014 1301 C ATOM 15019 CG LEU B 353 -33.194 9.813 -8.325 1.00 22.53 C ANISOU15019 CG LEU B 353 3306 2612 2642 159 1032 1292 C ATOM 15020 CD1 LEU B 353 -32.677 11.221 -8.055 1.00 24.64 C ANISOU15020 CD1 LEU B 353 3664 2875 2823 244 1031 1226 C ATOM 15021 CD2 LEU B 353 -34.466 9.522 -7.541 1.00 30.62 C ANISOU15021 CD2 LEU B 353 4246 3696 3693 189 1104 1392 C ATOM 15022 H LEU B 353 -32.031 7.682 -10.119 1.00 26.90 H ATOM 15023 HA LEU B 353 -34.669 8.046 -9.933 1.00 27.50 H ATOM 15024 HB2 LEU B 353 -32.599 9.925 -10.256 1.00 26.87 H ATOM 15025 HB3 LEU B 353 -34.110 10.331 -10.054 1.00 26.87 H ATOM 15026 HG LEU B 353 -32.513 9.179 -8.049 1.00 27.03 H ATOM 15027 HD11 LEU B 353 -32.521 11.322 -7.103 1.00 29.57 H ATOM 15028 HD12 LEU B 353 -31.848 11.351 -8.542 1.00 29.57 H ATOM 15029 HD13 LEU B 353 -33.341 11.863 -8.352 1.00 29.57 H ATOM 15030 HD21 LEU B 353 -34.282 9.616 -6.594 1.00 36.75 H ATOM 15031 HD22 LEU B 353 -35.153 10.153 -7.809 1.00 36.75 H ATOM 15032 HD23 LEU B 353 -34.755 8.616 -7.734 1.00 36.75 H ATOM 15033 N ALA B 354 -35.473 8.946 -12.093 1.00 25.61 N ANISOU15033 N ALA B 354 3415 3128 3188 77 1051 1461 N ATOM 15034 CA ALA B 354 -35.864 9.539 -13.362 1.00 27.73 C ANISOU15034 CA ALA B 354 3641 3461 3435 114 1053 1479 C ATOM 15035 C ALA B 354 -35.342 10.981 -13.341 1.00 27.07 C ANISOU15035 C ALA B 354 3665 3378 3241 223 1055 1399 C ATOM 15036 O ALA B 354 -34.971 11.478 -12.276 1.00 36.78 O ANISOU15036 O ALA B 354 4971 4575 4430 263 1064 1356 O ATOM 15037 CB ALA B 354 -37.374 9.503 -13.513 1.00 32.27 C ANISOU15037 CB ALA B 354 4059 4152 4051 128 1101 1597 C ATOM 15038 H ALA B 354 -36.119 8.861 -11.532 1.00 30.73 H ATOM 15039 HA ALA B 354 -35.455 9.060 -14.099 1.00 33.28 H ATOM 15040 HB1 ALA B 354 -37.616 9.902 -14.363 1.00 38.73 H ATOM 15041 HB2 ALA B 354 -37.671 8.580 -13.483 1.00 38.73 H ATOM 15042 HB3 ALA B 354 -37.776 10.004 -12.785 1.00 38.73 H ATOM 15043 N PRO B 355 -35.289 11.649 -14.511 1.00 23.11 N ANISOU15043 N PRO B 355 3167 2915 2699 267 1043 1383 N ATOM 15044 CA PRO B 355 -34.876 13.058 -14.615 1.00 22.77 C ANISOU15044 CA PRO B 355 3210 2870 2573 364 1041 1316 C ATOM 15045 C PRO B 355 -35.475 13.960 -13.518 1.00 23.41 C ANISOU15045 C PRO B 355 3308 2969 2618 454 1095 1328 C ATOM 15046 O PRO B 355 -36.692 14.131 -13.475 1.00 24.64 O ANISOU15046 O PRO B 355 3374 3211 2778 508 1149 1410 O ATOM 15047 CB PRO B 355 -35.413 13.460 -15.984 1.00 23.42 C ANISOU15047 CB PRO B 355 3227 3039 2633 408 1045 1352 C ATOM 15048 CG PRO B 355 -35.310 12.196 -16.797 1.00 22.62 C ANISOU15048 CG PRO B 355 3063 2942 2588 311 1014 1389 C ATOM 15049 CD PRO B 355 -35.506 11.046 -15.839 1.00 23.02 C ANISOU15049 CD PRO B 355 3076 2946 2724 219 1022 1428 C ATOM 15050 HA PRO B 355 -33.909 13.133 -14.609 1.00 27.33 H ATOM 15051 HB2 PRO B 355 -36.336 13.747 -15.905 1.00 28.11 H ATOM 15052 HB3 PRO B 355 -34.861 14.162 -16.363 1.00 28.11 H ATOM 15053 HG2 PRO B 355 -36.002 12.192 -17.476 1.00 27.14 H ATOM 15054 HG3 PRO B 355 -34.432 12.148 -17.208 1.00 27.14 H ATOM 15055 HD2 PRO B 355 -36.410 10.700 -15.908 1.00 27.62 H ATOM 15056 HD3 PRO B 355 -34.848 10.353 -16.005 1.00 27.62 H ATOM 15057 N PRO B 356 -34.630 14.521 -12.633 1.00 24.86 N ANISOU15057 N PRO B 356 3600 3079 2767 473 1081 1255 N ATOM 15058 CA PRO B 356 -35.106 15.259 -11.454 1.00 28.76 C ANISOU15058 CA PRO B 356 4124 3577 3226 558 1136 1268 C ATOM 15059 C PRO B 356 -35.480 16.721 -11.707 1.00 28.55 C ANISOU15059 C PRO B 356 4133 3570 3146 678 1170 1259 C ATOM 15060 O PRO B 356 -35.926 17.397 -10.779 1.00 32.93 O ANISOU15060 O PRO B 356 4719 4125 3667 765 1223 1273 O ATOM 15061 CB PRO B 356 -33.909 15.183 -10.502 1.00 26.01 C ANISOU15061 CB PRO B 356 3876 3142 2865 516 1098 1193 C ATOM 15062 CG PRO B 356 -32.741 15.153 -11.398 1.00 24.38 C ANISOU15062 CG PRO B 356 3712 2888 2663 456 1024 1123 C ATOM 15063 CD PRO B 356 -33.165 14.371 -12.616 1.00 24.42 C ANISOU15063 CD PRO B 356 3633 2937 2707 410 1013 1166 C ATOM 15064 HA PRO B 356 -35.861 14.800 -11.054 1.00 34.51 H ATOM 15065 HB2 PRO B 356 -33.890 15.968 -9.933 1.00 31.21 H ATOM 15066 HB3 PRO B 356 -33.960 14.372 -9.972 1.00 31.21 H ATOM 15067 HG2 PRO B 356 -32.498 16.059 -11.643 1.00 29.26 H ATOM 15068 HG3 PRO B 356 -32.001 14.712 -10.951 1.00 29.26 H ATOM 15069 HD2 PRO B 356 -32.776 14.757 -13.417 1.00 29.30 H ATOM 15070 HD3 PRO B 356 -32.922 13.437 -12.519 1.00 29.30 H ATOM 15071 N THR B 357 -35.309 17.193 -12.938 1.00 22.69 N ANISOU15071 N THR B 357 3384 2842 2394 691 1144 1240 N ATOM 15072 CA THR B 357 -35.644 18.569 -13.290 1.00 22.98 C ANISOU15072 CA THR B 357 3451 2893 2388 805 1175 1236 C ATOM 15073 C THR B 357 -36.310 18.583 -14.657 1.00 30.12 C ANISOU15073 C THR B 357 4261 3888 3296 828 1175 1285 C ATOM 15074 O THR B 357 -36.242 17.598 -15.392 1.00 30.99 O ANISOU15074 O THR B 357 4305 4033 3435 747 1141 1304 O ATOM 15075 CB THR B 357 -34.390 19.490 -13.318 1.00 24.50 C ANISOU15075 CB THR B 357 3765 2989 2553 806 1135 1143 C ATOM 15076 OG1 THR B 357 -33.580 19.191 -14.464 1.00 31.19 O ANISOU15076 OG1 THR B 357 4605 3830 3417 737 1070 1108 O ATOM 15077 CG2 THR B 357 -33.563 19.328 -12.048 1.00 21.90 C ANISOU15077 CG2 THR B 357 3522 2581 2219 764 1119 1093 C ATOM 15078 H THR B 357 -34.998 16.731 -13.594 1.00 27.22 H ATOM 15079 HA THR B 357 -36.271 18.924 -12.640 1.00 27.58 H ATOM 15080 HB THR B 357 -34.680 20.414 -13.369 1.00 29.39 H ATOM 15081 HG1 THR B 357 -32.904 19.690 -14.475 1.00 37.43 H ATOM 15082 HG21 THR B 357 -32.786 19.908 -12.083 1.00 26.28 H ATOM 15083 HG22 THR B 357 -34.097 19.561 -11.273 1.00 26.28 H ATOM 15084 HG23 THR B 357 -33.266 18.409 -11.962 1.00 26.28 H ATOM 15085 N LYS B 358 -36.953 19.697 -14.993 1.00 44.01 N ANISOU15085 N LYS B 358 6013 5687 5023 943 1215 1310 N ATOM 15086 CA LYS B 358 -37.577 19.852 -16.304 1.00 38.93 C ANISOU15086 CA LYS B 358 5277 5144 4372 980 1213 1358 C ATOM 15087 C LYS B 358 -36.525 19.834 -17.402 1.00 34.41 C ANISOU15087 C LYS B 358 4740 4540 3796 926 1147 1298 C ATOM 15088 O LYS B 358 -36.719 19.227 -18.455 1.00 32.03 O ANISOU15088 O LYS B 358 4356 4317 3496 895 1121 1330 O ATOM 15089 CB LYS B 358 -38.363 21.159 -16.374 1.00 33.57 C ANISOU15089 CB LYS B 358 4597 4500 3658 1126 1268 1392 C ATOM 15090 CG LYS B 358 -39.623 21.156 -15.542 1.00 43.92 C ANISOU15090 CG LYS B 358 5840 5879 4968 1201 1338 1475 C ATOM 15091 CD LYS B 358 -40.145 22.564 -15.295 1.00 45.65 C ANISOU15091 CD LYS B 358 6107 6090 5147 1357 1397 1490 C ATOM 15092 CE LYS B 358 -41.317 22.558 -14.323 1.00 48.01 C ANISOU15092 CE LYS B 358 6350 6451 5442 1442 1468 1573 C ATOM 15093 NZ LYS B 358 -42.466 21.780 -14.856 1.00 48.49 N ANISOU15093 NZ LYS B 358 6229 6668 5528 1428 1475 1680 N ATOM 15094 H LYS B 358 -37.043 20.380 -14.479 1.00 52.82 H ATOM 15095 HA LYS B 358 -38.191 19.117 -16.456 1.00 46.72 H ATOM 15096 HB2 LYS B 358 -37.799 21.881 -16.056 1.00 40.28 H ATOM 15097 HB3 LYS B 358 -38.617 21.322 -17.296 1.00 40.28 H ATOM 15098 HG2 LYS B 358 -40.312 20.656 -16.007 1.00 52.70 H ATOM 15099 HG3 LYS B 358 -39.436 20.748 -14.682 1.00 52.70 H ATOM 15100 HD2 LYS B 358 -39.436 23.106 -14.914 1.00 54.78 H ATOM 15101 HD3 LYS B 358 -40.446 22.946 -16.134 1.00 54.78 H ATOM 15102 HE2 LYS B 358 -41.038 22.152 -13.488 1.00 57.62 H ATOM 15103 HE3 LYS B 358 -41.612 23.469 -14.171 1.00 57.62 H ATOM 15104 HZ1 LYS B 358 -43.137 21.791 -14.272 1.00 58.19 H ATOM 15105 HZ2 LYS B 358 -42.744 22.136 -15.623 1.00 58.19 H ATOM 15106 HZ3 LYS B 358 -42.221 20.937 -15.001 1.00 58.19 H ATOM 15107 N LYS B 359 -35.412 20.511 -17.150 1.00 31.59 N ANISOU15107 N LYS B 359 4500 4075 3428 919 1120 1218 N ATOM 15108 CA LYS B 359 -34.333 20.597 -18.127 1.00 33.48 C ANISOU15108 CA LYS B 359 4773 4284 3666 874 1059 1164 C ATOM 15109 C LYS B 359 -33.756 19.213 -18.421 1.00 38.02 C ANISOU15109 C LYS B 359 5321 4859 4266 761 1007 1151 C ATOM 15110 O LYS B 359 -33.555 18.850 -19.583 1.00 32.62 O ANISOU15110 O LYS B 359 4597 4224 3574 745 973 1157 O ATOM 15111 CB LYS B 359 -33.236 21.538 -17.624 1.00 37.62 C ANISOU15111 CB LYS B 359 5416 4697 4184 873 1041 1091 C ATOM 15112 CG LYS B 359 -32.311 22.055 -18.719 1.00 41.13 C ANISOU15112 CG LYS B 359 5881 5125 4623 862 994 1056 C ATOM 15113 CD LYS B 359 -31.570 23.324 -18.304 1.00 44.07 C ANISOU15113 CD LYS B 359 6353 5407 4986 888 997 1012 C ATOM 15114 CE LYS B 359 -32.516 24.516 -18.117 1.00 51.08 C ANISOU15114 CE LYS B 359 7260 6301 5847 1015 1071 1047 C ATOM 15115 NZ LYS B 359 -33.488 24.694 -19.242 1.00 45.86 N ANISOU15115 NZ LYS B 359 6505 5745 5176 1096 1097 1110 N ATOM 15116 H LYS B 359 -35.255 20.933 -16.417 1.00 37.91 H ATOM 15117 HA LYS B 359 -34.684 20.959 -18.956 1.00 40.18 H ATOM 15118 HB2 LYS B 359 -33.653 22.305 -17.202 1.00 45.15 H ATOM 15119 HB3 LYS B 359 -32.691 21.063 -16.976 1.00 45.15 H ATOM 15120 HG2 LYS B 359 -31.651 21.374 -18.924 1.00 49.36 H ATOM 15121 HG3 LYS B 359 -32.837 22.257 -19.508 1.00 49.36 H ATOM 15122 HD2 LYS B 359 -31.115 23.166 -17.462 1.00 52.89 H ATOM 15123 HD3 LYS B 359 -30.927 23.556 -18.992 1.00 52.89 H ATOM 15124 HE2 LYS B 359 -33.026 24.386 -17.302 1.00 61.30 H ATOM 15125 HE3 LYS B 359 -31.988 25.327 -18.049 1.00 61.30 H ATOM 15126 HZ1 LYS B 359 -34.011 25.397 -19.083 1.00 55.03 H ATOM 15127 HZ2 LYS B 359 -33.049 24.827 -20.005 1.00 55.03 H ATOM 15128 HZ3 LYS B 359 -33.996 23.968 -19.323 1.00 55.03 H ATOM 15129 N LEU B 360 -33.507 18.439 -17.368 1.00 40.85 N ANISOU15129 N LEU B 360 5705 5166 4652 691 1003 1138 N ATOM 15130 CA LEU B 360 -32.943 17.097 -17.509 1.00 30.45 C ANISOU15130 CA LEU B 360 4373 3831 3365 586 960 1128 C ATOM 15131 C LEU B 360 -33.954 16.133 -18.106 1.00 33.71 C ANISOU15131 C LEU B 360 4674 4338 3795 569 981 1210 C ATOM 15132 O LEU B 360 -33.585 15.174 -18.789 1.00 35.99 O ANISOU15132 O LEU B 360 4942 4633 4100 505 946 1215 O ATOM 15133 CB LEU B 360 -32.474 16.567 -16.153 1.00 29.37 C ANISOU15133 CB LEU B 360 4285 3619 3255 524 954 1099 C ATOM 15134 CG LEU B 360 -31.088 17.044 -15.718 1.00 30.97 C