>>4PJW:HELIX   27 AC9 THR A  549  SER A  579  1                                  31    
TAKEKKTQLDDRTKITELFAVALPQLLAKYS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 27 AC9 THR A 549 SER A 579 1 31 ATOM 6941 N THR A 549 -56.314 2.473 -26.720 1.00 63.45 N ANISOU 6941 N THR A 549 7234 8492 8382 1349 -754 1199 N ATOM 6942 CA THR A 549 -57.430 1.552 -26.898 1.00 65.45 C ANISOU 6942 CA THR A 549 7383 8798 8688 1346 -878 1199 C ATOM 6943 C THR A 549 -58.712 2.343 -27.150 1.00 69.06 C ANISOU 6943 C THR A 549 7738 9306 9195 1402 -919 1268 C ATOM 6944 O THR A 549 -58.709 3.575 -27.112 1.00 67.06 O ANISOU 6944 O THR A 549 7499 9045 8937 1443 -842 1317 O ATOM 6945 CB THR A 549 -57.629 0.629 -25.673 1.00 71.86 C ANISOU 6945 CB THR A 549 8129 9605 9569 1302 -813 1176 C ATOM 6946 OG1 THR A 549 -58.278 1.346 -24.616 1.00 64.59 O ANISOU 6946 OG1 THR A 549 7144 8676 8720 1319 -702 1215 O ATOM 6947 CG2 THR A 549 -56.292 0.074 -25.175 1.00 77.13 C ANISOU 6947 CG2 THR A 549 8902 10209 10196 1250 -739 1111 C ATOM 6948 H THR A 549 -56.049 2.552 -25.906 1.00 76.14 H ATOM 6949 HA THR A 549 -57.262 0.994 -27.674 1.00 78.54 H ATOM 6950 HB THR A 549 -58.186 -0.122 -25.932 1.00 86.23 H ATOM 6951 HG1 THR A 549 -58.385 0.844 -23.951 1.00 77.50 H ATOM 6952 HG21 THR A 549 -56.437 -0.502 -24.408 1.00 92.56 H ATOM 6953 HG22 THR A 549 -55.864 -0.440 -25.878 1.00 92.56 H ATOM 6954 HG23 THR A 549 -55.706 0.802 -24.916 1.00 92.56 H ATOM 6955 N ALA A 550 -59.803 1.630 -27.409 1.00 66.02 N ANISOU 6955 N ALA A 550 7235 8991 8860 1404 -1030 1294 N ATOM 6956 CA ALA A 550 -61.078 2.259 -27.743 1.00 68.83 C ANISOU 6956 CA ALA A 550 7479 9402 9272 1454 -1088 1365 C ATOM 6957 C ALA A 550 -61.578 3.188 -26.639 1.00 63.07 C ANISOU 6957 C ALA A 550 6692 8648 8624 1480 -939 1410 C ATOM 6958 O ALA A 550 -61.932 4.337 -26.901 1.00 60.60 O ANISOU 6958 O ALA A 550 6368 8341 8316 1535 -916 1469 O ATOM 6959 CB ALA A 550 -62.121 1.195 -28.038 1.00 74.40 C ANISOU 6959 CB ALA A 550 8053 10187 10029 1432 -1221 1383 C ATOM 6960 H ALA A 550 -59.832 0.770 -27.399 1.00 79.23 H ATOM 6961 HA ALA A 550 -60.962 2.791 -28.546 1.00 82.60 H ATOM 6962 HB1 ALA A 550 -62.960 1.629 -28.257 1.00 89.28 H ATOM 6963 HB2 ALA A 550 -61.820 0.658 -28.787 1.00 89.28 H ATOM 6964 HB3 ALA A 550 -62.232 0.636 -27.253 1.00 89.28 H ATOM 6965 N LYS A 551 -61.598 2.688 -25.407 1.00 83.68 N ANISOU 6965 N LYS A 551 9267 11235 11293 1443 -833 1397 N ATOM 6966 CA LYS A 551 -62.206 3.410 -24.293 1.00 81.12 C ANISOU 6966 CA LYS A 551 8878 10895 11049 1466 -693 1458 C ATOM 6967 C LYS A 551 -61.301 4.508 -23.730 1.00 81.86 C ANISOU 6967 C LYS A 551 9076 10935 11092 1484 -536 1473 C ATOM 6968 O LYS A 551 -61.772 5.405 -23.031 1.00 86.63 O ANISOU 6968 O LYS A 551 9645 11531 11742 1521 -423 1539 O ATOM 6969 CB LYS A 551 -62.580 2.435 -23.173 1.00 80.46 C ANISOU 6969 CB LYS A 551 8722 10804 11043 1418 -637 1447 C ATOM 6970 CG LYS A 551 -63.307 1.178 -23.645 1.00 91.54 C ANISOU 6970 CG LYS A 551 10009 12273 12497 1382 -773 1451 C ATOM 6971 CD LYS A 551 -64.580 1.507 -24.428 1.00 98.24 C ANISOU 6971 CD LYS A 551 10729 13192 13405 1423 -882 1526 C ATOM 6972 CE LYS A 551 -65.396 0.259 -24.739 1.00 96.07 C ANISOU 6972 CE LYS A 551 10323 12983 13195 1373 -1011 1536 C ATOM 6973 NZ LYS A 551 -65.871 -0.419 -23.503 1.00 95.29 N ANISOU 6973 NZ LYS A 551 10134 12868 13204 1327 -914 1555 N ATOM 6974 H LYS A 551 -61.263 1.926 -25.188 1.00100.42 H ATOM 6975 HA LYS A 551 -63.023 3.831 -24.604 1.00 97.34 H ATOM 6976 HB2 LYS A 551 -61.768 2.154 -22.723 1.00 96.55 H ATOM 6977 HB3 LYS A 551 -63.161 2.892 -22.545 1.00 96.55 H ATOM 6978 HG2 LYS A 551 -62.719 0.669 -24.225 1.00109.84 H ATOM 6979 HG3 LYS A 551 -63.557 0.646 -22.874 1.00109.84 H ATOM 6980 HD2 LYS A 551 -65.132 2.106 -23.902 1.00117.89 H ATOM 6981 HD3 LYS A 551 -64.337 1.928 -25.268 1.00117.89 H ATOM 6982 HE2 LYS A 551 -66.172 0.509 -25.265 1.00115.28 H ATOM 6983 HE3 LYS A 551 -64.844 -0.367 -25.234 1.00115.28 H ATOM 6984 HZ1 LYS A 551 -66.344 -1.142 -23.716 1.00114.35 H ATOM 6985 HZ2 LYS A 551 -65.176 -0.663 -23.004 1.00114.35 H ATOM 6986 HZ3 LYS A 551 -66.385 0.134 -23.032 1.00114.35 H ATOM 6987 N GLU A 552 -60.007 4.434 -24.031 1.00 77.19 N ANISOU 6987 N GLU A 552 8613 10308 10407 1458 -527 1414 N ATOM 6988 CA GLU A 552 -59.043 5.399 -23.507 1.00 75.36 C ANISOU 6988 CA GLU A 552 8482 10030 10122 1466 -383 1420 C ATOM 6989 C GLU A 552 -59.102 6.736 -24.239 1.00 76.95 C ANISOU 6989 C GLU A 552 8703 10246 10288 1528 -375 1474 C ATOM 6990 O GLU A 552 -58.978 7.793 -23.621 1.00 74.17 O ANISOU 6990 O GLU A 552 8374 9874 9934 1557 -247 1515 O ATOM 6991 CB GLU A 552 -57.629 4.823 -23.572 1.00 80.76 C ANISOU 6991 CB GLU A 552 9285 10673 10729 1413 -373 1343 C ATOM 6992 CG GLU A 552 -57.279 3.938 -22.387 1.00 85.07 C ANISOU 6992 CG GLU A 552 9839 11181 11302 1355 -303 1301 C ATOM 6993 CD GLU A 552 -56.338 2.809 -22.756 1.00 84.19 C ANISOU 6993 CD GLU A 552 9794 11049 11146 1300 -368 1222 C ATOM 6994 OE1 GLU A 552 -56.601 1.660 -22.339 1.00 87.69 O ANISOU 6994 OE1 GLU A 552 10194 11493 11632 1260 -404 1188 O ATOM 6995 OE2 GLU A 552 -55.337 3.070 -23.456 1.00 74.18 O ANISOU 6995 OE2 GLU A 552 8620 9764 9804 1298 -377 1197 O ATOM 6996 H GLU A 552 -59.661 3.833 -24.538 1.00 92.63 H ATOM 6997 HA GLU A 552 -59.249 5.566 -22.574 1.00 90.43 H ATOM 6998 HB2 GLU A 552 -57.545 4.288 -24.377 1.00 96.92 H ATOM 6999 HB3 GLU A 552 -56.993 5.555 -23.595 1.00 96.92 H ATOM 7000 HG2 GLU A 552 -56.847 4.478 -21.706 1.00102.08 H ATOM 7001 HG3 GLU A 552 -58.093 3.547 -22.033 1.00102.08 H ATOM 7002 N LYS A 553 -59.286 6.687 -25.555 1.00 69.46 N ANISOU 7002 N LYS A 553 7751 9333 9309 1549 -515 1476 N ATOM 7003 CA LYS A 553 -59.442 7.900 -26.353 1.00 67.84 C ANISOU 7003 CA LYS A 553 7556 9147 9074 1611 -526 1533 C ATOM 7004 C LYS A 553 -60.703 8.650 -25.938 1.00 64.54 C ANISOU 7004 C LYS A 553 7024 8756 8743 1665 -487 1618 C ATOM 7005 O LYS A 553 -60.788 9.872 -26.070 1.00 62.03 O ANISOU 7005 O LYS A 553 6715 8439 8416 1718 -426 1675 O ATOM 7006 CB LYS A 553 -59.517 7.547 -27.837 1.00 65.72 C ANISOU 7006 CB LYS A 553 7305 8910 8757 1619 -704 1521 C ATOM 7007 CG LYS A 553 -58.199 7.064 -28.422 1.00 69.32 C ANISOU 7007 CG LYS A 553 7889 9333 9117 1578 -728 1455 C ATOM 7008 CD LYS A 553 -58.392 5.978 -29.476 1.00 75.06 C ANISOU 7008 CD LYS A 553 8624 10080 9814 1555 -918 1418 C ATOM 7009 CE LYS A 553 -57.853 6.402 -30.835 1.00 80.07 C ANISOU 7009 CE LYS A 553 9354 10715 10354 1574 -1000 1430 C ATOM 7010 NZ LYS A 553 -58.059 5.338 -31.857 1.00 72.22 N ANISOU 7010 NZ LYS A 553 8387 9734 9319 1548 -1194 1397 N ATOM 7011 H LYS A 553 -59.324 5.960 -26.012 1.00 83.36 H ATOM 7012 HA LYS A 553 -58.677 8.480 -26.212 1.00 81.41 H ATOM 7013 HB2 LYS A 553 -60.171 6.841 -27.958 1.00 78.87 H ATOM 7014 HB3 LYS A 553 -59.789 8.336 -28.332 1.00 78.87 H ATOM 7015 HG2 LYS A 553 -57.745 7.812 -28.841 1.00 83.19 H ATOM 7016 HG3 LYS A 553 -57.651 6.699 -27.710 1.00 83.19 H ATOM 7017 HD2 LYS A 553 -57.919 5.178 -29.199 1.00 90.07 H ATOM 7018 HD3 LYS A 553 -59.339 5.791 -29.571 1.00 90.07 H ATOM 7019 HE2 LYS A 553 -58.318 7.200 -31.129 1.00 96.08 H ATOM 7020 HE3 LYS A 553 -56.901 6.575 -30.762 1.00 96.08 H ATOM 7021 HZ1 LYS A 553 -57.737 5.605 -32.642 1.00 86.66 H ATOM 7022 HZ2 LYS A 553 -57.637 4.594 -31.610 1.00 86.66 H ATOM 7023 HZ3 LYS A 553 -58.927 5.163 -31.944 1.00 86.66 H ATOM 7024 N LYS A 554 -61.682 7.905 -25.441 1.00 63.81 N ANISOU 7024 N LYS A 554 6821 8684 8740 1651 -521 1630 N ATOM 7025 CA LYS A 554 -62.915 8.490 -24.943 1.00 66.88 C ANISOU 7025 CA LYS A 554 7089 9094 9227 1698 -473 1716 C ATOM 7026 C LYS A 554 -62.623 9.338 -23.710 1.00 67.56 C ANISOU 7026 C LYS A 554 7215 9133 9322 1712 -277 1746 C ATOM 7027 O LYS A 554 -63.011 10.505 -23.641 1.00 69.03 O ANISOU 7027 O LYS A 554 7384 9320 9527 1770 -206 1817 O ATOM 7028 CB LYS A 554 -63.906 7.383 -24.592 1.00 70.21 C ANISOU 7028 CB LYS A 554 7388 9545 9744 1669 -538 1716 C ATOM 7029 CG LYS A 554 -65.323 7.856 -24.338 1.00 77.17 C ANISOU 7029 CG LYS A 554 8122 10458 10741 1717 -523 1813 C ATOM 7030 CD LYS A 554 -66.219 6.675 -24.013 1.00 88.22 C ANISOU 7030 CD LYS A 554 9398 11887 12235 1678 -586 1810 C ATOM 7031 CE LYS A 554 -67.611 7.123 -23.610 1.00 95.85 C ANISOU 7031 CE LYS A 554 10211 12876 13331 1721 -547 1915 C ATOM 7032 NZ LYS A 554 -68.573 5.986 -23.589 1.00102.65 N ANISOU 7032 NZ LYS A 554 10934 13781 14289 1683 -642 1919 N ATOM 7033 H LYS A 554 -61.654 7.047 -25.381 1.00 76.57 H ATOM 7034 HA LYS A 554 -63.309 9.056 -25.625 1.00 80.25 H ATOM 7035 HB2 LYS A 554 -63.936 6.750 -25.326 1.00 84.25 H ATOM 7036 HB3 LYS A 554 -63.598 6.936 -23.788 1.00 84.25 H ATOM 7037 HG2 LYS A 554 -65.331 8.466 -23.583 1.00 92.60 H ATOM 7038 HG3 LYS A 554 -65.666 8.294 -25.133 1.00 92.60 H ATOM 7039 HD2 LYS A 554 -66.298 6.108 -24.796 1.00105.86 H ATOM 7040 HD3 LYS A 554 -65.836 6.176 -23.274 1.00105.86 H ATOM 7041 HE2 LYS A 554 -67.577 7.509 -22.721 1.00115.02 H ATOM 7042 HE3 LYS A 554 -67.932 7.779 -24.248 1.00115.02 H ATOM 7043 HZ1 LYS A 554 -69.380 6.275 -23.350 1.00123.18 H ATOM 7044 HZ2 LYS A 554 -68.625 5.616 -24.397 1.00123.18 H ATOM 7045 HZ3 LYS A 554 -68.302 5.370 -23.006 1.00123.18 H ATOM 7046 N THR A 555 -61.937 8.737 -22.741 1.00 63.30 N ANISOU 7046 N THR A 555 6734 8551 8766 1658 -193 1692 N ATOM 7047 CA THR A 555 -61.554 9.429 -21.516 1.00 57.71 C ANISOU 7047 CA THR A 555 6083 7792 8051 1663 -16 1710 C ATOM 7048 C THR A 555 -60.677 10.626 -21.857 1.00 56.26 C ANISOU 7048 C THR A 555 6004 7591 7783 1693 45 1713 C ATOM 7049 O THR A 555 -60.768 11.674 -21.219 1.00 57.55 O ANISOU 7049 O THR A 555 6185 7730 7950 1732 169 1762 O ATOM 7050 CB THR A 555 -60.784 8.492 -20.555 1.00 54.59 C ANISOU 7050 CB THR A 555 5751 7354 7637 1593 38 1641 C ATOM 7051 OG1 THR A 555 -61.577 7.332 -20.272 1.00 54.05 O ANISOU 7051 OG1 THR A 555 5584 7304 7649 1562 -20 1635 O ATOM 7052 CG2 THR A 555 -60.448 9.199 -19.245 1.00 53.38 C ANISOU 7052 CG2 THR A 555 5660 7147 7473 1598 211 1661 C ATOM 7053 H THR A 555 -61.680 7.917 -22.771 1.00 75.96 H ATOM 7054 HA THR A 555 -62.349 9.749 -21.062 1.00 69.25 H ATOM 7055 HB THR A 555 -59.953 8.217 -20.974 1.00 65.51 H ATOM 7056 HG1 THR A 555 -61.161 6.821 -19.750 1.00 64.86 H ATOM 7057 HG21 THR A 555 -59.966 8.596 -18.658 1.00 64.05 H ATOM 7058 HG22 THR A 555 -59.895 9.976 -19.421 1.00 64.05 H ATOM 7059 HG23 THR A 555 -61.263 9.484 -18.804 1.00 64.05 H ATOM 7060 N GLN A 556 -59.827 10.463 -22.867 1.00 60.90 N ANISOU 7060 N GLN A 556 6661 8187 8293 1675 -38 1662 N ATOM 7061 CA GLN A 556 -58.981 11.555 -23.327 1.00 63.81 C ANISOU 7061 CA GLN A 556 7120 8543 8581 1703 11 1666 C ATOM 7062 C GLN A 556 -59.844 12.727 -23.787 1.00 69.09 C ANISOU 7062 C GLN A 556 7730 9240 9282 1781 16 1753 C ATOM 7063 O GLN A 556 -59.690 13.844 -23.298 1.00 66.32 O ANISOU 7063 O GLN A 556 7414 8866 8918 1817 136 1790 O ATOM 7064 CB GLN A 556 -58.065 11.098 -24.466 1.00 56.89 C ANISOU 7064 CB GLN A 556 6314 7674 7626 1675 -90 1606 C ATOM 7065 CG GLN A 556 -56.979 12.105 -24.823 1.00 50.83 C ANISOU 7065 CG GLN A 556 5650 6887 6774 1692 -20 1599 C ATOM 7066 CD GLN A 556 -56.289 11.779 -26.132 1.00 59.83 C