ANISOU15134 CG LEU B 360 4584 3735 3449 495 906 1016 C ATOM 15135 CD1 LEU B 360 -30.869 16.824 -14.229 1.00 33.86 C ANISOU15135 CD1 LEU B 360 4991 4051 3823 469 914 1000 C ATOM 15136 CD2 LEU B 360 -30.022 16.323 -16.519 1.00 25.17 C ANISOU15136 CD2 LEU B 360 3854 2980 2731 422 841 981 C ATOM 15137 H LEU B 360 -33.656 18.669 -16.553 1.00 49.02 H ATOM 15138 HA LEU B 360 -32.175 17.135 -18.101 1.00 36.54 H ATOM 15139 HB2 LEU B 360 -33.107 16.850 -15.475 1.00 35.24 H ATOM 15140 HB3 LEU B 360 -32.451 15.598 -16.192 1.00 35.24 H ATOM 15141 HG LEU B 360 -31.009 17.994 -15.897 1.00 37.17 H ATOM 15142 HD11 LEU B 360 -29.982 17.138 -13.991 1.00 40.63 H ATOM 15143 HD12 LEU B 360 -31.540 17.320 -13.735 1.00 40.63 H ATOM 15144 HD13 LEU B 360 -30.948 15.877 -14.035 1.00 40.63 H ATOM 15145 HD21 LEU B 360 -29.149 16.634 -16.234 1.00 30.21 H ATOM 15146 HD22 LEU B 360 -30.101 15.369 -16.362 1.00 30.21 H ATOM 15147 HD23 LEU B 360 -30.151 16.516 -17.461 1.00 30.21 H HETATM15148 N MSE B 361 -35.229 16.384 -17.838 1.00 50.16 N ANISOU15148 N MSE B 361 6681 6500 5878 627 1037 1283 N HETATM15149 CA MSE B 361 -36.285 15.568 -18.408 1.00 49.42 C ANISOU15149 CA MSE B 361 6451 6521 5805 606 1056 1378 C HETATM15150 C MSE B 361 -36.372 15.791 -19.912 1.00 54.74 C ANISOU15150 C MSE B 361 7073 7289 6435 643 1031 1393 C HETATM15151 O MSE B 361 -36.581 14.852 -20.679 1.00 60.44 O ANISOU15151 O MSE B 361 7704 8073 7186 578 982 1399 O HETATM15152 CB MSE B 361 -37.625 15.885 -17.760 1.00 52.52 C ANISOU15152 CB MSE B 361 6759 6992 6206 668 1121 1457 C HETATM15153 CG MSE B 361 -38.707 14.919 -18.163 1.00 51.63 C ANISOU15153 CG MSE B 361 6478 7004 6137 617 1135 1567 C HETATM15154 SE MSE B 361 -40.466 15.460 -17.517 1.00 50.28 SE ANISOU15154 SE MSE B 361 6173 6962 5969 715 1214 1681 SE HETATM15155 CE MSE B 361 -41.608 14.459 -18.755 1.00 55.82 C ANISOU15155 CE MSE B 361 6627 7855 6726 631 1176 1782 C HETATM15156 H MSE B 361 -35.507 17.020 -17.329 1.00 60.19 H HETATM15157 HA MSE B 361 -36.086 14.633 -18.239 1.00 59.30 H HETATM15158 HB2 MSE B 361 -37.528 15.843 -16.795 1.00 63.03 H HETATM15159 HB3 MSE B 361 -37.902 16.776 -18.027 1.00 63.03 H HETATM15160 HG2 MSE B 361 -38.743 14.870 -19.131 1.00 61.96 H HETATM15161 HG3 MSE B 361 -38.506 14.045 -17.793 1.00 61.96 H HETATM15162 HE1 MSE B 361 -42.537 14.639 -18.543 1.00 66.98 H HETATM15163 HE2 MSE B 361 -41.414 14.742 -19.662 1.00 66.98 H HETATM15164 HE3 MSE B 361 -41.424 13.511 -18.658 1.00 66.98 H HETATM15165 N MSE B 362 -36.221 17.040 -20.331 1.00100.71 N ANISOU15165 N MSE B 362 12940 13116 12211 737 1032 1357 N HETATM15166 CA MSE B 362 -36.283 17.374 -21.745 1.00 97.74 C ANISOU15166 CA MSE B 362 12516 12837 11784 789 1006 1367 C HETATM15167 C MSE B 362 -35.063 16.800 -22.456 1.00102.92 C ANISOU15167 C MSE B 362 13230 13447 12426 731 944 1309 C HETATM15168 O MSE B 362 -35.162 16.325 -23.585 1.00104.12 O ANISOU15168 O MSE B 362 13307 13687 12567 720 883 1288 O HETATM15169 CB MSE B 362 -36.361 18.892 -21.929 1.00 99.31 C ANISOU15169 CB MSE B 362 12754 13029 11952 902 1026 1346 C HETATM15170 CG MSE B 362 -36.556 19.339 -23.373 1.00111.58 C ANISOU15170 CG MSE B 362 14245 14697 13453 972 1004 1365 C HETATM15171 SE MSE B 362 -35.255 20.663 -23.985 1.00132.44 SE ANISOU15171 SE MSE B 362 17002 17240 16081 1022 973 1283 SE HETATM15172 CE MSE B 362 -36.014 22.266 -23.167 1.00112.54 C ANISOU15172 CE MSE B 362 14515 14675 13570 1140 1050 1307 C HETATM15173 H MSE B 362 -36.082 17.714 -19.816 1.00120.86 H HETATM15174 HA MSE B 362 -37.085 16.983 -22.128 1.00117.29 H HETATM15175 HB2 MSE B 362 -37.109 19.230 -21.412 1.00119.18 H HETATM15176 HB3 MSE B 362 -35.535 19.287 -21.607 1.00119.18 H HETATM15177 HG2 MSE B 362 -36.483 18.564 -23.951 1.00133.89 H HETATM15178 HG3 MSE B 362 -37.439 19.731 -23.460 1.00133.89 H HETATM15179 HE1 MSE B 362 -35.456 23.028 -23.391 1.00135.05 H HETATM15180 HE2 MSE B 362 -36.911 22.400 -23.509 1.00135.05 H HETATM15181 HE3 MSE B 362 -36.040 22.147 -22.204 1.00135.05 H ATOM 15182 N TRP B 363 -33.919 16.828 -21.776 1.00 50.34 N ANISOU15182 N TRP B 363 6686 6646 5795 681 922 1233 N ATOM 15183 CA TRP B 363 -32.679 16.284 -22.326 1.00 40.35 C ANISOU15183 CA TRP B 363 5479 5329 4525 629 865 1179 C ATOM 15184 C TRP B 363 -32.829 14.795 -22.636 1.00 48.80 C ANISOU15184 C TRP B 363 6485 6425 5631 545 820 1174 C ATOM 15185 O TRP B 363 -32.519 14.351 -23.742 1.00 61.57 O ANISOU15185 O TRP B 363 8065 8086 7244 532 740 1108 O ATOM 15186 CB TRP B 363 -31.511 16.502 -21.359 1.00 41.81 C ANISOU15186 CB TRP B 363 5769 5373 4744 577 843 1102 C ATOM 15187 CG TRP B 363 -31.037 17.927 -21.275 1.00 48.97 C ANISOU15187 CG TRP B 363 6729 6239 5639 630 841 1059 C ATOM 15188 CD1 TRP B 363 -31.552 19.006 -21.934 1.00 47.10 C ANISOU15188 CD1 TRP B 363 6465 6059 5373 721 864 1082 C ATOM 15189 CD2 TRP B 363 -29.952 18.424 -20.482 1.00 50.76 C ANISOU15189 CD2 TRP B 363 7038 6363 5885 591 817 997 C ATOM 15190 NE1 TRP B 363 -30.854 20.143 -21.602 1.00 48.74 N ANISOU15190 NE1 TRP B 363 6742 6191 5586 739 860 1039 N ATOM 15191 CE2 TRP B 363 -29.864 19.811 -20.711 1.00 50.14 C ANISOU15191 CE2 TRP B 363 6984 6276 5790 657 829 988 C ATOM 15192 CE3 TRP B 363 -29.042 17.829 -19.599 1.00 54.32 C ANISOU15192 CE3 TRP B 363 7537 6736 6365 508 784 953 C ATOM 15193 CZ2 TRP B 363 -28.907 20.614 -20.094 1.00 54.83 C ANISOU15193 CZ2 TRP B 363 7652 6787 6396 635 810 940 C ATOM 15194 CZ3 TRP B 363 -28.087 18.627 -18.987 1.00 52.95 C ANISOU15194 CZ3 TRP B 363 7426 6495 6197 492 761 905 C ATOM 15195 CH2 TRP B 363 -28.027 20.003 -19.238 1.00 55.26 C ANISOU15195 CH2 TRP B 363 7744 6780 6472 551 774 900 C ATOM 15196 H TRP B 363 -33.834 17.158 -20.986 1.00 60.41 H ATOM 15197 HA TRP B 363 -32.473 16.744 -23.155 1.00 48.42 H ATOM 15198 HB2 TRP B 363 -31.789 16.230 -20.470 1.00 50.17 H ATOM 15199 HB3 TRP B 363 -30.762 15.958 -21.648 1.00 50.17 H ATOM 15200 HD1 TRP B 363 -32.271 18.976 -22.522 1.00 56.52 H ATOM 15201 HE1 TRP B 363 -31.011 20.933 -21.904 1.00 58.49 H ATOM 15202 HE3 TRP B 363 -29.074 16.915 -19.431 1.00 65.18 H ATOM 15203 HZ2 TRP B 363 -28.865 21.528 -20.258 1.00 65.80 H ATOM 15204 HZ3 TRP B 363 -27.478 18.242 -18.399 1.00 63.54 H ATOM 15205 HH2 TRP B 363 -27.379 20.515 -18.811 1.00 66.31 H ATOM 15206 N LYS B 364 -33.310 14.031 -21.659 1.00 34.14 N ANISOU15206 N LYS B 364 4599 4530 3842 474 836 1195 N ATOM 15207 CA LYS B 364 -33.539 12.597 -21.841 1.00 34.09 C ANISOU15207 CA LYS B 364 4511 4518 3922 365 757 1142 C ATOM 15208 C LYS B 364 -34.497 12.310 -23.001 1.00 40.26 C ANISOU15208 C LYS B 364 5152 5429 4716 365 684 1113 C ATOM 15209 O LYS B 364 -34.342 11.317 -23.711 1.00 51.59 O ANISOU15209 O LYS B 364 6547 6864 6193 297 586 1030 O ATOM 15210 CB LYS B 364 -34.080 11.972 -20.551 1.00 39.95 C ANISOU15210 CB LYS B 364 5230 5212 4737 300 802 1198 C ATOM 15211 CG LYS B 364 -34.323 10.467 -20.637 1.00 40.34 C ANISOU15211 CG LYS B 364 5200 5236 4893 177 721 1154 C ATOM 15212 CD LYS B 364 -34.767 9.902 -19.297 1.00 51.43 C ANISOU15212 CD LYS B 364 6585 6588 6368 117 777 1229 C ATOM 15213 CE LYS B 364 -35.192 8.440 -19.394 1.00 58.00 C ANISOU15213 CE LYS B 364 7321 7394 7322 -9 698 1202 C ATOM 15214 NZ LYS B 364 -34.048 7.485 -19.329 1.00 60.05 N ANISOU15214 NZ LYS B 364 7667 7525 7622 -81 645 1126 N ATOM 15215 H LYS B 364 -33.513 14.319 -20.875 1.00 40.97 H ATOM 15216 HA LYS B 364 -32.692 12.170 -22.044 1.00 40.90 H ATOM 15217 HB2 LYS B 364 -33.440 12.128 -19.838 1.00 47.94 H ATOM 15218 HB3 LYS B 364 -34.924 12.395 -20.330 1.00 47.94 H ATOM 15219 HG2 LYS B 364 -35.020 10.291 -21.288 1.00 48.41 H ATOM 15220 HG3 LYS B 364 -33.500 10.023 -20.897 1.00 48.41 H ATOM 15221 HD2 LYS B 364 -34.031 9.961 -18.668 1.00 61.71 H ATOM 15222 HD3 LYS B 364 -35.524 10.414 -18.972 1.00 61.71 H ATOM 15223 HE2 LYS B 364 -35.790 8.237 -18.658 1.00 69.60 H ATOM 15224 HE3 LYS B 364 -35.648 8.301 -20.238 1.00 69.60 H ATOM 15225 HZ1 LYS B 364 -34.347 6.649 -19.390 1.00 72.05 H ATOM 15226 HZ2 LYS B 364 -33.484 7.641 -20.000 1.00 72.05 H ATOM 15227 HZ3 LYS B 364 -33.614 7.583 -18.558 1.00 72.05 H ATOM 15228 N GLU B 365 -35.490 13.174 -23.182 1.00 57.19 N ANISOU15228 N GLU B 365 7224 7683 6821 444 730 1180 N ATOM 15229 CA GLU B 365 -36.447 13.032 -24.275 1.00 62.77 C ANISOU15229 CA GLU B 365 7791 8530 7528 454 663 1164 C ATOM 15230 C GLU B 365 -35.772 13.269 -25.622 1.00 65.81 C ANISOU15230 C GLU B 365 8200 8961 7845 503 595 1086 C ATOM 15231 O GLU B 365 -36.063 12.577 -26.602 1.00 69.54 O ANISOU15231 O GLU B 365 8588 9502 8330 467 493 1015 O ATOM 15232 CB GLU B 365 -37.600 14.025 -24.093 1.00 64.03 C ANISOU15232 CB GLU B 365 7875 8802 7651 547 743 1270 C ATOM 15233 CG GLU B 365 -38.599 14.066 -25.246 1.00 71.76 C ANISOU15233 CG GLU B 365 8704 9947 8614 575 680 1267 C ATOM 15234 CD GLU B 365 -39.508 15.281 -25.184 1.00 77.92 C ANISOU15234 CD GLU B 365 9435 10838 9334 702 771 1376 C ATOM 15235 OE1 GLU B 365 -39.613 15.996 -26.207 1.00 70.66 O ANISOU15235 OE1 GLU B 365 8489 10018 8341 793 756 1374 O ATOM 15236 OE2 GLU B 365 -40.113 15.521 -24.115 1.00 76.85 O ANISOU15236 OE2 GLU B 365 9288 10693 9220 720 861 1467 O ATOM 15237 H GLU B 365 -35.633 13.858 -22.680 1.00 68.62 H ATOM 15238 HA GLU B 365 -36.812 12.134 -24.268 1.00 75.32 H ATOM 15239 HB2 GLU B 365 -38.089 13.788 -23.290 1.00 76.83 H ATOM 15240 HB3 GLU B 365 -37.228 14.916 -23.996 1.00 76.83 H ATOM 15241 HG2 GLU B 365 -38.114 14.096 -26.086 1.00 86.11 H ATOM 15242 HG3 GLU B 365 -39.156 13.272 -25.211 1.00 86.11 H ATOM 15243 N THR B 366 -34.871 14.248 -25.654 1.00 53.04 N ANISOU15243 N THR B 366 6696 7303 6153 586 650 1103 N ATOM 15244 CA THR B 366 -34.299 14.744 -26.903 1.00 47.71 C ANISOU15244 CA THR B 366 6037 6690 5400 661 612 1064 C ATOM 15245 C THR B 366 -32.818 14.375 -27.029 1.00 47.13 C ANISOU15245 C THR B 366 6077 6515 5317 633 581 999 C ATOM 15246 O THR B 366 -32.096 14.929 -27.859 1.00 44.49 O ANISOU15246 O THR B 366 5781 6210 4913 703 572 989 O ATOM 15247 CB THR B 366 -34.524 16.287 -27.037 