ANISOU 7066 CD GLN A 556 6847 8040 7845 1681 -125 1563 C ATOM 7067 OE1 GLN A 556 -56.665 10.834 -26.824 1.00 68.32 O ANISOU 7067 OE1 GLN A 556 7890 9140 8931 1665 -260 1545 O ATOM 7068 NE2 GLN A 556 -55.273 12.563 -26.481 1.00 57.03 N ANISOU 7068 NE2 GLN A 556 6580 7669 7420 1692 -62 1554 N ATOM 7069 H GLN A 556 -59.723 9.728 -23.302 1.00 73.09 H ATOM 7070 HA GLN A 556 -58.424 11.858 -22.593 1.00 76.57 H ATOM 7071 HB2 GLN A 556 -57.630 10.272 -24.204 1.00 68.26 H ATOM 7072 HB3 GLN A 556 -58.604 10.949 -25.259 1.00 68.26 H ATOM 7073 HG2 GLN A 556 -57.378 12.985 -24.905 1.00 60.99 H ATOM 7074 HG3 GLN A 556 -56.308 12.108 -24.123 1.00 60.99 H ATOM 7075 HE21 GLN A 556 -55.039 13.216 -25.972 1.00 68.44 H ATOM 7076 HE22 GLN A 556 -54.850 12.418 -27.215 1.00 68.44 H ATOM 7077 N LEU A 557 -60.753 12.464 -24.722 1.00 61.29 N ANISOU 7077 N LEU A 557 6654 8300 8335 1807 -120 1785 N ATOM 7078 CA LEU A 557 -61.642 13.497 -25.250 1.00 58.76 C ANISOU 7078 CA LEU A 557 6265 8010 8053 1881 -135 1873 C ATOM 7079 C LEU A 557 -62.464 14.152 -24.141 1.00 54.95 C ANISOU 7079 C LEU A 557 5717 7511 7652 1919 -4 1944 C ATOM 7080 O LEU A 557 -62.690 15.363 -24.158 1.00 50.80 O ANISOU 7080 O LEU A 557 5190 6980 7131 1979 68 2008 O ATOM 7081 CB LEU A 557 -62.579 12.903 -26.300 1.00 57.87 C ANISOU 7081 CB LEU A 557 6056 7951 7982 1894 -318 1893 C ATOM 7082 CG LEU A 557 -63.603 13.879 -26.885 1.00 61.92 C ANISOU 7082 CG LEU A 557 6483 8499 8545 1970 -353 1990 C ATOM 7083 CD1 LEU A 557 -62.908 15.017 -27.623 1.00 66.26 C ANISOU 7083 CD1 LEU A 557 7122 9042 9013 2011 -329 2007 C ATOM 7084 CD2 LEU A 557 -64.579 13.159 -27.797 1.00 65.34 C ANISOU 7084 CD2 LEU A 557 6813 8987 9026 1974 -544 2007 C ATOM 7085 H LEU A 557 -60.877 11.688 -25.071 1.00 73.55 H ATOM 7086 HA LEU A 557 -61.109 14.186 -25.676 1.00 70.52 H ATOM 7087 HB2 LEU A 557 -62.043 12.567 -27.036 1.00 69.45 H ATOM 7088 HB3 LEU A 557 -63.071 12.172 -25.896 1.00 69.45 H ATOM 7089 HG LEU A 557 -64.112 14.269 -26.156 1.00 74.30 H ATOM 7090 HD11 LEU A 557 -63.580 15.617 -27.982 1.00 79.52 H ATOM 7091 HD12 LEU A 557 -62.335 15.493 -27.002 1.00 79.52 H ATOM 7092 HD13 LEU A 557 -62.376 14.645 -28.345 1.00 79.52 H ATOM 7093 HD21 LEU A 557 -65.213 13.801 -28.151 1.00 78.41 H ATOM 7094 HD22 LEU A 557 -64.086 12.746 -28.523 1.00 78.41 H ATOM 7095 HD23 LEU A 557 -65.046 12.479 -27.285 1.00 78.41 H ATOM 7096 N ASP A 558 -62.925 13.337 -23.195 1.00 55.59 N ANISOU 7096 N ASP A 558 5744 7580 7799 1886 28 1936 N ATOM 7097 CA ASP A 558 -63.607 13.835 -22.005 1.00 57.59 C ANISOU 7097 CA ASP A 558 5952 7806 8125 1916 169 2000 C ATOM 7098 C ASP A 558 -62.675 14.767 -21.228 1.00 52.53 C ANISOU 7098 C ASP A 558 5434 7110 7414 1922 326 1989 C ATOM 7099 O ASP A 558 -63.081 15.843 -20.786 1.00 54.37 O ANISOU 7099 O ASP A 558 5661 7325 7673 1979 434 2057 O ATOM 7100 CB ASP A 558 -64.044 12.668 -21.107 1.00 61.10 C ANISOU 7100 CB ASP A 558 6340 8240 8637 1868 179 1980 C ATOM 7101 CG ASP A 558 -65.331 12.003 -21.577 1.00 62.73 C ANISOU 7101 CG ASP A 558 6389 8498 8948 1877 61 2023 C ATOM 7102 OD1 ASP A 558 -66.304 12.724 -21.888 1.00 74.02 O ANISOU 7102 OD1 ASP A 558 7726 9952 10446 1940 55 2111 O ATOM 7103 OD2 ASP A 558 -65.373 10.755 -21.625 1.00 55.30 O ANISOU 7103 OD2 ASP A 558 5415 7573 8025 1822 -27 1970 O ATOM 7104 H ASP A 558 -62.853 12.481 -23.220 1.00 66.71 H ATOM 7105 HA ASP A 558 -64.396 14.335 -22.267 1.00 69.11 H ATOM 7106 HB2 ASP A 558 -63.345 11.995 -21.103 1.00 73.33 H ATOM 7107 HB3 ASP A 558 -64.190 12.999 -20.207 1.00 73.33 H ATOM 7108 N ASP A 559 -61.420 14.347 -21.078 1.00 48.62 N ANISOU 7108 N ASP A 559 5053 6589 6833 1864 337 1903 N ATOM 7109 CA ASP A 559 -60.428 15.101 -20.312 1.00 45.01 C ANISOU 7109 CA ASP A 559 4716 6080 6306 1858 472 1880 C ATOM 7110 C ASP A 559 -60.084 16.453 -20.939 1.00 45.18 C ANISOU 7110 C ASP A 559 4785 6104 6278 1912 505 1913 C ATOM 7111 O ASP A 559 -59.966 17.451 -20.227 1.00 40.95 O ANISOU 7111 O ASP A 559 4296 5532 5730 1945 632 1944 O ATOM 7112 CB ASP A 559 -59.154 14.265 -20.132 1.00 46.64 C ANISOU 7112 CB ASP A 559 5018 6262 6440 1780 457 1782 C ATOM 7113 CG ASP A 559 -59.277 13.240 -19.015 1.00 54.38 C ANISOU 7113 CG ASP A 559 5987 7215 7458 1729 490 1754 C ATOM 7114 OD1 ASP A 559 -60.369 13.132 -18.413 1.00 55.72 O ANISOU 7114 OD1 ASP A 559 6073 7387 7712 1753 524 1810 O ATOM 7115 OD2 ASP A 559 -58.280 12.531 -18.748 1.00 57.70 O ANISOU 7115 OD2 ASP A 559 6481 7612 7829 1666 484 1679 O ATOM 7116 H ASP A 559 -61.114 13.618 -21.415 1.00 58.35 H ATOM 7117 HA ASP A 559 -60.790 15.274 -19.429 1.00 54.01 H ATOM 7118 HB2 ASP A 559 -58.968 13.789 -20.956 1.00 55.96 H ATOM 7119 HB3 ASP A 559 -58.416 14.856 -19.916 1.00 55.96 H ATOM 7120 N ARG A 560 -59.933 16.498 -22.261 1.00 50.44 N ANISOU 7120 N ARG A 560 5443 6810 6913 1924 392 1907 N ATOM 7121 CA ARG A 560 -59.551 17.740 -22.924 1.00 55.24 C ANISOU 7121 CA ARG A 560 6097 7421 7470 1974 420 1936 C ATOM 7122 C ARG A 560 -60.642 18.798 -22.781 1.00 61.19 C ANISOU 7122 C ARG A 560 6778 8180 8290 2054 477 2036 C ATOM 7123 O ARG A 560 -60.364 19.944 -22.424 1.00 60.36 O ANISOU 7123 O ARG A 560 6727 8047 8161 2092 588 2065 O ATOM 7124 CB ARG A 560 -59.269 17.511 -24.407 1.00 59.20 C ANISOU 7124 CB ARG A 560 6602 7963 7928 1975 280 1916 C ATOM 7125 CG ARG A 560 -58.282 16.407 -24.702 1.00 60.39 C ANISOU 7125 CG ARG A 560 6816 8109 8021 1902 213 1824 C ATOM 7126 CD ARG A 560 -57.824 16.500 -26.136 1.00 64.22 C ANISOU 7126 CD ARG A 560 7335 8622 8444 1914 110 1813 C ATOM 7127 NE ARG A 560 -56.926 17.636 -26.355 1.00 63.98 N ANISOU 7127 