1.00 48.42 C ANISOU15247 CB THR B 366 6150 6836 5411 792 699 1154 C ATOM 15248 OG1 THR B 366 -34.489 16.667 -28.416 1.00 56.04 O ANISOU15248 OG1 THR B 366 7069 7918 6307 869 653 1132 O ATOM 15249 CG2 THR B 366 -33.498 17.119 -26.239 1.00 35.81 C ANISOU15249 CG2 THR B 366 4707 5110 3791 823 779 1195 C ATOM 15250 H THR B 366 -34.570 14.647 -24.954 1.00 63.64 H ATOM 15251 HA THR B 366 -34.765 14.320 -27.640 1.00 57.25 H ATOM 15252 HB THR B 366 -35.402 16.499 -26.685 1.00 58.10 H ATOM 15253 HG1 THR B 366 -34.609 17.495 -28.489 1.00 67.25 H ATOM 15254 HG21 THR B 366 -33.677 18.065 -26.353 1.00 42.98 H ATOM 15255 HG22 THR B 366 -33.555 16.898 -25.296 1.00 42.98 H ATOM 15256 HG23 THR B 366 -32.600 16.928 -26.553 1.00 42.98 H ATOM 15257 N GLY B 367 -32.383 13.416 -26.216 1.00 64.20 N ANISOU15257 N GLY B 367 8281 8562 7549 533 566 966 N ATOM 15258 CA GLY B 367 -31.005 12.963 -26.228 1.00 61.14 C ANISOU15258 CA GLY B 367 7994 8079 7159 504 539 912 C ATOM 15259 C GLY B 367 -30.857 11.644 -26.957 1.00 68.53 C ANISOU15259 C GLY B 367 8890 9019 8130 443 432 806 C ATOM 15260 O GLY B 367 -31.848 11.032 -27.363 1.00 67.76 O ANISOU15260 O GLY B 367 8690 8986 8068 405 371 770 O ATOM 15261 H GLY B 367 -32.878 13.008 -25.642 1.00 77.04 H ATOM 15262 HA2 GLY B 367 -30.449 13.625 -26.668 1.00 73.37 H ATOM 15263 HA3 GLY B 367 -30.691 12.851 -25.317 1.00 73.37 H ATOM 15264 N GLY B 368 -29.609 11.210 -27.112 1.00 56.11 N ANISOU15264 N GLY B 368 7400 7375 6545 434 406 757 N ATOM 15265 CA GLY B 368 -29.291 9.999 -27.846 1.00 60.44 C ANISOU15265 CA GLY B 368 7937 7916 7112 396 307 649 C ATOM 15266 C GLY B 368 -28.768 10.332 -29.228 1.00 59.11 C ANISOU15266 C GLY B 368 7768 7845 6846 493 265 604 C ATOM 15267 O GLY B 368 -29.031 11.413 -29.755 1.00 57.11 O ANISOU15267 O GLY B 368 7487 7691 6523 580 299 657 O ATOM 15268 H GLY B 368 -28.918 11.611 -26.794 1.00 67.33 H ATOM 15269 HA2 GLY B 368 -28.615 9.493 -27.369 1.00 72.53 H ATOM 15270 HA3 GLY B 368 -30.087 9.451 -27.936 1.00 72.53 H ATOM 15271 N VAL B 369 -28.029 9.404 -29.824 1.00 51.16 N ANISOU15271 N VAL B 369 6795 6813 5831 488 195 513 N ATOM 15272 CA VAL B 369 -27.385 9.672 -31.102 1.00 50.76 C ANISOU15272 CA VAL B 369 6753 6856 5676 593 162 475 C ATOM 15273 C VAL B 369 -28.419 9.903 -32.197 1.00 52.77 C ANISOU15273 C VAL B 369 6910 7264 5879 647 106 441 C ATOM 15274 O VAL B 369 -28.226 10.746 -33.072 1.00 52.48 O ANISOU15274 O VAL B 369 6857 7338 5744 755 121 471 O ATOM 15275 CB VAL B 369 -26.411 8.539 -31.524 1.00 49.57 C ANISOU15275 CB VAL B 369 6663 6652 5522 590 98 377 C ATOM 15276 CG1 VAL B 369 -25.444 8.236 -30.402 1.00 47.88 C ANISOU15276 CG1 VAL B 369 6535 6293 5363 533 149 416 C ATOM 15277 CG2 VAL B 369 -27.155 7.270 -31.936 1.00 51.58 C ANISOU15277 CG2 VAL B 369 6875 6898 5825 528 -12 254 C ATOM 15278 H VAL B 369 -27.886 8.616 -29.511 1.00 61.39 H ATOM 15279 HA VAL B 369 -26.864 10.486 -31.018 1.00 60.91 H ATOM 15280 HB VAL B 369 -25.894 8.840 -32.287 1.00 59.49 H ATOM 15281 HG11 VAL B 369 -24.846 7.527 -30.684 1.00 57.45 H ATOM 15282 HG12 VAL B 369 -24.936 9.037 -30.198 1.00 57.45 H ATOM 15283 HG13 VAL B 369 -25.946 7.955 -29.621 1.00 57.45 H ATOM 15284 HG21 VAL B 369 -26.508 6.594 -32.190 1.00 61.89 H ATOM 15285 HG22 VAL B 369 -27.685 6.957 -31.186 1.00 61.89 H ATOM 15286 HG23 VAL B 369 -27.733 7.474 -32.688 1.00 61.89 H ATOM 15287 N GLU B 370 -29.518 9.159 -32.140 1.00 54.49 N ANISOU15287 N GLU B 370 7054 7488 6162 569 40 386 N ATOM 15288 CA GLU B 370 -30.563 9.258 -33.153 1.00 60.38 C ANISOU15288 CA GLU B 370 7696 8382 6864 606 -29 347 C ATOM 15289 C GLU B 370 -31.175 10.655 -33.208 1.00 66.47 C ANISOU15289 C GLU B 370 8410 9263 7583 683 48 461 C ATOM 15290 O GLU B 370 -31.186 11.294 -34.260 1.00 67.02 O ANISOU15290 O GLU B 370 8448 9465 7552 791 38 466 O ATOM 15291 CB GLU B 370 -31.662 8.229 -32.886 1.00 72.01 C ANISOU15291 CB GLU B 370 9094 9829 8439 485 -111 287 C ATOM 15292 CG GLU B 370 -31.210 6.785 -33.030 1.00 85.31 C ANISOU15292 CG GLU B 370 10829 11410 10176 412 -208 159 C ATOM 15293 CD GLU B 370 -32.374 5.820 -33.154 1.00 93.01 C ANISOU15293 CD GLU B 370 11714 12386 11238 303 -318 86 C ATOM 15294 OE1 GLU B 370 -33.469 6.134 -32.640 1.00 94.01 O ANISOU15294 OE1 GLU B 370 11743 12553 11422 250 -294 163 O ATOM 15295 OE2 GLU B 370 -32.195 4.749 -33.773 1.00 96.48 O ANISOU15295 OE2 GLU B 370 12182 12789 11688 274 -431 -46 O ATOM 15296 H GLU B 370 -29.683 8.585 -31.521 1.00 65.39 H ATOM 15297 HA GLU B 370 -30.178 9.066 -34.022 1.00 72.46 H ATOM 15298 HB2 GLU B 370 -31.986 8.348 -31.980 1.00 86.42 H ATOM 15299 HB3 GLU B 370 -32.385 8.376 -33.515 1.00 86.42 H ATOM 15300 HG2 GLU B 370 -30.664 6.702 -33.827 1.00102.37 H ATOM 15301 HG3 GLU B 370 -30.694 6.535 -32.247 1.00102.37 H ATOM 15302 N LYS B 371 -31.689 11.117 -32.073 1.00 49.85 N ANISOU15302 N LYS B 371 6295 7102 5542 637 129 555 N ATOM 15303 CA LYS B 371 -32.322 12.429 -31.994 1.00 47.64 C ANISOU15303 CA LYS B 371 5972 6908 5221 713 211 666 C ATOM 15304 C LYS B 371 -31.337 13.559 -32.291 1.00 51.50 C ANISOU15304 C LYS B 371 6537 7406 5624 822 283 731 C ATOM 15305 O LYS B 371 -31.702 14.564 -32.903 1.00 55.23 O ANISOU15305 O LYS B 371 6968 7990 6027 921 315 792 O ATOM 15306 CB LYS B 371 -32.927 12.632 -30.605 1.00 46.67 C ANISOU15306 CB LYS B 371 5845 6706 5181 649 289 750 C ATOM 15307 CG LYS B 371 -34.382 12.211 -30.481 1.00 46.70 C ANISOU15307 CG LYS B 371 5719 6779 5244 591 252 756 C ATOM 15308 CD LYS B 371 -35.309 13.210 -31.147 1.00 52.69 C ANISOU15308 CD LYS B 371 6384 7702 5935 691 274 820 C ATOM 15309 CE LYS B 371 -36.752 12.989 -30.732 1.00 54.71 C ANISOU15309 CE LYS B 371 6510 8023 6256 638 268 867 C ATOM 15310 NZ LYS B 371 -37.644 14.055 -31.266 1.00 53.87 N ANISOU15310 NZ LYS B 371 6313 8075 6079 747 306 948 N ATOM 15311 H LYS B 371 -31.683 10.687 -31.329 1.00 59.82 H ATOM 15312 HA LYS B 371 -33.039 12.475 -32.645 1.00 57.17 H ATOM 15313 HB2 LYS B 371 -32.416 12.114 -29.965 1.00 56.01 H ATOM 15314 HB3 LYS B 371 -32.874 13.574 -30.379 1.00 56.01 H ATOM 15315 HG2 LYS B 371 -34.504 11.350 -30.912 1.00 56.03 H ATOM 15316 HG3 LYS B 371 -34.620 12.154 -29.543 1.00 56.03 H ATOM 15317 HD2 LYS B 371 -35.051 14.108 -30.886 1.00 63.23 H ATOM 15318 HD3 LYS B 371 -35.250 13.109 -32.110 1.00 63.23 H ATOM 15319 HE2 LYS B 371 -37.058 12.136 -31.078 1.00 65.66 H ATOM 15320 HE3 LYS B 371 -36.812 13.000 -29.764 1.00 65.66 H ATOM 15321 HZ1 LYS B 371 -38.483 13.906 -31.010 1.00 64.64 H ATOM 15322 HZ2 LYS B 371 -37.385 14.850 -30.958 1.00 64.64 H ATOM 15323 HZ3 LYS B 371 -37.609 14.064 -32.155 1.00 64.64 H ATOM 15324 N LEU B 372 -30.094 13.393 -31.848 1.00 52.58 N ANISOU15324 N LEU B 372 6781 7426 5772 801 308 726 N ATOM 15325 CA LEU B 372 -29.074 14.428 -32.009 1.00 51.40 C ANISOU15325 CA LEU B 372 6704 7267 5559 884 375 799 C ATOM 15326 C LEU B 372 -28.695 14.673 -33.469 1.00 55.47 C ANISOU15326 C LEU B 372 7190 7914 5971 993 335 778 C ATOM 15327 O LEU B 372 -28.520 15.819 -33.880 1.00 57.99 O ANISOU15327 O LEU B 372 7511 8293 6230 1086 391 864 O ATOM 15328 CB LEU B 372 -27.818 14.073 -31.211 1.00 52.14 C ANISOU15328 CB LEU B 372 6905 7215 5690 827 398 798 C ATOM 15329 CG LEU B 372 -27.676 14.717 -29.830 1.00 45.92 C ANISOU15329 CG LEU B 372 6187 6308 4952 783 486 882 C ATOM 15330 CD1 LEU B 372 -28.964 14.632 -29.018 1.00 55.22 C ANISOU15330 CD1 LEU B 372 7315 7477 6189 734 508 899 C ATOM 15331 CD2 LEU B 372 -26.530 14.064 -29.074 1.00 40.41 C ANISOU15331 CD2 LEU B 372 5579 5480 4297 712 485 862 C ATOM 15332 H LEU B 372 -29.813 12.686 -31.448 1.00 63.10 H ATOM 15333 HA LEU B 372 -29.422 15.261 -31.654 1.00 61.68 H ATOM 15334 HB2 LEU B 372 -27.803 13.112 -31.082 1.00 62.56 H ATOM 15335 HB3 LEU B 372 -27.044 14.338 -31.731 1.00 62.56 H ATOM 15336 HG LEU B 372 -27.459 15.656 -29.943 1.00 55.10 H ATOM 15337 HD11 LEU B 372 -28.822 15.053 -28.156 1.00 66.26 H ATOM 15338 HD12 LEU B 372 -29.670 15.092 -29.499 1.00 66.26 H ATOM 15339 HD13 LEU B 372 -29.199 13.699 -28.897 1.00 66.26 H ATOM 15340 HD21 LEU B 372 -26.450 14.480 -28.201 1.00 48.50 H ATOM 15341 HD22 LEU B 372 -26.717 13.117 -28.974 1.00 48.50 H ATOM 15342 HD23 LEU B 372 -25.709 14.188 -29.576 1.00 48.50 H ATOM 15343 N PHE B 373 -28.550 13.601 -34.243 1.00 62.62 N ANISOU15343 N PHE B 373 8074 8861 6856 986 241 665 N ATOM 15344 CA PHE B 373 -28.186 13.724 -35.656 1.00 64.87 C ANISOU15344 CA PHE B 373 8334 9283 7031 1099 198 636 C ATOM 15345 C PHE B 373 -29.353 14.174 -36.542 1.00 64.57 C ANISOU15345 C PHE B 373 8188 9412 6933 1169 167 640 C ATOM 15346 O PHE B 373 -29.172 14.398 -37.739 1.00 64.43 O ANISOU15346 O PHE B 373 8140 9529 6812 1277 137 627 O ATOM 15347 CB PHE B 373 -27.630 12.398 -36.185 1.00 58.51 C ANISOU15347 CB PHE B 373 7555 8462 6212 1081 104 503 C ATOM 15348 CG PHE B 373 -26.171 12.184 -35.888 1.00 53.44 C ANISOU15348 CG PHE B 373 7011 7723 5571 1084 136 516 C ATOM 15349 CD1 PHE B 373 -25.200 12.872 -36.597 1.00 59.32 C ANISOU15349 CD1 PHE B 373 7777 8537 6224 1196 175 579 C ATOM 15350 CD2 PHE B 373 -25.770 11.280 -34.917 1.00 56.83 C ANISOU15350 CD2 PHE B 373 7502 8000 6091 977 129 474 C ATOM 15351 CE1 PHE B 373 -23.856 12.672 -36.334 1.00 61.06 C ANISOU15351 CE1 PHE B 373 8074 8680 6445 1198 204 602 C ATOM 15352 CE2 PHE B 373 -24.430 11.074 -34.653 1.00 58.91 C ANISOU15352 CE2 PHE B 373 7847 8186 6351 984 157 492 C ATOM 15353 CZ PHE B 373 -23.471 11.772 -35.360 1.00 57.58 C ANISOU15353 CZ PHE B 373 7693 8091 6092 1092 194 557 C ATOM 15354 H PHE B 373 -28.657 12.790 -33.977 1.00 75.14 H ATOM 15355 HA PHE B 373 -27.485 14.389 -35.736 1.00 77.84 H ATOM 15356 HB2 PHE B 373 -28.125 11.669 -35.779 1.00 70.21 H ATOM 15357 HB3 PHE B 373 -27.743 12.375 -37.148 1.00 70.21 H ATOM 15358 HD1 PHE B 373 -25.454 13.480 -37.253 1.00 71.18 H ATOM 15359 HD2 PHE B 373 -26.411 10.808 -34.437 1.00 68.19 H ATOM 15360 HE1 PHE B 373 -23.213 13.142 -36.813 1.00 73.27 H ATOM 15361 HE2 PHE B 373 -24.174 10.468 -33.995 1.00 70.70 H ATOM 15362 HZ PHE B 373 -22.569 11.636 -35.182 1.00 69.09 H ATOM 15363 N SER B 374 -30.539 14.309 -35.950 1.00 54.93 N ANISOU15363 N SER B 374 6906 8194 5773 1114 178 666 N ATOM 15364 CA SER B 374 -31.759 14.607 -36.701 1.00 50.79 C ANISOU15364 CA SER B 374 6264 7832 5204 1165 140 670 C ATOM 15365 C SER B 374 -32.445 15.904 -36.259 1.00 48.55 C ANISOU15365 C SER B 374 5946 7580 4921 1215 241 807 C ATOM 15366 O SER B 374 -33.588 16.164 -36.638 1.00 53.13 O ANISOU15366 O SER B 374 6421 8285 5481 1247 223 828 O ATOM 15367 CB SER B 374 -32.729 13.432 -36.571 1.00 51.99 C ANISOU15367 CB SER B 374 6345 7984 5424 1055 39 569 C ATOM 15368 OG SER B 374 -32.778 12.971 -35.234 1.00 54.00 O ANISOU15368 OG SER B 374 6639 8081 5799 933 73 581 O ATOM 15369 H SER B 374 -30.665 14.232 -35.103 1.00 65.92 H ATOM 15370 HA SER B 374 -31.531 14.700 -37.640 1.00 60.95 H ATOM 15371 HB2 SER B 374 -33.616 13.722 -36.837 1.00 62.39 H ATOM 15372 HB3 SER B 374 -32.430 12.709 -37.144 1.00 62.39 H ATOM 15373 HG SER B 374 -33.035 13.589 -34.726 1.00 64.80 H ATOM 15374 N LEU B 375 -31.750 16.712 -35.462 1.00 40.55 N ANISOU15374 N LEU B 375 5023 6454 3930 1225 344 899 N ATOM 15375 CA LEU B 375 -32.279 18.005 -35.023 1.00 39.35 C ANISOU15375 CA LEU B 375 4865 6311 3775 1285 446 1026 C ATOM 15376 C LEU B 375 -31.217 19.103 -35.066 1.00 38.86 C ANISOU15376 C LEU B 375 4881 6169 3714 1340 518 1087 C ATOM 15377 O LEU B 375 -30.021 18.817 -34.977 1.00 41.00 O ANISOU15377 O LEU B 375 5224 6341 4012 1300 508 1048 O ATOM 15378 CB LEU B 375 -32.827 17.902 -33.600 1.00 42.30 C ANISOU15378 CB LEU B 375 5259 6566 4245 1194 495 1053 C ATOM 15379 CG LEU B 375 -34.055 17.015 -33.388 1.00 36.71 C ANISOU15379 CG LEU B 375 4446 5909 3594 1116 435 1003 C ATOM 15380 CD1 LEU B 375 -34.378 16.924 -31.906 1.00 34.16 C ANISOU15380 CD1 LEU B 375 4159 5460 3362 1034 498 1044 C ATOM 15381 CD2 LEU B 375 -35.255 17.539 -34.165 1.00 40.85 C ANISOU15381 CD2 LEU B 375 4843 6613 4066 1199 424 1046 C ATOM 15382 H LEU B 375 -30.964 16.535 -35.159 1.00 48.66 H ATOM 15383 HA LEU B 375 -33.007 18.266 -35.609 1.00 47.22 H ATOM 15384 HB2 LEU B 375 -32.123 17.554 -33.030 1.00 50.76 H ATOM 15385 HB3 LEU B 375 -33.065 18.794 -33.303 1.00 50.76 H ATOM 15386 HG LEU B 375 -33.858 16.120 -33.708 1.00 44.05 H ATOM 15387 HD11 LEU B 375 -35.157 16.359 -31.787 1.00 40.99 H ATOM 15388 HD12 LEU B 375 -33.617 16.541 -31.441 1.00 40.99 H ATOM 15389 HD13 LEU B 375 -34.559 17.815 -31.568 1.00 40.99 H ATOM 15390 HD21 LEU B 375 -36.013 16.953 -34.007 1.00 49.02 H ATOM 15391 HD22 LEU B 375 -35.461 18.436 -33.860 1.00 49.02 H ATOM 15392 HD23 LEU B 375 -35.038 17.552 -35.110 1.00 49.02 H ATOM 15393 N PRO B 376 -31.651 20.371 -35.184 1.00 47.60 N ANISOU15393 N PRO B 376 5951 7275 4860 1398 576 1140 N ATOM 15394 CA PRO B 376 -30.689 21.481 -35.207 1.00 47.86 C ANISOU15394 CA PRO B 376 6031 7187 4968 1408 621 1150 C ATOM 15395 C PRO B 376 -29.945 21.620 -33.881 1.00 52.40 C ANISOU15395 C PRO B 376 6712 7561 5636 1308 653 1138 C ATOM 15396 O PRO B 376 -30.396 21.094 -32.863 1.00 58.36 O ANISOU15396 O PRO B 376 7498 8264 6412 1246 662 1136 O ATOM 15397 CB PRO B 376 -31.568 22.718 -35.442 1.00 50.80 C ANISOU15397 CB PRO B 376 6345 7605 5353 1493 675 1212 C ATOM 15398 CG PRO B 376 -32.913 22.196 -35.858 1.00 47.03 C ANISOU15398 CG PRO B 376 5767 7309 4794 1542 647 1233 C ATOM 15399 CD PRO B 376 -33.044 20.847 -35.248 1.00 48.20 C ANISOU15399 CD PRO B 376 5939 7462 4914 1457 601 1198 C ATOM 15400 HA PRO B 376 -30.056 21.379 -35.936 1.00 57.44 H ATOM 15401 HB2 PRO B 376 -31.640 23.226 -34.620 1.00 60.97 H ATOM 15402 HB3 PRO B 376 -31.182 23.261 -36.147 1.00 60.97 H ATOM 15403 HG2 PRO B 376 -33.607 22.787 -35.525 1.00 56.44 H ATOM 15404 HG3 PRO B 376 -32.953 22.136 -36.825 1.00 56.44 H ATOM 15405 HD2 PRO B 376 -33.420 20.914 -34.356 1.00 57.85 H ATOM 15406 HD3 PRO B 376 -33.574 20.268 -35.817 1.00 57.85 H ATOM 15407 N ALA B 377 -28.816 22.320 -33.898 1.00 44.85 N ANISOU15407 N ALA B 377 5803 6505 4733 1289 667 1130 N ATOM 15408 CA ALA B 377 -28.061 22.584 -32.679 1.00 44.84 C ANISOU15408 CA ALA B 377 5895 6329 4812 1194 685 1112 C ATOM 15409 C ALA B 377 -28.674 23.787 -31.959 1.00 46.17 C ANISOU15409 C ALA B 377 6086 6430 5028 1211 741 1144 C ATOM 15410 O ALA B 377 -28.588 23.905 -30.737 1.00 47.88 O ANISOU15410 O ALA B 377 6372 6528 5292 1144 757 1127 O ATOM 15411 CB ALA B 377 -26.588 22.828 -33.005 1.00 45.26 C ANISOU15411 CB ALA B 377 5979 6325 4893 1161 668 1095 C ATOM 15412 H ALA B 377 -28.463 22.655 -34.607 1.00 53.82 H ATOM 15413 HA ALA B 377 -28.120 21.814 -32.092 1.00 53.81 H ATOM 15414 HB1 ALA B 377 -26.107 23.001 -32.180 1.00 54.31 H ATOM 15415 HB2 ALA B 377 -26.227 22.040 -33.440 1.00 54.31 H ATOM 15416 HB3 ALA B 377 -26.518 23.594 -33.596 1.00 54.31 H ATOM 15417 N GLN B 378 -29.291 24.675 -32.738 1.00 44.79 N ANISOU15417 N GLN B 378 5852 6336 4832 1310 771 1189 N ATOM 15418 CA GLN B 378 -30.065 25.796 -32.209 1.00 41.83 C ANISOU15418 CA GLN B 378 5488 5920 4485 1356 830 1226 C ATOM 15419 C GLN B 378 -31.544 25.460 -32.390 1.00 41.57 C ANISOU15419 C GLN B 378 5374 6014 4405 1427 842 1263 C ATOM 15420 O GLN B 378 -32.063 25.568 -33.501 1.00 46.93 O ANISOU15420 O GLN B 378 5962 6836 5033 1514 837 1296 O ATOM 15421 CB GLN B 378 -29.721 27.090 -32.958 1.00 40.72 C ANISOU15421 CB GLN B 378 5335 5783 4355 1423 862 1263 C ATOM 15422 CG GLN B 378 -30.265 28.360 -32.305 1.00 46.41 C ANISOU15422 CG GLN B 378 6098 6430 5107 1464 927 1294 C ATOM 15423 CD GLN B 378 -29.753 28.573 -30.887 1.00 51.12 C ANISOU15423 CD GLN B 378 6809 6862 5752 1372 932 1255 C ATOM 15424 OE1 GLN B 378 -30.488 29.047 -30.020 1.00 54.20 O ANISOU15424 OE1 GLN B 378 7238 7203 6152 1398 976 1263 O ATOM 15425 NE2 GLN B 378 -28.491 28.227 -30.647 1.00 44.64 N ANISOU15425 NE2 GLN B 378 6038 5966 4956 1271 887 1214 N ATOM 15426 H GLN B 378 -29.275 24.647 -33.597 1.00 53.75 H ATOM 15427 HA GLN B 378 -29.878 25.915 -31.264 1.00 50.20 H ATOM 15428 HB2 GLN B 378 -28.756 27.174 -33.007 1.00 48.87 H ATOM 15429 HB3 GLN B 378 -30.090 27.037 -33.854 1.00 48.87 H ATOM 15430 HG2 GLN B 378 -29.998 29.126 -32.837 1.00 55.70 H ATOM 15431 HG3 GLN B 378 -31.233 28.304 -32.268 1.00 55.70 H ATOM 15432 HE21 GLN B 378 -28.006 27.901 -31.278 1.00 53.56 H ATOM 15433 HE22 GLN B 378 -28.160 28.330 -29.860 1.00 53.56 H ATOM 15434 N PRO B 379 -32.223 25.031 -31.309 1.00 40.12 N ANISOU15434 N PRO B 379 5214 5793 4238 1389 858 1262 N ATOM 15435 CA PRO B 379 -33.599 24.521 -31.415 1.00 43.97 C ANISOU15435 CA PRO B 379 5611 6415 4680 1436 863 1304 C ATOM 15436 C PRO B 379 -34.572 25.451 -32.141 1.00 46.53 C ANISOU15436 C PRO B 379 5850 6853 4977 1563 899 1367 C ATOM 15437 O PRO B 379 -34.541 26.668 -31.955 1.00 45.03 O ANISOU15437 O PRO B 379 5698 6590 4822 1616 952 1388 O ATOM 15438 CB PRO B 379 -34.012 24.338 -29.954 1.00 36.86 C ANISOU15438 CB PRO B 379 4765 5416 3823 1382 897 1302 C ATOM 15439 CG PRO B 379 -32.724 24.032 -29.262 1.00 35.78 C ANISOU15439 CG PRO B 379 4735 5128 3730 1276 874 1237 C ATOM 15440 CD PRO B 379 -31.716 24.920 -29.929 1.00 37.59 C ANISOU15440 CD PRO B 379 4995 5314 3972 1295 867 1222 C ATOM 15441 HA PRO B 379 -33.600 23.657 -31.855 1.00 52.76 H ATOM 15442 HB2 PRO B 379 -34.403 25.158 -29.614 1.00 44.23 H ATOM 15443 HB3 PRO B 379 -34.633 23.597 -29.875 1.00 44.23 H ATOM 15444 HG2 PRO B 379 -32.800 24.245 -28.319 1.00 42.93 H ATOM 15445 HG3 PRO B 379 -32.497 23.098 -29.388 1.00 42.93 H ATOM 15446 HD2 PRO B 379 -31.698 25.791 -29.503 1.00 45.10 H ATOM 15447 HD3 PRO B 379 -30.840 24.502 -29.923 1.00 45.10 H ATOM 15448 N LEU B 380 -35.422 24.852 -32.970 1.00 40.26 N ANISOU15448 N LEU B 380 4939 6244 4112 1609 868 1397 N ATOM 15449 CA LEU B 380 -36.398 25.583 -33.764 1.00 41.47 C ANISOU15449 CA LEU B 380 4991 6539 4229 1731 893 1461 C ATOM 15450 C LEU B 380 -37.812 25.202 -33.331 1.00 40.64 C ANISOU15450 C LEU B 380 4798 6545 4099 1752 907 1517 C ATOM 15451 O LEU B 380 -38.221 24.047 -33.450 1.00 35.54 O ANISOU15451 O LEU B 380 4087 6017 3401 1701 858 1514 O ATOM 15452 CB LEU B 380 -36.183 25.274 -35.244 1.00 41.48 C ANISOU15452 CB LEU B 380 4910 6698 4154 1775 837 1449 C ATOM 15453 CG LEU B 380 -34.810 25.682 -35.786 1.00 35.11 C ANISOU15453 CG LEU B 380 4167 5801 3370 1765 831 1409 C ATOM 15454 CD1 LEU B 380 -34.596 25.129 -37.197 1.00 29.76 C ANISOU15454 CD1 LEU B 380 3410 5289 2607 1805 770 1384 C ATOM 15455 CD2 LEU B 380 -34.644 27.204 -35.751 1.00 29.57 C ANISOU15455 CD2 LEU B 380 3500 5011 2725 1830 904 1449 C ATOM 15456 H LEU B 380 -35.452 24.001 -33.091 1.00 48.31 H ATOM 15457 HA LEU B 380 -36.279 26.536 -33.627 1.00 49.77 H ATOM 15458 HB2 LEU B 380 -36.280 24.318 -35.379 1.00 49.78 H ATOM 15459 HB3 LEU B 380 -36.855 25.746 -35.761 1.00 49.78 H ATOM 15460 HG LEU B 380 -34.126 25.299 -35.214 1.00 42.13 H ATOM 15461 HD11 LEU B 380 -33.720 25.402 -37.513 1.00 35.71 H ATOM 15462 HD12 LEU B 380 -34.650 24.161 -37.168 1.00 35.71 H ATOM 15463 HD13 LEU B 380 -35.284 25.482 -37.782 1.00 35.71 H ATOM 15464 HD21 LEU B 380 -33.768 27.434 -36.098 1.00 35.49 H ATOM 15465 HD22 LEU B 380 -35.334 27.609 -36.299 1.00 35.49 H ATOM 15466 HD23 LEU B 380 -34.727 27.509 -34.834 1.00 35.49 H ATOM 15467 N TRP B 381 -38.554 26.186 -32.834 1.00 58.68 N ANISOU15467 N TRP B 381 7079 8800 6417 1830 975 1573 N ATOM 15468 CA TRP B 381 -39.845 25.939 -32.201 1.00 57.16 C ANISOU15468 CA TRP B 381 6813 8688 6219 1850 1001 1636 C ATOM 15469 C TRP B 381 -40.977 25.776 -33.211 1.00 61.18 C ANISOU15469 C TRP B 381 7151 9443 6650 1929 976 1704 C ATOM 15470 O TRP B 381 -42.022 25.211 -32.890 1.00 71.35 O ANISOU15470 O TRP B 381 8343 10850 7917 1918 975 1759 O ATOM 15471 CB TRP B 381 -40.171 27.081 -31.236 1.00 53.36 C ANISOU15471 CB TRP B 381 6402 8076 5797 1917 1085 1667 C ATOM 15472 CG TRP B 381 -39.112 27.283 -30.191 1.00 50.84 C ANISOU15472 CG TRP B 381 6243 7534 5539 1839 1106 1596 C ATOM 15473 CD1 TRP B 381 -38.156 26.387 -29.812 1.00 46.40 C ANISOU15473 CD1 TRP B 381 5750 6887 4994 1710 1061 1526 C ATOM 15474 CD2 TRP B 381 -38.897 28.458 -29.399 1.00 54.57 C ANISOU15474 CD2 TRP B 381 6825 7853 6056 1886 1174 1588 C ATOM 15475 NE1 TRP B 381 -37.366 26.925 -28.829 1.00 46.28 N ANISOU15475 NE1 TRP B 381 5872 6682 5032 1671 1091 1477 N ATOM 15476 CE2 TRP B 381 -37.798 28.198 -28.558 1.00 50.74 C ANISOU15476 CE2 TRP B 381 6467 7204 5610 1775 1160 1510 C ATOM 15477 CE3 TRP B 381 -39.529 29.704 -29.316 1.00 59.45 C ANISOU15477 CE3 TRP B 381 7448 8461 6678 2017 1248 1639 C ATOM 15478 CZ2 TRP B 381 -37.311 29.136 -27.650 1.00 54.81 C ANISOU15478 CZ2 TRP B 381 7110 7557 6160 1782 1210 1477 C ATOM 15479 CZ3 TRP B 381 -39.046 30.637 -28.409 1.00 57.20 C ANISOU15479 CZ3 TRP B 381 7300 8005 6427 2029 1307 1605 C ATOM 15480 CH2 TRP B 381 -37.949 30.346 -27.589 1.00 54.84 C ANISOU15480 CH2 TRP B 381 7124 7555 6159 1908 1284 1523 C ATOM 15481 H TRP B 381 -38.328 27.016 -32.851 1.00 70.42 H ATOM 15482 HA TRP B 381 -39.789 25.120 -31.685 1.00 68.60 H ATOM 15483 HB2 TRP B 381 -40.256 27.905 -31.739 1.00 64.03 H ATOM 15484 HB3 TRP B 381 -41.005 26.882 -30.782 1.00 64.03 H ATOM 15485 HD1 TRP B 381 -38.059 25.531 -30.163 1.00 55.68 H ATOM 15486 HE1 TRP B 381 -36.703 26.531 -28.449 1.00 55.54 H ATOM 15487 HE3 TRP B 381 -40.258 29.904 -29.858 1.00 71.34 H ATOM 15488 HZ2 TRP B 381 -36.584 28.946 -27.102 1.00 65.78 H ATOM 15489 HZ3 TRP B 381 -39.457 31.468 -28.345 1.00 68.64 H ATOM 15490 HH2 TRP B 381 -37.646 30.989 -26.990 1.00 65.81 H ATOM 15491 N ASN B 382 -40.767 26.276 -34.424 1.00 54.83 N ANISOU15491 N ASN B 382 6303 8725 5806 2005 958 1704 N ATOM 15492 CA ASN B 382 -41.772 26.195 -35.479 1.00 59.34 C ANISOU15492 CA ASN B 382 6708 9544 6293 2087 930 1760 C ATOM 15493 C ASN B 382 -41.410 25.117 -36.499 1.00 55.56 C ANISOU15493 C ASN B 382 6172 9214 5724 2032 836 1700 C ATOM 15494 O ASN B 382 -40.277 25.070 -36.975 1.00 58.82 O ANISOU15494 O ASN B 382 6661 9549 6137 2007 810 1629 O ATOM 15495 CB ASN B 382 -41.912 27.552 -36.171 1.00 62.42 C ANISOU15495 CB ASN B 382 7088 9940 6689 2209 980 1798 C ATOM 15496 CG ASN B 382 -43.216 27.685 -36.935 1.00 62.98 C ANISOU15496 CG ASN B 382 7029 10220 6680 2257 964 1859 C ATOM 15497 OD1 ASN B 382 -43.629 26.770 -37.647 1.00 61.13 O ANISOU15497 OD1 ASN B 382 6675 10193 6358 2234 902 1850 O ATOM 15498 ND2 ASN B 382 -43.879 28.825 -36.779 1.00 57.17 N ANISOU15498 ND2 ASN B 382 6314 9441 5968 2324 1023 1917 N ATOM 15499 H ASN B 382 -40.042 26.671 -34.665 1.00 65.80 H ATOM 15500 HA ASN B 382 -42.629 25.965 -35.086 1.00 71.20 H ATOM 15501 HB2 ASN B 382 -41.882 28.253 -35.502 1.00 74.90 H ATOM 15502 HB3 ASN B 382 -41.182 27.662 -36.801 1.00 74.90 H ATOM 15503 HD21 ASN B 382 -44.624 28.949 -37.191 1.00 68.61 H ATOM 15504 HD22 ASN B 382 -43.564 29.440 -36.266 1.00 68.61 H ATOM 15505 N ASN B 383 -42.364 24.249 -36.825 1.00 53.38 N ANISOU15505 N ASN B 383 5762 9155 5364 2013 777 1727 N ATOM 15506 CA ASN B 383 -42.114 23.174 -37.784 1.00 50.57 C ANISOU15506 CA ASN B 383 5357 8941 4918 1966 643 1654 C ATOM 15507 C ASN B 383 -41.816 23.707 -39.180 1.00 56.50 C ANISOU15507 C ASN B 383 6076 9782 5610 2047 633 1613 C ATOM 15508 O ASN B 383 -41.128 23.052 -39.964 1.00 57.63 O ANISOU15508 O ASN B 383 6236 9957 5705 2019 540 1519 O ATOM 15509 CB ASN B 383 -43.289 22.190 -37.832 1.00 49.41 C ANISOU15509 CB ASN B 383 5045 8931 4798 1881 541 1620 C ATOM 15510 CG ASN B 383 -43.196 21.110 -36.762 1.00 54.92 C ANISOU15510 CG ASN B 383 5775 9480 5612 1708 508 1544 C ATOM 15511 OD1 ASN B 383 -42.231 21.051 -35.999 1.00 60.55 O ANISOU15511 OD1 ASN B 383 6636 10001 6370 1658 556 1517 O ATOM 15512 ND2 ASN B 383 -44.210 20.255 -36.695 1.00 56.98 N ANISOU15512 ND2 ASN B 383 5893 9832 5924 1614 424 1518 N ATOM 15513 H ASN B 383 -43.163 24.259 -36.507 1.00 64.05 H ATOM 15514 HA ASN B 383 -41.333 22.679 -37.491 1.00 60.69 H ATOM 15515 HB2 ASN B 383 -44.116 22.679 -37.693 1.00 59.29 H ATOM 15516 HB3 ASN B 383 -43.302 21.755 -38.698 1.00 59.29 H ATOM 15517 HD21 ASN B 383 -44.205 19.627 -36.108 1.00 68.37 H ATOM 15518 HD22 ASN B 383 -44.872 20.330 -37.239 1.00 68.37 H ATOM 15519 N ARG B 384 -42.326 24.898 -39.482 1.00 61.80 N ANISOU15519 N ARG B 384 6705 10492 6285 2153 735 1682 N ATOM 15520 CA ARG B 384 -42.033 25.552 -40.752 1.00 63.32 C ANISOU15520 CA ARG B 384 6877 10761 6422 2233 756 1662 C ATOM 15521 C ARG B 384 -40.527 25.732 -40.894 1.00 62.32 C ANISOU15521 C ARG B 384 6871 10458 6350 2220 758 1598 C ATOM 15522 O ARG B 384 -39.968 25.562 -41.979 1.00 68.61 O ANISOU15522 O ARG B 384 7660 11325 7084 2238 719 1541 O ATOM 15523 CB ARG B 384 -42.728 26.915 -40.836 1.00 63.90 C ANISOU15523 CB ARG B 384 6961 10793 6524 2295 828 1743 C ATOM 15524 CG ARG B 384 -44.249 26.852 -40.956 1.00 69.11 C ANISOU15524 CG ARG B 384 7499 11651 7108 2316 827 1816 C ATOM 15525 CD ARG B 384 -44.843 28.217 -41.274 1.00 73.75 C ANISOU15525 CD ARG B 384 8104 12215 7705 2390 897 1887 C ATOM 15526 NE ARG B 384 -44.396 28.714 -42.572 1.00 80.78 N ANISOU15526 NE ARG B 384 8995 13156 8540 2438 893 1861 N ATOM 15527 CZ ARG B 384 -44.641 29.938 -43.031 1.00 76.10 C ANISOU15527 CZ ARG B 384 8426 12534 7955 2505 953 1913 C ATOM 15528 NH1 ARG B 384 -45.325 30.806 -42.296 1.00 69.50 N ANISOU15528 NH1 ARG B 384 7617 11615 7174 2536 1022 1986 N ATOM 15529 NH2 ARG B 384 -44.189 30.297 -44.227 1.00 63.69 N ANISOU15529 NH2 ARG B 384 6848 11018 6333 2546 947 1894 N ATOM 15530 H ARG B 384 -42.846 25.349 -38.967 1.00 74.16 H ATOM 15531 HA ARG B 384 -42.349 24.999 -41.483 1.00 75.99 H ATOM 15532 HB2 ARG B 384 -42.518 27.419 -40.034 1.00 76.68 H ATOM 15533 HB3 ARG B 384 -42.392 27.386 -41.614 1.00 76.68 H ATOM 15534 HG2 ARG B 384 -44.488 26.242 -41.672 1.00 82.93 H ATOM 15535 HG3 ARG B 384 -44.623 26.546 -40.115 1.00 82.93 H ATOM 15536 HD2 ARG B 384 -45.810 28.147 -41.292 1.00 88.51 H ATOM 15537 HD3 ARG B 384 -44.565 28.851 -40.594 1.00 88.51 H ATOM 15538 HE ARG B 384 -43.945 28.180 -43.072 1.00 96.93 H ATOM 15539 HH11 ARG B 384 -45.618 30.576 -41.520 1.00 83.40 H ATOM 15540 HH12 ARG B 384 -45.480 31.597 -42.596 1.00 83.40 H ATOM 15541 HH21 ARG B 384 -43.744 29.737 -44.704 1.00 76.43 H ATOM 15542 HH22 ARG B 384 -44.345 31.088 -44.525 1.00 76.43 H ATOM 15543 N LEU B 385 -39.874 26.064 -39.786 1.00 50.36 N ANISOU15543 N LEU B 385 5473 8714 4949 2181 800 1607 N ATOM 15544 CA LEU B 385 -38.432 26.259 -39.784 1.00 47.18 C ANISOU15544 CA LEU B 385 5190 8134 4601 2145 803 1555 C ATOM 15545 C LEU B 385 -37.679 24.951 -39.565 1.00 52.13 C ANISOU15545 C LEU B 385 5879 8720 5207 2032 718 1469 C ATOM 15546 O LEU B 385 -36.607 24.750 -40.137 1.00 53.79 O ANISOU15546 O LEU B 385 6136 8893 5408 2017 689 1413 O ATOM 15547 CB LEU B 385 -38.021 27.278 -38.718 1.00 48.48 C ANISOU15547 CB LEU B 385 5466 8069 4883 2140 884 1589 C ATOM 15548 CG LEU B 385 -38.494 28.724 -38.905 1.00 52.92 C ANISOU15548 CG LEU B 385 6030 8605 5474 2221 957 1655 C ATOM 15549 CD1 LEU B 385 -37.606 29.660 -38.091 1.00 47.63 C ANISOU15549 CD1 LEU B 385 5490 7706 4903 2206 1022 1654 C ATOM 15550 CD2 LEU B 385 -38.514 29.148 -40.373 1.00 60.74 C ANISOU15550 CD2 LEU B 385 6960 9723 6394 2273 943 1662 C ATOM 15551 H LEU B 385 -40.245 26.182 -39.019 1.00 60.44 H ATOM 15552 HA LEU B 385 -38.165 26.612 -40.648 1.00 56.61 H ATOM 15553 HB2 LEU B 385 -38.366 26.975 -37.864 1.00 58.17 H ATOM 15554 HB3 LEU B 385 -37.052 27.299 -38.680 1.00 58.17 H ATOM 15555 HG LEU B 385 -39.398 28.802 -38.563 1.00 63.51 H ATOM 15556 HD11 LEU B 385 -37.913 30.572 -38.215 1.00 57.16 H ATOM 15557 HD12 LEU B 385 -37.666 29.415 -37.154 1.00 57.16 H ATOM 15558 HD13 LEU B 385 -36.691 29.574 -38.399 1.00 57.16 H ATOM 15559 HD21 LEU B 385 -38.819 30.067 -40.431 1.00 72.88 H ATOM 15560 HD22 LEU B 385 -37.617 29.074 -40.735 1.00 72.88 H ATOM 15561 HD23 LEU B 385 -39.117 28.567 -40.861 1.00 72.88 H ATOM 15562 N LEU B 386 -38.227 24.062 -38.741 1.00 56.95 N ANISOU15562 N LEU B 386 6487 9342 5811 1957 681 1466 N ATOM 15563 CA LEU B 386 -37.559 22.795 -38.470 1.00 54.38 C ANISOU15563 CA LEU B 386 6222 8976 5464 1852 601 1390 C ATOM 15564 C LEU B 386 -37.427 21.974 -39.746 1.00 57.80 C ANISOU15564 C LEU B 386 6594 9578 5790 1871 489 1312 C ATOM 15565 O LEU B 386 -36.433 21.268 -39.932 1.00 61.76 O ANISOU15565 O LEU B 386 7165 10023 6277 1825 434 1233 O ATOM 15566 CB LEU B 386 -38.307 21.985 -37.409 1.00 55.47 C ANISOU15566 CB LEU B 386 6349 9121 5608 1772 583 1415 C ATOM 15567 CG LEU B 386 -37.757 20.572 -37.168 1.00 56.07 C ANISOU15567 CG LEU B 386 6462 9129 5714 1636 485 1294 C ATOM 15568 CD1 LEU B 386 -36.324 20.617 -36.629 1.00 49.33 C ANISOU15568 CD1 LEU B 386 5767 8088 4887 1600 528 1279 C ATOM 15569 CD2 LEU B 386 -38.670 19.771 -36.247 1.00 58.28 C ANISOU15569 CD2 LEU B 386 6680 9373 6090 1514 459 1267 C ATOM 15570 H LEU B 386 -38.976 24.167 -38.332 1.00 68.34 H ATOM 15571 HA LEU B 386 -36.667 22.974 -38.135 1.00 65.26 H ATOM 15572 HB2 LEU B 386 -38.263 22.464 -36.567 1.00 66.57 H ATOM 15573 HB3 LEU B 386 -39.233 21.895 -37.685 1.00 66.57 H ATOM 15574 HG LEU B 386 -37.729 20.108 -38.019 1.00 67.29 H ATOM 15575 HD11 LEU B 386 -36.011 19.710 -36.489 1.00 59.19 H ATOM 15576 HD12 LEU B 386 -35.758 21.067 -37.275 1.00 59.19 H ATOM 15577 HD13 LEU B 386 -36.318 21.103 -35.789 1.00 59.19 H ATOM 15578 HD21 LEU B 386 -38.291 18.887 -36.118 1.00 69.93 H ATOM 15579 HD22 LEU B 386 -38.738 20.229 -35.394 1.00 69.93 H ATOM 15580 HD23 LEU B 386 -39.546 19.699 -36.656 1.00 69.93 H ATOM 15581 N LYS B 387 -38.419 22.059 -40.629 1.00 66.97 N ANISOU15581 N LYS B 387 7626 10942 6877 1939 450 1326 N ATOM 15582 CA LYS B 387 -38.368 21.251 -41.840 1.00 68.08 C ANISOU15582 CA LYS B 387 7707 11236 6923 1951 325 1226 C ATOM 15583 C LYS B 387 -37.184 21.670 -42.705 1.00 66.38 C ANISOU15583 C LYS B 387 7555 10971 6695 2003 363 1185 C ATOM 15584 O LYS B 387 -36.511 20.817 -43.266 1.00 66.86 O ANISOU15584 O LYS B 387 7646 11049 6708 1984 276 1085 O ATOM 15585 CB LYS B 387 -39.673 21.288 -42.648 1.00 66.86 C ANISOU15585 CB LYS B 387 7399 