NE ARG A 560 7390 8572 8346 1940 196 1816 N ATOM 7128 CZ ARG A 560 -55.627 17.541 -26.641 1.00 63.23 C ANISOU 7128 CZ ARG A 560 7392 8457 8174 1904 215 1755 C ATOM 7129 NH1 ARG A 560 -55.034 16.356 -26.760 1.00 58.01 N ANISOU 7129 NH1 ARG A 560 6762 7791 7490 1842 157 1686 N ATOM 7130 NH2 ARG A 560 -54.912 18.644 -26.820 1.00 65.47 N ANISOU 7130 NH2 ARG A 560 7741 8726 8409 1933 296 1766 N ATOM 7131 H ARG A 560 -60.044 15.830 -22.790 1.00 60.53 H ATOM 7132 HA ARG A 560 -58.742 18.084 -22.513 1.00 66.28 H ATOM 7133 HB2 ARG A 560 -60.103 17.284 -24.848 1.00 71.04 H ATOM 7134 HB3 ARG A 560 -58.914 18.331 -24.784 1.00 71.04 H ATOM 7135 HG2 ARG A 560 -57.508 16.499 -24.124 1.00 72.47 H ATOM 7136 HG3 ARG A 560 -58.707 15.546 -24.568 1.00 72.47 H ATOM 7137 HD2 ARG A 560 -57.347 15.688 -26.371 1.00 77.07 H ATOM 7138 HD3 ARG A 560 -58.597 16.611 -26.711 1.00 77.07 H ATOM 7139 HE ARG A 560 -57.263 18.425 -26.295 1.00 76.77 H ATOM 7140 HH11 ARG A 560 -55.489 15.635 -26.647 1.00 69.62 H ATOM 7141 HH12 ARG A 560 -54.196 16.311 -26.946 1.00 69.62 H ATOM 7142 HH21 ARG A 560 -55.285 19.416 -26.747 1.00 78.56 H ATOM 7143 HH22 ARG A 560 -54.074 18.588 -27.006 1.00 78.56 H ATOM 7144 N THR A 561 -61.880 18.404 -23.069 1.00 73.62 N ANISOU 7144 N THR A 561 8227 9791 9954 2079 398 2091 N ATOM 7145 CA THR A 561 -63.017 19.319 -23.021 1.00 76.25 C ANISOU 7145 CA THR A 561 8472 10133 10366 2157 441 2195 C ATOM 7146 C THR A 561 -63.250 19.842 -21.610 1.00 70.54 C ANISOU 7146 C THR A 561 7766 9357 9678 2176 613 2230 C ATOM 7147 O THR A 561 -63.621 21.000 -21.425 1.00 73.39 O ANISOU 7147 O THR A 561 8122 9701 10060 2241 705 2301 O ATOM 7148 CB THR A 561 -64.312 18.647 -23.528 1.00 74.53 C ANISOU 7148 CB THR A 561 8104 9965 10249 2171 317 2244 C ATOM 7149 OG1 THR A 561 -64.319 17.264 -23.152 1.00 80.77 O ANISOU 7149 OG1 THR A 561 8871 10758 11059 2104 262 2185 O ATOM 7150 CG2 THR A 561 -64.420 18.761 -25.043 1.00 74.15 C ANISOU 7150 CG2 THR A 561 8029 9968 10177 2195 160 2256 C ATOM 7151 H THR A 561 -62.090 17.602 -23.297 1.00 88.34 H ATOM 7152 HA THR A 561 -62.832 20.080 -23.594 1.00 91.50 H ATOM 7153 HB THR A 561 -65.080 19.091 -23.133 1.00 89.44 H ATOM 7154 HG1 THR A 561 -63.657 16.872 -23.488 1.00 96.92 H ATOM 7155 HG21 THR A 561 -65.236 18.336 -25.350 1.00 88.98 H ATOM 7156 HG22 THR A 561 -64.433 19.695 -25.305 1.00 88.98 H ATOM 7157 HG23 THR A 561 -63.661 18.327 -25.463 1.00 88.98 H ATOM 7158 N LYS A 562 -63.032 18.987 -20.618 1.00 44.62 N ANISOU 7158 N LYS A 562 4509 6045 6400 2120 657 2182 N ATOM 7159 CA LYS A 562 -63.149 19.402 -19.228 1.00 49.41 C ANISOU 7159 CA LYS A 562 5154 6595 7026 2133 820 2207 C ATOM 7160 C LYS A 562 -62.043 20.405 -18.894 1.00 52.88 C ANISOU 7160 C LYS A 562 5733 6989 7368 2139 922 2177 C ATOM 7161 O LYS A 562 -62.295 21.432 -18.262 1.00 45.80 O ANISOU 7161 O LYS A 562 4863 6055 6483 2192 1047 2232 O ATOM 7162 CB LYS A 562 -63.089 18.184 -18.304 1.00 53.40 C ANISOU 7162 CB LYS A 562 5662 7079 7549 2069 830 2158 C ATOM 7163 CG LYS A 562 -63.320 18.507 -16.835 1.00 62.85 C ANISOU 7163 CG LYS A 562 6897 8213 8769 2084 994 2189 C ATOM 7164 CD LYS A 562 -63.806 17.286 -16.059 1.00 69.45 C ANISOU 7164 CD LYS A 562 7681 9041 9667 2041 992 2177 C ATOM 7165 CE LYS A 562 -62.972 17.031 -14.810 1.00 65.39 C ANISOU 7165 CE LYS A 562 7288 8465 9092 1994 1093 2121 C ATOM 7166 NZ LYS A 562 -63.003 18.169 -13.849 1.00 62.80 N ANISOU 7166 NZ LYS A 562 7038 8077 8748 2046 1257 2166 N ATOM 7167 H LYS A 562 -62.816 18.161 -20.724 1.00 53.54 H ATOM 7168 HA LYS A 562 -64.004 19.840 -19.097 1.00 59.30 H ATOM 7169 HB2 LYS A 562 -63.771 17.551 -18.578 1.00 64.08 H ATOM 7170 HB3 LYS A 562 -62.212 17.777 -18.382 1.00 64.08 H ATOM 7171 HG2 LYS A 562 -62.486 18.806 -16.438 1.00 75.42 H ATOM 7172 HG3 LYS A 562 -63.993 19.201 -16.762 1.00 75.42 H ATOM 7173 HD2 LYS A 562 -64.725 17.430 -15.784 1.00 83.34 H ATOM 7174 HD3 LYS A 562 -63.746 16.503 -16.628 1.00 83.34 H ATOM 7175 HE2 LYS A 562 -63.316 16.246 -14.356 1.00 78.47 H ATOM 7176 HE3 LYS A 562 -62.049 16.885 -15.072 1.00 78.47 H ATOM 7177 HZ1 LYS A 562 -62.505 17.979 -13.137 1.00 75.37 H ATOM 7178 HZ2 LYS A 562 -62.684 18.904 -14.237 1.00 75.37 H ATOM 7179 HZ3 LYS A 562 -63.839 18.321 -13.585 1.00 75.37 H ATOM 7180 N ILE A 563 -60.824 20.107 -19.341 1.00 53.70 N ANISOU 7180 N ILE A 563 5923 7097 7382 2085 869 2092 N ATOM 7181 CA ILE A 563 -59.684 21.001 -19.148 1.00 51.74 C ANISOU 7181 CA ILE A 563 5801 6813 7046 2084 948 2057 C ATOM 7182 C ILE A 563 -59.920 22.318 -19.872 1.00 48.18 C ANISOU 7182 C ILE A 563 5341 6373 6592 2158 968 2122 C ATOM 7183 O ILE A 563 -59.774 23.392 -19.288 1.00 43.22 O ANISOU 7183 O ILE A 563 4771 5704 5948 2197 1086 2150 O ATOM 7184 CB ILE A 563 -58.371 20.363 -19.668 1.00 39.75 C ANISOU 7184 CB ILE A 563 4358 5302 5445 2013 874 1960 C ATOM 7185 CG1 ILE A 563 -57.903 19.271 -18.711 1.00 43.20 C ANISOU 7185 CG1 ILE A 563 4833 5709 5872 1939 888 1893 C ATOM 7186 CG2 ILE A 563 -57.245 21.407 -19.819 1.00 36.96 C ANISOU 7186 CG2 ILE A 563 4111 4921 5010 2021 933 1935 C ATOM 7187 CD1 ILE A 563 -56.841 18.367 -19.291 1.00 45.83 C ANISOU 7187 CD1 ILE A 563 5209 6055 6149 1870 797 1806 C ATOM 7188 H ILE A 563 -60.630 19.384 -19.764 1.00 64.43 H ATOM 7189 HA ILE A 563 -59.578 21.188 -18.202 1.00 62.09 H ATOM 7190 HB ILE A 563 -58.542 19.964 -20.535 1.00 47.71 H ATOM 7191 HG12 ILE A 563 -57.536 19.688 -17.916 1.00 51.84 H ATOM 7192 HG13 ILE A 563 -58.664 18.719 -18.472 1.00 51.84 H ATOM 7193 HG21 ILE A 563 -56.446 20.964 -20.145 1.00 44.35 H ATOM 7194 HG22 ILE A 563 -57.528 22.087 -20.450 1.00 44.35 H ATOM 7195 HG23 ILE A 563 -57.071 21.810 -18.954 1.00 44.35 H ATOM 7196 HD11 ILE A 563 -56.596 17.702 -18.629 1.00 54.99 H ATOM 7197 HD12 ILE A 563 -57.195 17.932 -20.082 1.00 54.99 H ATOM 7198 HD13 ILE A 563 -56.066 18.902 -19.526 1.00 54.99 H ATOM 7199 N THR A 564 -60.284 22.227 -21.147 1.00 54.84 N ANISOU 7199 N THR A 564 6114 7271 7450 2179 849 2145 N ATOM 7200 CA THR A 564 -60.475 23.413 -21.976 1.00 61.29 C ANISOU 7200 CA THR A 564 6920 8105 8263 2249 851 2206 C ATOM 7201 C THR A 564 -61.564 24.327 -21.408 1.00 61.74 C ANISOU 7201 C THR A 564 6918 8142 8397 2325 950 2305 C ATOM 7202 O THR A 564 -61.341 25.522 -21.220 1.00 57.96 O ANISOU 7202 O THR A 564 6495 7633 7896 2372 1048 2337 O ATOM 7203 CB THR A 564 -60.846 23.045 -23.430 1.00 62.44 C ANISOU 7203 CB THR A 564 6992 8314 8420 2260 691 2221 C ATOM 7204 OG1 THR A 564 -59.909 22.092 -23.946 1.00 57.48 O ANISOU 7204 OG1 THR A 564 6416 7699 7725 2191 601 2131 O ATOM 7205 CG2 THR A 564 -60.839 24.289 -24.313 1.00 62.92 C ANISOU 7205 CG2 THR A 564 7060 8387 8459 2328 694 2276 C ATOM 7206 H THR A 564 -60.428 21.486 -21.559 1.00 65.80 H ATOM 7207 HA THR A 564 -59.646 23.916 -21.999 1.00 73.55 H ATOM 7208 HB THR A 564 -61.737 22.663 -23.447 1.00 74.93 H ATOM 7209 HG1 THR A 564 -59.920 21.395 -23.477 1.00 68.98 H ATOM 7210 HG21 THR A 564 -61.073 24.049 -25.224 1.00 75.50 H ATOM 7211 HG22 THR A 564 -61.483 24.934 -23.982 1.00 75.50 H ATOM 7212 HG23 THR A 564 -59.958 24.693 -24.310 1.00 75.50 H ATOM 7213 N GLU A 565 -62.735 23.753 -21.135 1.00 58.83 N ANISOU 7213 N GLU A 565 6438 7790 8125 2338 928 2356 N ATOM 7214 CA GLU A 565 -63.886 24.513 -20.643 1.00 55.08 C ANISOU 7214 CA GLU A 565 5889 7297 7741 2413 1020 2460 C ATOM 7215 C GLU A 565 -63.601 25.192 -19.309 1.00 55.47 C ANISOU 7215 C GLU A 565 6031 7273 7769 2427 1197 2464 C ATOM 7216 O GLU A 565 -64.076 26.299 -19.055 1.00 64.91 O ANISOU 7216 O GLU A 565 7225 8442 8998 2499 1299 2539 O ATOM 7217 CB GLU A 565 -65.110 23.599 -20.496 1.00 59.22 C ANISOU 7217 CB GLU A 565 6274 7849 8378 2412 965 2505 C ATOM 7218 CG GLU A 565 -65.751 23.184 -21.821 1.00 62.81 C ANISOU 7218 CG GLU A 565 6612 8375 8879 2423 792 2532 C ATOM 7219 CD GLU A 565 -66.926 22.230 -21.650 1.00 70.80 C ANISOU 7219 CD GLU A 565 7482 9413 10007 2416 731 2572 C ATOM 7220 OE1 GLU A 565 -67.207 21.815 -20.505 1.00 67.18 O ANISOU 7220 OE1 GLU A 565 7016 8917 9591 2399 827 2574 O ATOM 7221 OE2 GLU A 565 -67.570 21.897 -22.669 1.00 77.33 O ANISOU 7221 OE2 GLU A 565 8204 10296 10881 2427 585 2601 O ATOM 7222 H GLU A 565 -62.891 22.913 -21.228 1.00 70.60 H ATOM 7223 HA GLU A 565 -64.106 25.203 -21.289 1.00 66.09 H ATOM 7224 HB2 GLU A 565 -64.840 22.791 -20.033 1.00 71.06 H ATOM 7225 HB3 GLU A 565 -65.784 24.064 -19.975 1.00 71.06 H ATOM 7226 HG2 GLU A 565 -66.075 23.978 -22.275 1.00 75.37 H ATOM 7227 HG3 GLU A 565 -65.084 22.740 -22.367 1.00 75.37 H ATOM 7228 N LEU A 566 -62.834 24.522 -18.456 1.00 58.09 N ANISOU 7228 N LEU A 566 6449 7572 8049 2361 1233 2384 N ATOM 7229 CA LEU A 566 -62.509 25.054 -17.137 1.00 61.90 C ANISOU 7229 CA LEU A 566 7034 7982 8502 2367 1389 2378 C ATOM 7230 C LEU A 566 -61.403 26.106 -17.208 1.00 62.93 C ANISOU 7230 C LEU A 566 7290 8082 8539 2375 1443 2342 C ATOM 7231 O LEU A 566 -61.522 27.182 -16.619 1.00 61.71 O ANISOU 7231 O LEU A 566 7186 7878 8382 2429 1566 2384 O ATOM 7232 CB LEU A 566 -62.101 23.923 -16.189 1.00 60.54 C ANISOU 7232 CB LEU A 566 6907 7786 8311 2293 1399 2307 C ATOM 7233 CG LEU A 566 -61.478 24.348 -14.855 1.00 62.38 C ANISOU 7233 CG LEU A 566 7272 7942 8486 2284 1538 2275 C ATOM 7234 CD1 LEU A 566 -62.365 25.323 -14.094 1.00 69.44 C ANISOU 7234 CD1 LEU A 566 8164 8787 9433 2366 1684 2367 C ATOM 7235 CD2 LEU A 566 -61.209 23.132 -13.997 1.00 62.30 C ANISOU 7235 CD2 LEU A 566 7288 7915 8468 2213 1533 2214 C ATOM 7236 H LEU A 566 -62.486 23.752 -18.618 1.00 69.70 H ATOM 7237 HA LEU A 566 -63.300 25.479 -16.769 1.00 74.28 H ATOM 7238 HB2 LEU A 566 -62.890 23.398 -15.984 1.00 72.65 H ATOM 7239 HB3 LEU A 566 -61.452 23.363 -16.644 1.00 72.65 H ATOM 7240 HG LEU A 566 -60.630 24.786 -15.028 1.00 74.85 H ATOM 7241 HD11 LEU A 566 -61.930 25.561 -13.260 1.00 83.33 H ATOM 7242 HD12 LEU A 566 -62.500 26.116 -14.636 1.00 83.33 H ATOM 7243 HD13 LEU A 566 -63.218 24.897 -13.912 1.00 83.33 H ATOM 7244 HD21 LEU A 566 -60.815 23.419 -13.158 1.00 74.76 H ATOM 7245 HD22 LEU A 566 -62.046 22.672 -13.830 1.00 74.76 H ATOM 7246 HD23 LEU A 566 -60.596 22.544 -14.467 1.00 74.76 H ATOM 7247 N PHE A 567 -60.335 25.800 -17.940 1.00 59.78 N ANISOU 7247 N PHE A 567 6940 7709 8066 2322 1352 2264 N ATOM 7248 CA PHE A 567 -59.138 26.641 -17.939 1.00 56.68 C ANISOU 7248 CA PHE A 567 6667 7284 7585 2315 1398 2217 C ATOM 7249 C PHE A 567 -59.166 27.749 -18.989 1.00 56.90 C ANISOU 7249 C PHE A 567 6680 7334 7606 2376 1384 2266 C ATOM 7250 O PHE A 567 -58.358 28.674 -18.936 1.00 54.01 O ANISOU 7250 O PHE A 567 6404 6934 7183 2388 1442 2247 O ATOM 7251 CB PHE A 567 -57.877 25.778 -18.076 1.00 49.49 C ANISOU 7251 CB PHE A 567 5822 6380 6602 2227 1327 2110 C ATOM 7252 CG PHE A 567 -57.529 25.031 -16.818 1.00 43.19 C ANISOU 7252 CG PHE A 567 5081 5540 5790 2170 1375 2054 C ATOM 7253 CD1 PHE A 567 -57.006 25.704 -15.726 1.00 42.46 C ANISOU 7253 CD1 PHE A 567 5094 5380 5657 2174 1489 2034 C ATOM 7254 CD2 PHE A 567 -57.746 23.667 -16.717 1.00 43.39 C ANISOU 7254 CD2 PHE A 567 5055 5588 5841 2115 1303 2022 C ATOM 7255 CE1 PHE A 567 -56.701 25.030 -14.558 1.00 45.13 C ANISOU 7255 CE1 PHE A 567 5488 5678 5980 2125 1529 1984 C ATOM 7256 CE2 