11302 6703 2001 270 1236 C ATOM 15586 CG LYS B 387 -39.778 20.086 -43.585 1.00 73.74 C ANISOU15586 CG LYS B 387 8209 12308 7502 1970 95 1098 C ATOM 15587 CD LYS B 387 -41.034 20.079 -44.432 1.00 83.76 C ANISOU15587 CD LYS B 387 9325 13785 8714 2000 29 1090 C ATOM 15588 CE LYS B 387 -41.012 18.900 -45.402 1.00 88.29 C ANISOU15588 CE LYS B 387 9860 14464 9224 1964 -151 927 C ATOM 15589 NZ LYS B 387 -39.943 19.024 -46.436 1.00 80.30 N ANISOU15589 NZ LYS B 387 8934 13440 8138 2037 -130 857 N ATOM 15590 H LYS B 387 -39.112 22.562 -40.554 1.00 80.36 H ATOM 15591 HA LYS B 387 -38.220 20.328 -41.580 1.00 81.69 H ATOM 15592 HB2 LYS B 387 -40.428 21.268 -42.039 1.00 80.23 H ATOM 15593 HB3 LYS B 387 -39.695 22.096 -43.185 1.00 80.23 H ATOM 15594 HG2 LYS B 387 -39.016 20.090 -44.185 1.00 88.49 H ATOM 15595 HG3 LYS B 387 -39.775 19.274 -43.054 1.00 88.49 H ATOM 15596 HD2 LYS B 387 -41.811 19.991 -43.858 1.00100.51 H ATOM 15597 HD3 LYS B 387 -41.082 20.900 -44.946 1.00100.51 H ATOM 15598 HE2 LYS B 387 -40.854 18.083 -44.903 1.00105.95 H ATOM 15599 HE3 LYS B 387 -41.867 18.850 -45.858 1.00105.95 H ATOM 15600 HZ1 LYS B 387 -39.963 18.320 -46.980 1.00 96.36 H ATOM 15601 HZ2 LYS B 387 -40.068 19.763 -46.915 1.00 96.36 H ATOM 15602 HZ3 LYS B 387 -39.145 19.064 -46.045 1.00 96.36 H ATOM 15603 N LEU B 388 -36.923 22.975 -42.781 1.00 50.46 N ANISOU15603 N LEU B 388 5553 8888 4731 2070 487 1263 N ATOM 15604 CA LEU B 388 -35.804 23.511 -43.560 1.00 51.76 C ANISOU15604 CA LEU B 388 5756 9005 4905 2122 529 1250 C ATOM 15605 C LEU B 388 -34.490 22.801 -43.228 1.00 57.96 C ANISOU15605 C LEU B 388 6649 9649 5725 2048 491 1183 C ATOM 15606 O LEU B 388 -33.596 22.695 -44.070 1.00 64.76 O ANISOU15606 O LEU B 388 7523 10525 6558 2082 479 1141 O ATOM 15607 CB LEU B 388 -35.637 25.012 -43.296 1.00 52.13 C ANISOU15607 CB LEU B 388 5818 8945 5045 2176 653 1348 C ATOM 15608 CG LEU B 388 -36.808 25.939 -43.635 1.00 54.07 C ANISOU15608 CG LEU B 388 5965 9312 5266 2268 717 1428 C ATOM 15609 CD1 LEU B 388 -36.478 27.380 -43.249 1.00 51.98 C ANISOU15609 CD1 LEU B 388 5774 8869 5108 2276 801 1502 C ATOM 15610 CD2 LEU B 388 -37.155 25.846 -45.111 1.00 64.30 C ANISOU15610 CD2 LEU B 388 7172 10818 6441 2340 687 1403 C ATOM 15611 H LEU B 388 -37.387 23.580 -42.385 1.00 60.55 H ATOM 15612 HA LEU B 388 -35.985 23.388 -44.505 1.00 62.11 H ATOM 15613 HB2 LEU B 388 -35.451 25.129 -42.351 1.00 62.56 H ATOM 15614 HB3 LEU B 388 -34.875 25.322 -43.809 1.00 62.56 H ATOM 15615 HG LEU B 388 -37.586 25.663 -43.127 1.00 64.88 H ATOM 15616 HD11 LEU B 388 -37.233 27.947 -43.473 1.00 62.38 H ATOM 15617 HD12 LEU B 388 -36.306 27.419 -42.295 1.00 62.38 H ATOM 15618 HD13 LEU B 388 -35.692 27.666 -43.740 1.00 62.38 H ATOM 15619 HD21 LEU B 388 -37.897 26.441 -45.299 1.00 77.16 H ATOM 15620 HD22 LEU B 388 -36.381 26.107 -45.634 1.00 77.16 H ATOM 15621 HD23 LEU B 388 -37.403 24.931 -45.320 1.00 77.16 H ATOM 15622 N PHE B 389 -34.385 22.321 -41.993 1.00 53.97 N ANISOU15622 N PHE B 389 6217 9012 5277 1952 482 1180 N ATOM 15623 CA PHE B 389 -33.206 21.603 -41.528 1.00 48.56 C ANISOU15623 CA PHE B 389 5637 8190 4625 1873 453 1122 C ATOM 15624 C PHE B 389 -33.323 20.114 -41.834 1.00 53.92 C ANISOU15624 C PHE B 389 6310 8967 5211 1838 326 1019 C ATOM 15625 O PHE B 389 -32.420 19.520 -42.423 1.00 60.62 O ANISOU15625 O PHE B 389 7196 9814 6024 1844 280 943 O ATOM 15626 CB PHE B 389 -33.037 21.801 -40.021 1.00 48.20 C ANISOU15626 CB PHE B 389 5679 7951 4682 1783 507 1163 C ATOM 15627 CG PHE B 389 -31.850 21.085 -39.441 1.00 41.83 C ANISOU15627 CG PHE B 389 4980 7001 3913 1694 486 1110 C ATOM 15628 CD1 PHE B 389 -31.962 19.784 -38.975 1.00 42.54 C ANISOU15628 CD1 PHE B 389 5101 7100 3961 1624 414 1053 C ATOM 15629 CD2 PHE B 389 -30.619 21.717 -39.359 1.00 40.47 C ANISOU15629 CD2 PHE B 389 4872 6690 3816 1680 534 1122 C ATOM 15630 CE1 PHE B 389 -30.867 19.125 -38.437 1.00 40.65 C ANISOU15630 CE1 PHE B 389 4960 6730 3754 1550 402 1009 C ATOM 15631 CE2 PHE B 389 -29.521 21.063 -38.825 1.00 44.90 C ANISOU15631 CE2 PHE B 389 5521 7130 4410 1599 516 1079 C ATOM 15632 CZ PHE B 389 -29.646 19.765 -38.365 1.00 41.99 C ANISOU15632 CZ PHE B 389 5188 6768 4000 1538 455 1023 C ATOM 15633 H PHE B 389 -34.997 22.401 -41.394 1.00 64.77 H ATOM 15634 HA PHE B 389 -32.418 21.950 -41.976 1.00 58.28 H ATOM 15635 HB2 PHE B 389 -32.930 22.748 -39.840 1.00 57.84 H ATOM 15636 HB3 PHE B 389 -33.831 21.469 -39.572 1.00 57.84 H ATOM 15637 HD1 PHE B 389 -32.783 19.348 -39.022 1.00 51.04 H ATOM 15638 HD2 PHE B 389 -30.529 22.589 -39.668 1.00 48.57 H ATOM 15639 HE1 PHE B 389 -30.954 18.252 -38.129 1.00 48.77 H ATOM 15640 HE2 PHE B 389 -28.700 21.496 -38.776 1.00 53.88 H ATOM 15641 HZ PHE B 389 -28.910 19.325 -38.005 1.00 50.39 H ATOM 15642 N THR B 390 -34.431 19.513 -41.410 1.00 58.17 N ANISOU15642 N THR B 390 6798 9589 5717 1801 262 1014 N ATOM 15643 CA THR B 390 -34.651 18.081 -41.598 1.00 60.90 C ANISOU15643 CA THR B 390 7124 9999 6015 1742 116 892 C ATOM 15644 C THR B 390 -34.794 17.701 -43.073 1.00 62.21 C ANISOU15644 C THR B 390 7221 10354 6064 1825 12 806 C ATOM 15645 O THR B 390 -34.661 16.535 -43.441 1.00 64.85 O ANISOU15645 O THR B 390 7562 10699 6380 1775 -108 663 O ATOM 15646 CB THR B 390 -35.892 17.598 -40.824 1.00 61.35 C ANISOU15646 CB THR B 390 7105 10035 6170 1626 82 870 C ATOM 15647 OG1 THR B 390 -37.064 18.253 -41.323 1.00 67.57 O ANISOU15647 OG1 THR B 390 7767 10998 6909 1704 85 942 O ATOM 15648 CG2 THR B 390 -35.739 17.889 -39.334 1.00 50.28 C ANISOU15648 CG2 THR B 390 5778 8443 4884 1544 186 941 C ATOM 15649 H THR B 390 -35.076 19.916 -41.008 1.00 69.81 H ATOM 15650 HA THR B 390 -33.883 17.603 -41.246 1.00 73.08 H ATOM 15651 HB THR B 390 -35.988 16.639 -40.938 1.00 73.62 H ATOM 15652 HG1 THR B 390 -37.741 17.991 -40.902 1.00 81.08 H ATOM 15653 HG21 THR B 390 -36.524 17.582 -38.854 1.00 60.34 H ATOM 15654 HG22 THR B 390 -34.957 17.431 -38.985 1.00 60.34 H ATOM 15655 HG23 THR B 390 -35.635 18.843 -39.191 1.00 60.34 H ATOM 15656 N ARG B 391 -35.075 18.700 -43.902 1.00 68.78 N ANISOU15656 N ARG B 391 7988 11271 6874 1917 82 859 N ATOM 15657 CA ARG B 391 -35.156 18.544 -45.348 1.00 64.37 C ANISOU15657 CA ARG B 391 7370 10865 6223 1996 23 782 C ATOM 15658 C ARG B 391 -33.838 18.013 -45.922 1.00 68.37 C ANISOU15658 C ARG B 391 7961 11315 6702 2017 2 695 C ATOM 15659 O ARG B 391 -33.822 17.296 -46.926 1.00 70.90 O ANISOU15659 O ARG B 391 8261 11739 6939 2054 -96 580 O ATOM 15660 CB ARG B 391 -35.459 19.913 -45.947 1.00 61.40 C ANISOU15660 CB ARG B 391 6932 10553 5845 2092 143 885 C ATOM 15661 CG ARG B 391 -35.919 19.940 -47.377 1.00 75.40 C ANISOU15661 CG ARG B 391 8619 12515 7516 2180 99 836 C ATOM 15662 CD ARG B 391 -36.309 21.374 -47.741 1.00 74.81 C ANISOU15662 CD ARG B 391 8484 12491 7448 2268 233 960 C ATOM 15663 NE ARG B 391 -35.251 22.323 -47.396 1.00 71.01 N ANISOU15663 NE ARG B 391 8070 11854 7055 2290 363 1043 N ATOM 15664 CZ ARG B 391 -35.317 23.639 -47.573 1.00 69.96 C ANISOU15664 CZ ARG B 391 7906 11717 6960 2360 484 1149 C ATOM 15665 NH1 ARG B 391 -36.396 24.204 -48.103 1.00 64.33 N ANISOU15665 NH1 ARG B 391 7100 11153 6189 2425 512 1197 N ATOM 15666 NH2 ARG B 391 -34.289 24.396 -47.215 1.00 68.07 N ANISOU15666 NH2 ARG B 391 7727 11319 6817 2361 570 1207 N ATOM 15667 H ARG B 391 -35.229 19.504 -43.640 1.00 82.54 H ATOM 15668 HA ARG B 391 -35.872 17.931 -45.578 1.00 77.25 H ATOM 15669 HB2 ARG B 391 -36.155 20.328 -45.415 1.00 73.68 H ATOM 15670 HB3 ARG B 391 -34.653 20.450 -45.895 1.00 73.68 H ATOM 15671 HG2 ARG B 391 -35.198 19.654 -47.960 1.00 90.49 H ATOM 15672 HG3 ARG B 391 -36.695 19.368 -47.484 1.00 90.49 H ATOM 15673 HD2 ARG B 391 -36.468 21.430 -48.696 1.00 89.77 H ATOM 15674 HD3 ARG B 391 -37.110 21.622 -47.252 1.00 89.77 H ATOM 15675 HE ARG B 391 -34.530 22.004 -47.053 1.00 85.21 H ATOM 15676 HH11 ARG B 391 -37.066 23.718 -48.335 1.00 77.19 H ATOM 15677 HH12 ARG B 391 -36.426 25.057 -48.212 1.00 77.19 H ATOM 15678 HH21 ARG B 391 -33.587 24.034 -46.873 1.00 81.68 H ATOM 15679 HH22 ARG B 391 -34.322 25.248 -47.328 1.00 81.68 H ATOM 15680 N CYS B 392 -32.738 18.364 -45.258 1.00 65.67 N ANISOU15680 N CYS B 392 7711 10803 6438 1991 94 748 N ATOM 15681 CA CYS B 392 -31.386 18.127 -45.761 1.00 62.90 C ANISOU15681 CA CYS B 392 7427 10392 6082 2022 108 705 C ATOM 15682 C CYS B 392 -30.703 16.895 -45.141 1.00 68.46 C ANISOU15682 C CYS B 392 8228 10994 6789 1944 32 615 C ATOM 15683 O CYS B 392 -29.473 16.811 -45.130 1.00 62.20 O ANISOU15683 O CYS B 392 7503 10102 6026 1947 72 613 O ATOM 15684 CB CYS B 392 -30.526 19.369 -45.474 1.00 57.33 C ANISOU15684 CB CYS B 392 6746 9563 5474 2038 249 824 C ATOM 15685 SG CYS B 392 -31.197 20.939 -46.091 1.00 70.82 S ANISOU15685 SG CYS B 392 8355 11360 7195 2132 352 938 S ATOM 15686 H CYS B 392 -32.751 18.753 -44.491 1.00 78.81 H ATOM 15687 HA CYS B 392 -31.422 18.000 -46.722 1.00 75.49 H ATOM 15688 HB2 CYS B 392 -30.421 19.454 -44.514 1.00 68.80 H ATOM 15689 HB3 CYS B 392 -29.657 19.242 -45.885 1.00 68.80 H ATOM 15690 HG CYS B 392 -30.440 21.826 -45.806 1.00 84.99 H ATOM 15691 N LEU B 393 -31.495 15.936 -44.657 1.00 77.01 N ANISOU15691 N LEU B 393 9307 12107 7844 1875 -81 541 N ATOM 15692 CA LEU B 393 -30.980 14.853 -43.804 1.00 78.14 C ANISOU15692 CA LEU B 393 9546 12139 8005 1789 -142 473 C ATOM 15693 C LEU B 393 -30.891 13.463 -44.453 1.00 86.73 C ANISOU15693 C LEU B 393 10653 13249 9052 1769 -285 283 C ATOM 15694 O LEU B 393 -31.165 12.454 -43.801 1.00 90.59 O ANISOU15694 O LEU B 393 11165 13613 9643 1631 -350 182 O ATOM 15695 CB LEU B 393 -31.830 14.737 -42.532 1.00 80.19 C ANISOU15695 CB LEU B 393 9786 12272 8412 1639 -124 491 C ATOM 15696 CG LEU B 393 -31.779 15.872 -41.516 1.00 75.00 C ANISOU15696 CG LEU B 393 9151 11521 7824 1626 16 651 C ATOM 15697 CD1 LEU B 393 -32.688 15.497 -40.354 1.00 76.75 C ANISOU15697 CD1 LEU B 393 9348 11637 8176 1484 14 642 C ATOM 15698 CD2 LEU B 393 -30.358 16.122 -41.041 1.00 65.22 C ANISOU15698 