PHE A 567 -57.439 22.986 -15.550 1.00 43.98 C ANISOU 7256 CE2 PHE A 567 5182 5624 5904 2065 1348 1974 C ATOM 7257 CZ PHE A 567 -56.912 23.669 -14.472 1.00 41.26 C ANISOU 7257 CZ PHE A 567 4945 5215 5517 2070 1460 1956 C ATOM 7258 H PHE A 567 -60.278 25.108 -18.448 1.00 71.74 H ATOM 7259 HA PHE A 567 -59.085 27.078 -17.074 1.00 68.02 H ATOM 7260 HB2 PHE A 567 -58.017 25.126 -18.781 1.00 59.39 H ATOM 7261 HB3 PHE A 567 -57.127 26.351 -18.300 1.00 59.39 H ATOM 7262 HD1 PHE A 567 -56.861 26.621 -15.778 1.00 50.95 H ATOM 7263 HD2 PHE A 567 -58.101 23.202 -17.441 1.00 52.06 H ATOM 7264 HE1 PHE A 567 -56.344 25.493 -13.834 1.00 54.15 H ATOM 7265 HE2 PHE A 567 -57.584 22.069 -15.494 1.00 52.78 H ATOM 7266 HZ PHE A 567 -56.704 23.213 -13.688 1.00 49.51 H ATOM 7267 N ALA A 568 -60.099 27.670 -19.931 1.00 63.06 N ANISOU 7267 N ALA A 568 7346 8168 8447 2416 1304 2331 N ATOM 7268 CA ALA A 568 -60.297 28.771 -20.864 1.00 63.79 C ANISOU 7268 CA ALA A 568 7416 8278 8544 2484 1297 2393 C ATOM 7269 C ALA A 568 -60.762 29.984 -20.066 1.00 73.65 C ANISOU 7269 C ALA A 568 8689 9471 9822 2555 1445 2462 C ATOM 7270 O ALA A 568 -60.391 31.120 -20.362 1.00 74.57 O ANISOU 7270 O ALA A 568 8856 9569 9908 2598 1494 2483 O ATOM 7271 CB ALA A 568 -61.321 28.406 -21.923 1.00 63.67 C ANISOU 7271 CB ALA A 568 7267 8328 8597 2515 1177 2454 C ATOM 7272 H ALA A 568 -60.623 26.999 -20.051 1.00 75.67 H ATOM 7273 HA ALA A 568 -59.458 28.986 -21.301 1.00 76.55 H ATOM 7274 HB1 ALA A 568 -61.431 29.157 -22.527 1.00 76.41 H ATOM 7275 HB2 ALA A 568 -61.005 27.630 -22.413 1.00 76.41 H ATOM 7276 HB3 ALA A 568 -62.165 28.203 -21.490 1.00 76.41 H ATOM 7277 N VAL A 569 -61.563 29.718 -19.036 1.00 57.51 N ANISOU 7277 N VAL A 569 6615 7398 7840 2567 1521 2497 N ATOM 7278 CA VAL A 569 -62.126 30.756 -18.176 1.00 52.85 C ANISOU 7278 CA VAL A 569 6048 6749 7286 2638 1672 2567 C ATOM 7279 C VAL A 569 -61.205 31.085 -17.005 1.00 53.05 C ANISOU 7279 C VAL A 569 6221 6699 7235 2610 1784 2503 C ATOM 7280 O VAL A 569 -61.119 32.239 -16.580 1.00 55.95 O ANISOU 7280 O VAL A 569 6657 7013 7588 2663 1896 2533 O ATOM 7281 CB VAL A 569 -63.487 30.307 -17.588 1.00 58.10 C ANISOU 7281 CB VAL A 569 6606 7409 8058 2669 1711 2643 C ATOM 7282 CG1 VAL A 569 -64.120 31.421 -16.750 1.00 51.55 C ANISOU 7282 CG1 VAL A 569 5801 6513 7271 2751 1878 2725 C ATOM 7283 CG2 VAL A 569 -64.433 29.870 -18.697 1.00 62.02 C ANISOU 7283 CG2 VAL A 569 6946 7980 8638 2691 1584 2703 C ATOM 7284 H VAL A 569 -61.801 28.923 -18.810 1.00 69.02 H ATOM 7285 HA VAL A 569 -62.266 31.564 -18.694 1.00 63.43 H ATOM 7286 HB VAL A 569 -63.340 29.545 -17.006 1.00 69.71 H ATOM 7287 HG11 VAL A 569 -64.968 31.107 -16.398 1.00 61.86 H ATOM 7288 HG12 VAL A 569 -63.522 31.646 -16.021 1.00 61.86 H ATOM 7289 HG13 VAL A 569 -64.262 32.197 -17.314 1.00 61.86 H ATOM 7290 HG21 VAL A 569 -65.275 29.595 -18.303 1.00 74.42 H ATOM 7291 HG22 VAL A 569 -64.578 30.616 -19.300 1.00 74.42 H ATOM 7292 HG23 VAL A 569 -64.034 29.128 -19.178 1.00 74.42 H ATOM 7293 N ALA A 570 -60.524 30.066 -16.487 1.00 56.96 N ANISOU 7293 N ALA A 570 6767 7190 7686 2529 1751 2415 N ATOM 7294 CA ALA A 570 -59.751 30.200 -15.255 1.00 55.47 C ANISOU 7294 CA ALA A 570 6711 6931 7435 2499 1847 2354 C ATOM 7295 C ALA A 570 -58.337 30.708 -15.497 1.00 54.42 C ANISOU 7295 C ALA A 570 6688 6781 7210 2465 1830 2276 C ATOM 7296 O ALA A 570 -57.774 31.403 -14.652 1.00 51.49 O ANISOU 7296 O ALA A 570 6429 6342 6792 2472 1923 2248 O ATOM 7297 CB ALA A 570 -59.703 28.871 -14.522 1.00 53.66 C ANISOU 7297 CB ALA A 570 6481 6701 7206 2430 1821 2300 C ATOM 7298 H ALA A 570 -60.492 29.280 -16.834 1.00 68.36 H ATOM 7299 HA ALA A 570 -60.198 30.838 -14.677 1.00 66.57 H ATOM 7300 HB1 ALA A 570 -59.187 28.979 -13.708 1.00 64.39 H ATOM 7301 HB2 ALA A 570 -60.608 28.597 -14.307 1.00 64.39 H ATOM 7302 HB3 ALA A 570 -59.284 28.210 -15.095 1.00 64.39 H ATOM 7303 N LEU A 571 -57.757 30.361 -16.642 1.00 52.11 N ANISOU 7303 N LEU A 571 6365 6544 6892 2429 1712 2240 N ATOM 7304 CA LEU A 571 -56.360 30.707 -16.909 1.00 53.02 C ANISOU 7304 CA LEU A 571 6574 6643 6928 2389 1691 2164 C ATOM 7305 C LEU A 571 -56.094 32.216 -16.918 1.00 54.57 C ANISOU 7305 C LEU A 571 6835 6795 7105 2450 1775 2196 C ATOM 7306 O LEU A 571 -55.092 32.663 -16.358 1.00 48.48 O ANISOU 7306 O LEU A 571 6172 5970 6278 2426 1817 2137 O ATOM 7307 CB LEU A 571 -55.863 30.065 -18.212 1.00 50.68 C ANISOU 7307 CB LEU A 571 6230 6413 6613 2348 1558 2131 C ATOM 7308 CG LEU A 571 -54.417 30.376 -18.615 1.00 50.26 C ANISOU 7308 CG LEU A 571 6261 6346 6489 2309 1534 2060 C ATOM 7309 CD1 LEU A 571 -53.434 30.020 -17.502 1.00 42.25 C ANISOU 7309 CD1 LEU A 571 5344 5277 5432 2244 1568 1974 C ATOM 7310 CD2 LEU A 571 -54.067 29.631 -19.893 1.00 54.82 C ANISOU 7310 CD2 LEU A 571 6789 6988 7053 2274 1410 2034 C ATOM 7311 H LEU A 571 -58.145 29.929 -17.276 1.00 62.53 H ATOM 7312 HA LEU A 571 -55.823 30.334 -16.192 1.00 63.62 H ATOM 7313 HB2 LEU A 571 -55.936 29.102 -18.123 1.00 60.81 H ATOM 7314 HB3 LEU A 571 -56.434 30.366 -18.935 1.00 60.81 H ATOM 7315 HG LEU A 571 -54.336 31.326 -18.791 1.00 60.31 H ATOM 7316 HD11 LEU A 571 -52.535 30.231 -17.797 1.00 50.70 H ATOM 7317 HD12 LEU A 571 -53.654 30.536 -16.711 1.00 50.70 H ATOM 7318 HD13 LEU A 571 -53.506 29.072 -17.310 1.00 50.70 H ATOM 7319 HD21 LEU A 571 -53.150 29.836 -20.137 1.00 65.79 H ATOM 7320 HD22 LEU A 571 -54.163 28.678 -19.740 1.00 65.79 H ATOM 7321 HD23 LEU A 571 -54.668 29.916 -20.599 1.00 65.79 H ATOM 7322 N PRO A 572 -56.982 33.008 -17.550 1.00 56.22 N ANISOU 7322 N PRO A 572 6976 7023 7361 2529 1795 2288 N ATOM 7323 CA PRO A 572 -56.763 34.460 -17.544 1.00 51.04 C ANISOU 7323 CA PRO A 572 6382 6320 6690 2590 1880 2322 C ATOM 7324 C PRO A 572 -56.749 35.032 -16.129 1.00 49.14 C ANISOU 7324 C PRO A 572 6242 5993 6437 2610 2012 2315 C ATOM 7325 O PRO A 572 -55.949 35.921 -15.834 1.00 45.50 O ANISOU 7325 O PRO A 572 5882 5477 5930 2618 2064 2283 O ATOM 7326 CB PRO A 572 -57.954 34.999 -18.341 1.00 53.26 C ANISOU 7326 CB PRO A 572 6555 6639 7042 2673 1878 2433 C ATOM 7327 CG PRO A 572 -58.389 33.845 -19.202 1.00 49.82 C ANISOU 7327 CG PRO A 572 6009 6285 6638 2640 1747 2435 C ATOM 7328 CD PRO A 572 -58.151 32.632 -18.366 1.00 53.43 C ANISOU 7328 CD PRO A 572 6487 6734 7080 2565 1730 2365 C ATOM 7329 HA PRO A 572 -55.936 34.685 -17.998 1.00 61.25 H ATOM 7330 HB2 PRO A 572 -58.664 35.262 -17.734 1.00 63.91 H ATOM 7331 HB3 PRO A 572 -57.672 35.749 -18.888 1.00 63.91 H ATOM 7332 HG2 PRO A 572 -59.330 33.933 -19.419 1.00 59.79 H ATOM 7333 HG3 PRO A 572 -57.851 33.817 -20.009 1.00 59.79 H ATOM 7334 HD2 PRO A 572 -58.918 32.456 -17.798 1.00 64.12 H ATOM 7335 HD3 PRO A 572 -57.941 31.869 -18.927 1.00 64.12 H ATOM 7336 N GLN A 573 -57.609 34.508 -15.262 1.00 51.25 N ANISOU 7336 N GLN A 573 6484 6245 6744 2619 2065 2342 N ATOM 7337 CA GLN A 573 -57.630 34.928 -13.866 1.00 54.41 C ANISOU 7337 CA GLN A 573 6988 6560 7126 2637 2193 2333 C ATOM 7338 C GLN A 573 -56.364 34.447 -13.174 1.00 52.80 C ANISOU 7338 C GLN A 573 6896 6321 6843 2556 2169 2218 C ATOM 7339 O GLN A 573 -55.821 35.131 -12.307 1.00 55.35 O ANISOU 7339 O GLN A 573 7341 6568 7120 2564 2247 2182 O ATOM 7340 CB GLN A 573 -58.838 34.346 -13.134 1.00 58.84 C ANISOU 7340 CB GLN A 573 7492 7115 7750 2661 2252 2391 C ATOM 7341 CG GLN A 573 -60.152 34.476 -13.868 1.00 63.28 C ANISOU 7341 CG GLN A 573 7911 7723 8408 2727 2245 2503 C ATOM 7342 CD GLN A 573 -61.284 33.802 -13.120 1.00 62.53 C ANISOU 7342 CD GLN A 573 7753 7619 8385 2743 2300 2556 C ATOM 7343 OE1 GLN A 573 -61.995 32.959 -13.669 1.00 64.11 O ANISOU 7343 OE1 GLN A 573 7826 7882 8653 2732 2218 2590 O ATOM 7344 NE2 GLN A 573 -61.450 34.162 -11.852 1.00 62.75 N ANISOU 7344 NE2 GLN A 573 7875 7567 8401 2770 2440 2564 N ATOM 7345 H GLN A 573 -58.192 33.907 -15.457 1.00 61.50 H ATOM 7346 HA GLN A 573 -57.668 35.896 -13.813 1.00 65.29 H ATOM 7347 HB2 GLN A 573 -58.680 33.401 -12.981 1.00 70.61 H ATOM 7348 HB3 GLN A 573 -58.932 34.802 -12.283 1.00 70.61 H ATOM 7349 HG2 GLN A 573 -60.372 35.415 -13.967 1.00 75.93 H ATOM 7350 HG3 GLN A 573 -60.074 34.057 -14.739 1.00 75.93 H ATOM 7351 HE21 GLN A 573 -60.929 34.749 -11.500 1.00 75.30 H ATOM 7352 HE22 GLN A 573 -62.078 33.809 -11.383 1.00 75.30 H ATOM 7353 N LEU A 574 -55.902 33.262 -13.564 1.00 48.55 N ANISOU 7353 N LEU A 574 6317 5837 6294 2479 2057 2159 N ATOM 7354 CA LEU A 574 -54.727 32.650 -12.951 1.00 46.24 C ANISOU 7354 CA LEU A 574 6112 5517 5939 2397 2021 2052 C ATOM 7355 C LEU A 574 -53.452 33.419 -13.278 1.00 46.74 C ANISOU 7355 C LEU A 574 6257 5553 5951 2380 1999 1996 C ATOM 7356 O LEU A 574 -52.601 33.617 -12.412 1.00 43.48 O ANISOU 7356 O LEU A 574 5955 5075 5491 2351 2026 1929 O ATOM 7357 CB LEU A 574 -54.582 31.197 -13.408 1.00 44.89 C ANISOU 7357 CB LEU A 574 5867 5412 5778 2323 1906 2010 C ATOM 7358 CG LEU A 574 -55.310 30.144 -12.569 1.00 45.35 C ANISOU 7358 CG LEU A 574 5894 5470 5866 2302 1924 2015 C ATOM 7359 CD1 LEU A 574 -55.325 28.795 -13.293 1.00 37.17 C ANISOU 7359 CD1 LEU A 574 4765 4507 4852 2241 1801 1990 C ATOM 7360 CD2 LEU A 574 -54.684 30.018 -11.175 1.00 43.33 C ANISOU 7360 CD2 LEU A 574 5762 5142 5560 2269 1985 1947 C ATOM 7361 H LEU A 574 -56.255 32.787 -14.188 1.00 58.26 H ATOM 7362 HA LEU A 574 -54.838 32.651 -11.987 1.00 55.49 H ATOM 7363 HB2 LEU A 574 -54.921 31.128 -14.314 1.00 53.87 H ATOM 7364 HB3 LEU A 574 -53.639 30.969 -13.399 1.00 53.87 H ATOM 7365 HG LEU A 574 -56.232 30.425 -12.453 1.00 54.42 H ATOM 7366 HD11 LEU A 574 -55.791 28.147 -12.742 1.00 44.60 H ATOM 7367 HD12 LEU A 574 -55.782 28.898 -14.142 1.00 44.60 H ATOM 7368 HD13 LEU A 574 -54.411 28.507 -13.441 1.00 44.60 H ATOM 7369 HD21 LEU A 574 -55.168 29.345 -10.671 1.00 52.00 H ATOM 7370 HD22 LEU A 574 -53.754 29.757 -11.269 1.00 52.00 H ATOM 7371 HD23 LEU A 574 -54.743 30.875 -10.724 1.00 52.00 H ATOM 7372 N LEU A 575 -53.319 33.844 -14.529 1.00 48.70 N ANISOU 7372 N LEU A 575 6449 5845 6208 2398 1946 2025 N ATOM 7373 CA LEU A 575 -52.170 34.641 -14.928 1.00 50.28 C ANISOU 7373 CA LEU A 575 6717 6018 6370 2388 1930 1985 C ATOM 7374 C LEU A 575 -52.212 35.983 -14.208 1.00 54.10 C ANISOU 7374 C LEU A 575 7293 6420 6844 2450 2041 2009 C ATOM 7375 O LEU A 575 -51.193 36.454 -13.710 1.00 53.79 O ANISOU 7375 O LEU A 575 7355 6317 6764 2425 2051 1947 O ATOM 7376 CB LEU A 575 -52.145 34.843 -16.447 1.00 52.22 C ANISOU 7376 CB LEU A 575 6882 6329 6629 2405 1861 2023 C ATOM 7377 CG LEU A 575 -51.753 33.625 -17.289 1.00 51.05 C ANISOU 7377 CG LEU A 575 6671 6251 6474 2339 1743 1982 C ATOM 7378 CD1 LEU A 575 -51.936 33.921 -18.771 1.00 48.80 C ANISOU 7378 CD1 LEU A 575 6314 6027 6201 2373 1687 2033 C ATOM 7379 CD2 LEU A 575 -50.316 33.204 -17.001 1.00 48.58 C ANISOU 7379 CD2 LEU A 575 6432 5909 6119 2259 1702 1883 C ATOM 7380 H LEU A 575 -53.878 33.685 -15.162 1.00 58.43 H ATOM 7381 HA LEU A 575 -51.355 34.182 -14.669 1.00 60.34 H ATOM 7382 HB2 LEU A 575 -53.031 35.116 -16.731 1.00 62.66 H ATOM 7383 HB3 LEU A 575 -51.512 35.549 -16.649 1.00 62.66 H ATOM 7384 HG LEU A 575 -52.333 32.883 -17.059 1.00 61.26 H ATOM 7385 HD11 LEU A 575 -51.682 33.137 -19.283 1.00 58.56 H ATOM 