CD2 LEU B 393 8028 10148 6603 1630 96 704 C ATOM 15699 H LEU B 393 -32.340 15.887 -44.807 1.00 92.41 H ATOM 15700 HA LEU B 393 -30.083 15.093 -43.526 1.00 93.77 H ATOM 15701 HB2 LEU B 393 -32.757 14.646 -42.803 1.00 96.23 H ATOM 15702 HB3 LEU B 393 -31.557 13.931 -42.066 1.00 96.23 H ATOM 15703 HG LEU B 393 -32.116 16.686 -41.921 1.00 90.00 H ATOM 15704 HD11 LEU B 393 -32.668 16.209 -39.696 1.00 92.10 H ATOM 15705 HD12 LEU B 393 -33.591 15.378 -40.687 1.00 92.10 H ATOM 15706 HD13 LEU B 393 -32.369 14.670 -39.959 1.00 92.10 H ATOM 15707 HD21 LEU B 393 -30.364 16.848 -40.398 1.00 78.26 H ATOM 15708 HD22 LEU B 393 -30.017 15.315 -40.626 1.00 78.26 H ATOM 15709 HD23 LEU B 393 -29.808 16.360 -41.804 1.00 78.26 H ATOM 15710 N THR B 394 -30.523 13.394 -45.727 1.00107.36 N ANISOU15710 N THR B 394 13256 15978 11559 1884 -318 226 N ATOM 15711 CA THR B 394 -30.084 12.119 -46.307 1.00113.23 C ANISOU15711 CA THR B 394 14057 16725 12239 1896 -439 53 C ATOM 15712 C THR B 394 -29.227 12.373 -47.558 1.00113.43 C ANISOU15712 C THR B 394 14086 16801 12210 2023 -389 42 C ATOM 15713 O THR B 394 -29.674 13.040 -48.492 1.00114.27 O ANISOU15713 O THR B 394 14109 17035 12275 2104 -364 73 O ATOM 15714 CB THR B 394 -31.264 11.152 -46.627 1.00113.30 C ANISOU15714 CB THR B 394 14012 16805 12233 1830 -611 -104 C ATOM 15715 OG1 THR B 394 -32.250 11.208 -45.588 1.00113.79 O ANISOU15715 OG1 THR B 394 14016 16777 12443 1678 -600 -62 O ATOM 15716 CG2 THR B 394 -30.755 9.721 -46.726 1.00108.35 C ANISOU15716 CG2 THR B 394 13479 16071 11618 1780 -719 -288 C ATOM 15717 H THR B 394 -30.515 14.057 -46.273 1.00128.84 H ATOM 15718 HA THR B 394 -29.518 11.673 -45.658 1.00135.87 H ATOM 15719 HB THR B 394 -31.667 11.398 -47.474 1.00135.96 H ATOM 15720 HG1 THR B 394 -32.552 11.989 -45.520 1.00136.55 H ATOM 15721 HG21 THR B 394 -30.092 9.653 -47.432 1.00130.02 H ATOM 15722 HG22 THR B 394 -30.349 9.455 -45.887 1.00130.02 H ATOM 15723 HG23 THR B 394 -31.490 9.121 -46.926 1.00130.02 H ATOM 15724 N PRO B 395 -27.992 11.829 -47.582 1.00101.52 N ANISOU15724 N PRO B 395 12669 15200 10703 2047 -371 4 N ATOM 15725 CA PRO B 395 -26.982 12.228 -48.573 1.00100.75 C ANISOU15725 CA PRO B 395 12565 15137 10578 2169 -292 39 C ATOM 15726 C PRO B 395 -27.290 11.734 -49.983 1.00103.40 C ANISOU15726 C PRO B 395 12869 15615 10805 2274 -380 -84 C ATOM 15727 O PRO B 395 -26.413 11.811 -50.846 1.00104.18 O ANISOU15727 O PRO B 395 12970 15749 10866 2386 -335 -78 O ATOM 15728 CB PRO B 395 -25.712 11.554 -48.053 1.00 94.85 C ANISOU15728 CB PRO B 395 11923 14253 9864 2151 -274 19 C ATOM 15729 CG PRO B 395 -26.214 10.306 -47.422 1.00 95.35 C ANISOU15729 CG PRO B 395 12057 14259 9912 2060 -406 -124 C ATOM 15730 CD PRO B 395 -27.552 10.655 -46.805 1.00 98.84 C ANISOU15730 CD PRO B 395 12437 14739 10380 1971 -443 -96 C TER 15731 PRO B 395 HETATM15732 O1 MES A1101 -27.448 -20.747 9.177 1.00 44.45 O HETATM15733 C2 MES A1101 -28.726 -21.090 8.638 1.00 47.88 C HETATM15734 C3 MES A1101 -28.639 -22.227 7.618 1.00 45.96 C HETATM15735 N4 MES A1101 -28.060 -23.403 8.259 1.00 45.16 N HETATM15736 C5 MES A1101 -27.306 -23.143 9.475 1.00 50.86 C HETATM15737 C6 MES A1101 -26.546 -21.850 9.199 1.00 40.66 C HETATM15738 C7 MES A1101 -28.910 -24.589 8.291 1.00 48.86 C HETATM15739 C8 MES A1101 -28.644 -25.374 7.009 1.00 43.71 C HETATM15740 S MES A1101 -29.999 -26.267 6.632 1.00 97.13 S HETATM15741 O1S MES A1101 -29.676 -27.281 5.602 1.00 74.33 O HETATM15742 O2S MES A1101 -31.045 -25.361 6.110 1.00 83.85 O HETATM15743 O3S MES A1101 -30.490 -26.958 7.846 1.00 88.17 O HETATM15744 H21 MES A1101 -29.379 -21.397 9.458 1.00 57.46 H HETATM15745 H22 MES A1101 -29.170 -20.211 8.166 1.00 57.46 H HETATM15746 H31 MES A1101 -28.036 -21.929 6.758 1.00 55.15 H HETATM15747 H32 MES A1101 -29.645 -22.465 7.265 1.00 55.15 H HETATM15748 HN4 MES A1101 -27.337 -23.672 7.609 1.00 54.19 H HETATM15749 H51 MES A1101 -27.978 -23.022 10.327 1.00 61.03 H HETATM15750 H52 MES A1101 -26.612 -23.961 9.680 1.00 61.03 H HETATM15751 H61 MES A1101 -25.787 -21.699 9.969 1.00 48.79 H HETATM15752 H62 MES A1101 -26.030 -21.928 8.239 1.00 48.79 H HETATM15753 H71 MES A1101 -28.672 -25.200 9.164 1.00 58.63 H HETATM15754 H72 MES A1101 -29.961 -24.298 8.344 1.00 58.63 H HETATM15755 H81 MES A1101 -28.413 -24.686 6.194 1.00 52.45 H HETATM15756 H82 MES A1101 -27.789 -26.038 7.151 1.00 52.45 H HETATM15757 O HOH A1201 -39.555 45.004 -18.554 1.00 39.55 O HETATM15758 O HOH A1202 -36.297 -12.002 -11.755 1.00 33.72 O HETATM15759 O HOH A1203 -59.666 -29.884 1.453 1.00 19.43 O HETATM15760 O HOH A1204 -47.754 -18.859 -0.029 1.00 14.28 O HETATM15761 O HOH A1205 -29.010 -34.170 -21.430 1.00 23.56 O HETATM15762 O HOH A1206 -39.676 46.143 -24.567 1.00 28.97 O HETATM15763 O HOH A1207 -42.262 -26.017 -7.402 1.00 33.85 O HETATM15764 O HOH A1208 -27.711 13.397 -25.935 1.00 23.70 O HETATM15765 O HOH A1209 -45.962 -2.067 -10.437 1.00 35.52 O HETATM15766 O HOH A1210 -17.637 14.508 -44.886 1.00 56.53 O HETATM15767 O HOH A1211 -47.381 13.102 -20.451 1.00 39.82 O HETATM15768 O HOH B 501 -18.974 -10.252 2.405 1.00 20.65 O HETATM15769 O HOH B 502 -19.444 -18.503 7.141 1.00 31.33 O HETATM15770 O HOH B 503 -27.270 -18.111 -3.197 1.00 14.23 O CONECT 1 2 CONECT 2 1 3 5 9 CONECT 3 2 4 17 CONECT 4 3 CONECT 5 2 6 10 11 CONECT 6 5 7 12 13 CONECT 7 6 8 CONECT 8 7 14 15 16 CONECT 9 2 CONECT 10 5 CONECT 11 5 CONECT 12 6 CONECT 13 6 CONECT 14 8 CONECT 15 8 CONECT 16 8 CONECT 17 3 CONECT 105 124 CONECT 124 105 125 CONECT 125 124 126 128 132 CONECT 126 125 127 140 CONECT 127 126 CONECT 128 125 129 133 134 CONECT 129 128 130 135 136 CONECT 130 129 131 CONECT 131 130 137 138 139 CONECT 132 125 CONECT 133 128 CONECT 134 128 CONECT 135 129 CONECT 136 129 CONECT 137 131 CONECT 138 131 CONECT 139 131 CONECT 140 126 CONECT 152 159 CONECT 159 152 160 167 CONECT 160 159 161 163 168 CONECT 161 160 162 176 CONECT 162 161 CONECT 163 160 164 169 170 CONECT 164 163 165 171 172 CONECT 165 164 166 CONECT 166 165 173 174 175 CONECT 167 159 CONECT 168 160 CONECT 169 163 CONECT 170 163 CONECT 171 164 CONECT 172 164 CONECT 173 166 CONECT 174 166 CONECT 175 166 CONECT 176 161 CONECT 772 785 CONECT 785 772 786 793 CONECT 786 785 787 789 794 CONECT 787 786 788 802 CONECT 788 787 CONECT 789 786 790 795 796 CONECT 790 789 791 797 798 CONECT 791 790 792 CONECT 792 791 799 800 801 CONECT 793 785 CONECT 794 786 CONECT 795 789 CONECT 796 789 CONECT 797 790 CONECT 798 790 CONECT 799 792 CONECT 800 792 CONECT 801 792 CONECT 802 787 CONECT 848 864 CONECT 864 848 865 872 CONECT 865 864 866 868 873 CONECT 866 865 867 881 CONECT 867 866 CONECT 868 865 869 874 875 CONECT 869 868 870 876 877 CONECT 870 869 871 CONECT 871 870 878 879 880 CONECT 872 864 CONECT 873 865 CONECT 874 868 CONECT 875 868 CONECT 876 869 CONECT 877 869 CONECT 878 871 CONECT 879 871 CONECT 880 871 CONECT 881 866 CONECT 1002 1022 CONECT 1022 1002 1023 1030 CONECT 1023 1022 1024 1026 1031 CONECT 1024 1023 1025 1039 CONECT 1025 1024 CONECT 1026 1023 1027 1032 1033 CONECT 1027 1026 1028 1034 1035 CONECT 1028 1027 1029 CONECT 1029 1028 1036 1037 1038 CONECT 1030 1022 CONECT 1031 1023 CONECT 1032 1026 CONECT 1033 1026 CONECT 1034 1027 CONECT 1035 1027 CONECT 1036 1029 CONECT 1037 1029 CONECT 1038 1029 CONECT 1039 1024 CONECT 1228 1240 CONECT 1240 1228 1241 1248 CONECT 1241 1240 1242 1244 1249 CONECT 1242 1241 1243 1257 CONECT 1243 1242 CONECT 1244 1241 1245 1250 1251 CONECT 1245 1244 1246 1252 1253 CONECT 1246 1245 1247 CONECT 1247 1246 1254 1255 1256 CONECT 1248 1240 CONECT 1249 1241 CONECT 1250 1244 CONECT 1251 1244 CONECT 1252 1245 CONECT 1253 1245 CONECT 1254 1247 CONECT 1255 1247 CONECT 1256 1247 CONECT 1257 1242 CONECT 1769 1788 CONECT 1788 1769 1789 1796 CONECT 1789 1788 1790 1792 1797 CONECT 1790 1789 1791 1805 CONECT 1791 1790 CONECT 1792 1789 1793 1798 1799 CONECT 1793 1792 1794 1800 1801 CONECT 1794 1793 1795 CONECT 1795 1794 1802 1803 1804 CONECT 1796 1788 CONECT 1797 1789 CONECT 1798 1792 CONECT 1799 1792 CONECT 1800 1793 CONECT 1801 1793 CONECT 1802 1795 CONECT 1803 1795 CONECT 1804 1795 CONECT 1805 1790 1806 1813 CONECT 1806 1805 1807 1809 1814 CONECT 1807 1806 1808 1822 CONECT 1808 1807 CONECT 1809 1806 1810 1815 1816 CONECT 1810 1809 1811 1817 1818 CONECT 1811 1810 1812 CONECT 1812 1811 1819 1820 1821 CONECT 1813 1805 CONECT 1814 1806 CONECT 1815 1809 CONECT 1816 1809 CONECT 1817 1810 CONECT 1818 1810 CONECT 1819 1812 CONECT 1820 1812 CONECT 1821 1812 CONECT 1822 1807 CONECT 2205 2213 CONECT 2213 2205 2214 2221 CONECT 2214 2213 2215 2217 2222 CONECT 2215 2214 2216 2230 CONECT 2216 2215 CONECT 2217 2214 2218 2223 2224 CONECT 2218 2217 2219 2225 2226 CONECT 2219 2218 2220 CONECT 2220 2219 2227 2228 2229 CONECT 2221 2213 CONECT 2222 2214 CONECT 2223 2217 CONECT 2224 2217 CONECT 2225 2218 CONECT 2226 2218 CONECT 2227 2220 CONECT 2228 2220 CONECT 2229 2220 CONECT 2230 2215 CONECT 2254 2271 CONECT 2271 2254 2272 2279 CONECT 2272 2271 2273 2275 2280 CONECT 2273 2272 2274 2288 CONECT 2274 2273 CONECT 2275 2272 2276 2281 2282 CONECT 2276 2275 2277 2283 2284 CONECT 2277 2276 2278 CONECT 2278 2277 2285 2286 2287 CONECT 2279 2271 CONECT 2280 2272 CONECT 2281 2275 CONECT 2282 2275 CONECT 2283 2276 CONECT 2284 2276 CONECT 2285 2278 CONECT 2286 2278 CONECT 2287 2278 CONECT 2288 2273 CONECT 2471 2483 CONECT 2483 2471 2484 2491 CONECT 2484 2483 2485 2487 2492 CONECT 2485 2484 2486 2500 CONECT 2486 2485 CONECT 2487 2484 2488 2493 2494 CONECT 2488 2487 2489 2495 2496 CONECT 2489 2488 2490 CONECT 2490 2489 2497 2498 2499 CONECT 2491 2483 CONECT 2492 2484 CONECT 2493 2487 CONECT 2494 2487 CONECT 2495 2488 CONECT 2496 2488 CONECT 2497 2490 CONECT 2498 2490 CONECT 2499 2490 CONECT 2500 2485 CONECT 3091 3103 CONECT 3103 3091 3104 3111 CONECT 3104 3103 3105 3107 3112 CONECT 3105 3104 3106 3120 CONECT 3106 3105 CONECT 3107 3104 3108 3113 3114 CONECT 3108 3107 3109 3115 3116 CONECT 3109 3108 3110 CONECT 3110 3109 3117 3118 3119 CONECT 3111 3103 CONECT 3112 3104 CONECT 3113 3107 CONECT 3114 3107 CONECT 3115 3108 CONECT 3116 3108 CONECT 3117 3110 CONECT 3118 3110 CONECT 3119 3110 CONECT 3120 3105 3121 3128 CONECT 3121 3120 3122 3124 3129 CONECT 3122 3121 3123 3137 CONECT 3123 3122 CONECT 3124 3121 3125 3130 3131 CONECT 3125 3124 3126 3132 3133 CONECT 3126 3125 3127 CONECT 3127 3126 3134 3135 3136 CONECT 3128 3120 CONECT 3129 3121 CONECT 3130 3124 CONECT 3131 3124 CONECT 3132 3125 CONECT 3133 3125 CONECT 3134 3127 CONECT 3135 3127 CONECT 3136 3127 CONECT 3137 3122 CONECT 3613 3635 CONECT 3635 3613 3636 3643 CONECT 3636 3635 3637 3639 3644 CONECT 3637 3636 3638 3652 CONECT 3638 3637 CONECT 3639 3636 3640 3645 3646 CONECT 3640 3639 3641 3647 3648 CONECT 3641 3640 3642 CONECT 3642 3641 3649 3650 3651 CONECT 3643 3635 CONECT 3644 3636 CONECT 3645 3639 CONECT 3646 3639 CONECT 3647 3640 CONECT 3648 3640 CONECT 3649 3642 CONECT 3650 3642 CONECT 3651 3642 CONECT 3652 3637 CONECT 3654 3674 CONECT 3674 3654 3675 3682 CONECT 3675 3674 3676 3678 3683 CONECT 3676 3675 3677 3691 CONECT 3677 3676 CONECT 3678 3675 3679 3684 3685 CONECT 3679 3678 3680 3686 3687 CONECT 3680 3679 3681 CONECT 3681 3680 3688 3689 3690 CONECT 3682 3674 CONECT 3683 3675 CONECT 3684 3678 CONECT 3685 3678 CONECT 3686 3679 CONECT 3687 3679 CONECT 3688 3681 CONECT 3689 3681 CONECT 3690 3681 CONECT 3691 3676 CONECT 3953 3965 CONECT 3965 3953 3966 3973 CONECT 3966 3965 3967 3969 3974 CONECT 3967 3966 3968 3982 CONECT 3968 3967 CONECT 3969 3966 3970 3975 3976 CONECT 3970 3969 3971 3977 3978 CONECT 3971 3970 3972 CONECT 3972 3971 3979 3980 3981 CONECT 3973 3965 CONECT 3974 3966 CONECT 3975 3969 CONECT 3976 3969 CONECT 3977 3970 CONECT 3978 3970 CONECT 3979 3972 CONECT 3980 3972 CONECT 3981 3972 CONECT 3982 3967 CONECT 4666 4675 CONECT 4675 4666 4676 4683 CONECT 4676 4675 4677 4679 4684 CONECT 4677 4676 4678 4692 CONECT 4678 4677 CONECT 4679 4676 4680 4685 4686 CONECT 4680 4679 4681 4687 4688 CONECT 4681 4680 4682 CONECT 4682 4681 4689 4690 4691 CONECT 4683 4675 CONECT 4684 4676 CONECT 4685 4679 CONECT 4686 4679 CONECT 4687 4680 CONECT 4688 4680 CONECT 4689 4682 CONECT 4690 4682 CONECT 4691 4682 CONECT 4692 4677 CONECT 6086 6095 CONECT 6095 6086 6096 6103 CONECT 6096 6095 6097 6099 6104 CONECT 6097 6096 6098 6112 CONECT 6098 6097 CONECT 6099 6096 6100 6105 6106 CONECT 6100 6099 6101 6107 6108 CONECT 6101 6100 6102 CONECT 6102 6101 6109 6110 6111 CONECT 6103 6095 CONECT 6104 6096 CONECT 6105 6099 CONECT 6106 6099 CONECT 6107 6100 CONECT 6108 6100 CONECT 6109 6102 CONECT 6110 6102 CONECT 6111 6102 CONECT 6112 6097 CONECT 6311 6320 CONECT 6320 6311 6321 6328 CONECT 6321 6320 6322 6324 6329 CONECT 6322 6321 6323 6337 CONECT 6323 6322 CONECT 6324 6321 6325 6330 6331 CONECT 6325 6324 6326 6332 6333 CONECT 6326 6325 6327 CONECT 6327 6326 6334 6335 6336 CONECT 6328 6320 CONECT 6329 6321 CONECT 6330 6324 CONECT 6331 6324 CONECT 6332 6325 CONECT 6333 6325 CONECT 6334 6327 CONECT 6335 6327 CONECT 6336 6327 CONECT 6337 6322 CONECT 6625 6642 CONECT 6642 6625 6643 6650 CONECT 6643 6642 6644 6646 6651 CONECT 6644 6643 6645 6659 CONECT 6645 6644 CONECT 6646 6643 6647 6652 6653 CONECT 6647 6646 6648 6654 6655 CONECT 6648 6647 6649 CONECT 6649 6648 6656 6657 6658 CONECT 6650 6642 CONECT 6651 6643 CONECT 6652 6646 CONECT 6653 6646 CONECT 6654 6647 CONECT 6655 6647 CONECT 6656 6649 CONECT 6657 6649 CONECT 6658 6649 CONECT 6659 6644 CONECT 9757 9767 CONECT 9767 9757 9768 9775 CONECT 9768 9767 9769 9771 9776 CONECT 9769 9768 9770 9784 CONECT 9770 9769 CONECT 9771 9768 9772 9777 9778 CONECT 9772 9771 9773 9779 9780 CONECT 9773 9772 9774 CONECT 9774 9773 9781 9782 9783 CONECT 9775 9767 CONECT 9776 9768 CONECT 9777 9771 CONECT 9778 9771 CONECT 9779 9772 CONECT 9780 9772 CONECT 9781 9774 CONECT 9782 9774 CONECT 9783 9774 CONECT 9784 9769 CONECT1037710392 CONECT10392103771039310400 CONECT1039310392103941039610401 CONECT10394103931039510409 CONECT1039510394 CONECT1039610393103971040210403 CONECT1039710396103981040410405 CONECT103981039710399 CONECT1039910398104061040710408 CONECT1040010392 CONECT1040110393 CONECT1040210396 CONECT1040310396 CONECT1040410397 CONECT1040510397 CONECT1040610399 CONECT1040710399 CONECT1040810399 CONECT1040910394 CONECT1088410901 CONECT10901108841090210909 CONECT1090210901109031090510910 CONECT10903109021090410918 CONECT1090410903 CONECT1090510902109061091110912 CONECT1090610905109071091310914 CONECT109071090610908 CONECT1090810907109151091610917 CONECT1090910901 CONECT1091010902 CONECT1091110905 CONECT1091210905 CONECT1091310906 CONECT1091410906 CONECT1091510908 CONECT1091610908 CONECT1091710908 CONECT1091810903 CONECT1100511022 CONECT11022110051102311030 CONECT1102311022110241102611031 CONECT11024110231102511039 CONECT1102511024 CONECT1102611023110271103211033 CONECT1102711026110281103411035 CONECT110281102711029 CONECT1102911028110361103711038 CONECT1103011022 CONECT1103111023 CONECT1103211026 CONECT1103311026 CONECT1103411027 CONECT1103511027 CONECT1103611029 CONECT1103711029 CONECT1103811029 CONECT1103911024 CONECT1107111077 CONECT110771107111078 CONECT1107811077110791108111085 CONECT11079110781108011086 CONECT1108011079 CONECT110811107811082 CONECT110821108111083 CONECT110831108211084 CONECT1108411083 CONECT1108511078 CONECT1108611079 CONECT1191911932 CONECT11932119191193311940 CONECT1193311932119341193611941 CONECT11934119331193511949 CONECT1193511934 CONECT1193611933119371194211943 CONECT1193711936119381194411945 CONECT119381193711939 CONECT1193911938119461194711948 CONECT1194011932 CONECT1194111933 CONECT1194211936 CONECT1194311936 CONECT1194411937 CONECT1194511937 CONECT1194611939 CONECT1194711939 CONECT1194811939 CONECT1194911934 CONECT1208912108 CONECT12108120891210912116 CONECT1210912108121101211212117 CONECT12110121091211112125 CONECT1211112110 CONECT1211212109121131211812119 CONECT1211312112121141212012121 CONECT121141211312115 CONECT1211512114121221212312124 CONECT1211612108 CONECT1211712109 CONECT1211812112 CONECT1211912112 CONECT1212012113 CONECT1212112113 CONECT1212212115 CONECT1212312115 CONECT1212412115 CONECT1212512110 CONECT1233212344 CONECT12344123321234512352 CONECT1234512344123461234812353 CONECT12346123451234712361 CONECT1234712346 CONECT1234812345123491235412355 CONECT1234912348123501235612357 CONECT123501234912351 CONECT1235112350123581235912360 CONECT1235212344 CONECT1235312345 CONECT1235412348 CONECT1235512348 CONECT1235612349 CONECT1235712349 CONECT1235812351 CONECT1235912351 CONECT1236012351 CONECT1236112346 CONECT1277112784 CONECT12784127711278512792 CONECT1278512784127861278812793 CONECT12786127851278712801 CONECT1278712786 CONECT1278812785127891279412795 CONECT1278912788127901279612797 CONECT127901278912791 CONECT1279112790127981279912800 CONECT1279212784 CONECT1279312785 CONECT1279412788 CONECT1279512788 CONECT1279612789 CONECT1279712789 CONECT1279812791 CONECT1279912791 CONECT1280012791 CONECT1280112786 CONECT1327813286 CONECT13286132781328713294 CONECT1328713286132881329013295 CONECT13288132871328913303 CONECT1328913288 CONECT1329013287132911329613297 CONECT1329113290132921329813299 CONECT132921329113293 CONECT1329313292133001330113302 CONECT1329413286 CONECT1329513287 CONECT1329613290 CONECT1329713290 CONECT1329813291 CONECT1329913291 CONECT1330013293 CONECT1330113293 CONECT1330213293 CONECT1330313288 CONECT1409514113 CONECT14113140951411414121 CONECT1411414113141151411714122 CONECT14115141141411614130 CONECT1411614115 CONECT1411714114141181412314124 CONECT1411814117141191412514126 CONECT141191411814120 CONECT1412014119141271412814129 CONECT1412114113 CONECT1412214114 CONECT1412314117 CONECT1412414117 CONECT1412514118 CONECT1412614118 CONECT1412714120 CONECT1412814120 CONECT1412914120 CONECT1413014115 CONECT1416614181 CONECT14181141661418214189 CONECT1418214181141831418514190 CONECT14183141821418414198 CONECT1418414183 CONECT1418514182141861419114192 CONECT1418614185141871419314194 CONECT141871418614188 CONECT1418814187141951419614197 CONECT1418914181 CONECT1419014182 CONECT1419114185 CONECT1419214185 CONECT1419314186 CONECT1419414186 CONECT1419514188 CONECT1419614188 CONECT1419714188 CONECT1419814183 CONECT1436514382 CONECT14382143651438314390 CONECT1438314382143841438614391 CONECT14384143831438514399 CONECT1438514384 CONECT1438614383143871439214393 CONECT1438714386143881439414395 CONECT143881438714389 CONECT1438914388143961439714398 CONECT1439014382 CONECT1439114383 CONECT1439214386 CONECT1439314386 CONECT1439414387 CONECT1439514387 CONECT1439614389 CONECT1439714389 CONECT1439814389 CONECT1439914384 CONECT1513115148 CONECT15148151311514915156 CONECT1514915148151501515215157 CONECT15150151491515115165 CONECT1515115150 CONECT1515215149151531515815159 CONECT1515315152151541516015161 CONECT151541515315155 CONECT1515515154151621516315164 CONECT1515615148 CONECT1515715149 CONECT1515815152 CONECT1515915152 CONECT1516015153 CONECT1516115153 CONECT1516215155 CONECT1516315155 CONECT1516415155 CONECT15165151501516615173 CONECT1516615165151671516915174 CONECT15167151661516815182 CONECT1516815167 CONECT1516915166151701517515176 CONECT1517015169151711517715178 CONECT151711517015172 CONECT1517215171151791518015181 CONECT1517315165 CONECT1517415166 CONECT1517515169 CONECT1517615169 CONECT1517715170 CONECT1517815170 CONECT1517915172 CONECT1518015172 CONECT1518115172 CONECT1518215167 CONECT157321573315737 CONECT1573315732157341574415745 CONECT1573415733157351574615747 CONECT1573515734157361573815748 CONECT1573615735157371574915750 CONECT1573715732157361575115752 CONECT1573815735157391575315754 CONECT1573915738157401575515756 CONECT1574015739157411574215743 CONECT1574115740 CONECT1574215740 CONECT1574315740 CONECT1574415733 CONECT1574515733 CONECT1574615734 CONECT1574715734 CONECT1574815735 CONECT1574915736 CONECT1575015736 CONECT1575115737 CONECT1575215737 CONECT1575315738 CONECT1575415738 CONECT1575515739 CONECT1575615739 MASTER 470 0 37 57 0 0 2 6 8000 2 692 87 END