7386 HD12 LEU A 575 -52.867 34.138 -18.937 1.00 58.56 H ATOM 7387 HD13 LEU A 575 -51.373 34.673 -19.015 1.00 58.56 H ATOM 7388 HD21 LEU A 575 -50.098 32.434 -17.548 1.00 58.30 H ATOM 7389 HD22 LEU A 575 -49.723 33.941 -17.215 1.00 58.30 H ATOM 7390 HD23 LEU A 575 -50.237 32.977 -16.062 1.00 58.30 H ATOM 7391 N ALA A 576 -53.399 36.581 -14.144 1.00 54.92 N ANISOU 7391 N ALA A 576 7359 6520 6988 2530 2122 2099 N ATOM 7392 CA ALA A 576 -53.590 37.851 -13.448 1.00 48.87 C ANISOU 7392 CA ALA A 576 6681 5672 6216 2598 2240 2131 C ATOM 7393 C ALA A 576 -53.051 37.796 -12.021 1.00 49.80 C ANISOU 7393 C ALA A 576 6931 5706 6286 2568 2294 2059 C ATOM 7394 O ALA A 576 -52.272 38.656 -11.608 1.00 47.10 O ANISOU 7394 O ALA A 576 6699 5290 5907 2573 2324 2019 O ATOM 7395 CB ALA A 576 -55.064 38.222 -13.434 1.00 48.94 C ANISOU 7395 CB ALA A 576 6620 5690 6286 2683 2324 2241 C ATOM 7396 H ALA A 576 -54.117 36.269 -14.501 1.00 65.90 H ATOM 7397 HA ALA A 576 -53.110 38.547 -13.923 1.00 58.65 H ATOM 7398 HB1 ALA A 576 -55.171 39.067 -12.968 1.00 58.73 H ATOM 7399 HB2 ALA A 576 -55.377 38.306 -14.348 1.00 58.73 H ATOM 7400 HB3 ALA A 576 -55.560 37.526 -12.976 1.00 58.73 H ATOM 7401 N LYS A 577 -53.464 36.773 -11.279 1.00 52.04 N ANISOU 7401 N LYS A 577 7205 5996 6570 2537 2299 2041 N ATOM 7402 CA LYS A 577 -53.071 36.627 -9.883 1.00 47.81 C ANISOU 7402 CA LYS A 577 6796 5383 5986 2512 2351 1976 C ATOM 7403 C LYS A 577 -51.569 36.434 -9.713 1.00 49.49 C ANISOU 7403 C LYS A 577 7091 5567 6147 2434 2267 1868 C ATOM 7404 O LYS A 577 -50.961 37.051 -8.840 1.00 53.87 O ANISOU 7404 O LYS A 577 7778 6033 6657 2435 2306 1819 O ATOM 7405 CB LYS A 577 -53.812 35.448 -9.248 1.00 46.56 C ANISOU 7405 CB LYS A 577 6596 5249 5846 2490 2364 1983 C ATOM 7406 CG LYS A 577 -53.409 35.173 -7.806 1.00 47.80 C ANISOU 7406 CG LYS A 577 6886 5329 5946 2462 2412 1914 C ATOM 7407 CD LYS A 577 -54.556 34.581 -6.991 1.00 46.69 C ANISOU 7407 CD LYS A 577 6726 5182 5830 2488 2499 1964 C ATOM 7408 CE LYS A 577 -54.091 34.139 -5.608 1.00 57.93 C ANISOU 7408 CE LYS A 577 8284 6537 7190 2451 2533 1888 C ATOM 7409 NZ LYS A 577 -53.230 35.153 -4.933 1.00 59.08 N ANISOU 7409 NZ LYS A 577 8595 6588 7266 2461 2570 1830 N ATOM 7410 H LYS A 577 -53.977 36.145 -11.564 1.00 62.44 H ATOM 7411 HA LYS A 577 -53.323 37.431 -9.402 1.00 57.37 H ATOM 7412 HB2 LYS A 577 -54.764 35.635 -9.260 1.00 55.87 H ATOM 7413 HB3 LYS A 577 -53.627 34.648 -9.766 1.00 55.87 H ATOM 7414 HG2 LYS A 577 -52.674 34.540 -7.797 1.00 57.36 H ATOM 7415 HG3 LYS A 577 -53.139 36.005 -7.387 1.00 57.36 H ATOM 7416 HD2 LYS A 577 -55.248 35.251 -6.880 1.00 56.02 H ATOM 7417 HD3 LYS A 577 -54.910 33.806 -7.454 1.00 56.02 H ATOM 7418 HE2 LYS A 577 -54.868 33.987 -5.048 1.00 69.52 H ATOM 7419 HE3 LYS A 577 -53.578 33.321 -5.693 1.00 69.52 H ATOM 7420 HZ1 LYS A 577 -52.982 34.857 -4.132 1.00 70.90 H ATOM 7421 HZ2 LYS A 577 -52.502 35.308 -5.422 1.00 70.90 H ATOM 7422 HZ3 LYS A 577 -53.679 35.915 -4.833 1.00 70.90 H ATOM 7423 N TYR A 578 -50.976 35.592 -10.557 1.00 53.01 N ANISOU 7423 N TYR A 578 7460 6081 6601 2368 2149 1831 N ATOM 7424 CA TYR A 578 -49.599 35.136 -10.354 1.00 50.31 C ANISOU 7424 CA TYR A 578 7176 5715 6223 2285 2062 1731 C ATOM 7425 C TYR A 578 -48.596 35.697 -11.362 1.00 47.86 C ANISOU 7425 C TYR A 578 6856 5413 5914 2267 1994 1714 C ATOM 7426 O TYR A 578 -47.459 35.235 -11.415 1.00 48.87 O ANISOU 7426 O TYR A 578 7007 5533 6029 2195 1911 1643 O ATOM 7427 CB TYR A 578 -49.551 33.603 -10.398 1.00 41.52 C ANISOU 7427 CB TYR A 578 5995 4662 5117 2214 1983 1694 C ATOM 7428 CG TYR A 578 -50.422 32.929 -9.355 1.00 36.37 C ANISOU 7428 CG TYR A 578 5354 3999 4466 2221 2044 1704 C ATOM 7429 CD1 TYR A 578 -50.048 32.906 -8.015 1.00 37.45 C ANISOU 7429 CD1 TYR A 578 5615 4057 4559 2204 2084 1647 C ATOM 7430 CD2 TYR A 578 -51.616 32.314 -9.712 1.00 38.27 C ANISOU 7430 CD2 TYR A 578 5484 4304 4753 2245 2058 1773 C ATOM 7431 CE1 TYR A 578 -50.843 32.295 -7.061 1.00 39.26 C ANISOU 7431 CE1 TYR A 578 5858 4273 4784 2214 2148 1660 C ATOM 7432 CE2 TYR A 578 -52.419 31.701 -8.762 1.00 43.50 C ANISOU 7432 CE2 TYR A 578 6153 4953 5424 2252 2118 1790 C ATOM 7433 CZ TYR A 578 -52.026 31.695 -7.440 1.00 45.35 C ANISOU 7433 CZ TYR A 578 6513 5110 5608 2238 2169 1733 C ATOM 7434 OH TYR A 578 -52.817 31.082 -6.498 1.00 49.22 O ANISOU 7434 OH TYR A 578 7014 5584 6104 2247 2237 1753 O ATOM 7435 H TYR A 578 -51.350 35.268 -11.260 1.00 63.61 H ATOM 7436 HA TYR A 578 -49.311 35.413 -9.470 1.00 60.37 H ATOM 7437 HB2 TYR A 578 -49.852 33.306 -11.271 1.00 49.82 H ATOM 7438 HB3 TYR A 578 -48.637 33.315 -10.250 1.00 49.82 H ATOM 7439 HD1 TYR A 578 -49.253 33.312 -7.756 1.00 44.94 H ATOM 7440 HD2 TYR A 578 -51.885 32.319 -10.602 1.00 45.92 H ATOM 7441 HE1 TYR A 578 -50.580 32.288 -6.169 1.00 47.11 H ATOM 7442 HE2 TYR A 578 -53.216 31.293 -9.016 1.00 52.20 H ATOM 7443 HH TYR A 578 -53.502 30.760 -6.863 1.00 59.07 H ATOM 7444 N SER A 579 -49.000 36.703 -12.133 1.00 54.31 N ATOM 7445 CA SER A 579 -48.165 37.223 -13.219 1.00 52.48 C ATOM 7446 C SER A 579 -46.749 37.631 -12.798 1.00 54.86 C ATOM 7447 O SER A 579 -45.812 37.531 -13.591 1.00 50.73 O ATOM 7448 CB SER A 579 -48.836 38.426 -13.885 1.00 52.16 C ATOM 7449 OG SER A 579 -49.185 39.403 -12.920 1.00 57.10 O ATOM 7450 H SER A 579 -49.756 37.106 -12.049 1.00 65.17 H ATOM 7451 HA SER A 579 -48.077 36.531 -13.893 1.00 62.98 H ATOM 7452 HB2 SER A 579 -48.221 38.818 -14.523 1.00 62.60 H ATOM 7453 HB3 SER A 579 -49.640 38.128 -14.338 1.00 62.60 H ATOM 7454 HG SER A 579 -49.553 40.058 -13.295 1.00 68.52 H