>>4PK7:HELIX   52 AF7 ALA A  998  SER A 1004  1                                   7    
AFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQMSLRREVWLPLMSYRNSKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPL
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 52 AF7 ALA A 998 SER A 1004 1 7 ATOM 13900 N ALA A 998 -7.498 106.027 54.078 1.00 68.99 N ANISOU13900 N ALA A 998 7931 9677 8606 1362 -382 2149 N ATOM 13901 CA ALA A 998 -6.737 106.649 55.163 1.00 68.57 C ANISOU13901 CA ALA A 998 7925 9639 8491 1478 -362 2072 C ATOM 13902 C ALA A 998 -5.256 106.798 54.801 1.00 69.63 C ANISOU13902 C ALA A 998 8144 9740 8571 1421 -407 1998 C ATOM 13903 O ALA A 998 -4.516 107.539 55.460 1.00 60.36 O ANISOU13903 O ALA A 998 7016 8556 7361 1499 -424 1925 O ATOM 13904 CB ALA A 998 -6.897 105.856 56.448 1.00 62.22 C ANISOU13904 CB ALA A 998 7097 8900 7643 1584 -253 2087 C ATOM 13905 H ALA A 998 -7.713 105.205 54.211 1.00 82.79 H ATOM 13906 HA ALA A 998 -7.091 107.538 55.320 1.00 82.29 H ATOM 13907 HB1 ALA A 998 -6.385 106.287 57.151 1.00 74.66 H ATOM 13908 HB2 ALA A 998 -7.836 105.833 56.690 1.00 74.66 H ATOM 13909 HB3 ALA A 998 -6.569 104.954 56.305 1.00 74.66 H ATOM 13910 N PHE A 999 -4.841 106.109 53.735 1.00 68.48 N ANISOU13910 N PHE A 999 8017 9576 8426 1287 -430 2016 N ATOM 13911 CA PHE A 999 -3.433 106.034 53.356 1.00 62.08 C ANISOU13911 CA PHE A 999 7280 8744 7565 1226 -457 1956 C ATOM 13912 C PHE A 999 -2.866 107.366 52.881 1.00 67.04 C ANISOU13912 C PHE A 999 7946 9319 8206 1210 -544 1913 C ATOM 13913 O PHE A 999 -1.642 107.538 52.811 1.00 57.86 O ANISOU13913 O PHE A 999 6840 8137 7008 1187 -565 1856 O ATOM 13914 CB PHE A 999 -3.235 104.978 52.271 1.00 53.04 C ANISOU13914 CB PHE A 999 6139 7598 6416 1093 -462 1988 C ATOM 13915 CG PHE A 999 -1.815 104.496 52.146 1.00 50.21 C ANISOU13915 CG PHE A 999 5845 7237 5997 1047 -455 1929 C ATOM 13916 CD1 PHE A 999 -1.185 103.873 53.206 1.00 62.91 C ANISOU13916 CD1 PHE A 999 7473 8872 7558 1114 -391 1890 C ATOM 13917 CD2 PHE A 999 -1.116 104.650 50.968 1.00 55.19 C ANISOU13917 CD2 PHE A 999 6512 7841 6617 939 -512 1916 C ATOM 13918 CE1 PHE A 999 0.118 103.423 53.092 1.00 65.88 C ANISOU13918 CE1 PHE A 999 7904 9242 7885 1072 -387 1834 C ATOM 13919 CE2 PHE A 999 0.183 104.196 50.851 1.00 59.86 C ANISOU13919 CE2 PHE A 999 7155 8433 7156 899 -501 1863 C ATOM 13920 CZ PHE A 999 0.798 103.584 51.917 1.00 61.28 C ANISOU13920 CZ PHE A 999 7353 8634 7298 965 -441 1820 C ATOM 13921 H PHE A 999 -5.365 105.673 53.211 1.00 82.18 H ATOM 13922 HA PHE A 999 -2.919 105.758 54.131 1.00 74.50 H ATOM 13923 HB2 PHE A 999 -3.792 104.210 52.477 1.00 63.65 H ATOM 13924 HB3 PHE A 999 -3.497 105.354 51.416 1.00 63.65 H ATOM 13925 HD1 PHE A 999 -1.641 103.759 54.008 1.00 75.49 H ATOM 13926 HD2 PHE A 999 -1.525 105.062 50.242 1.00 66.23 H ATOM 13927 HE1 PHE A 999 0.531 103.008 53.815 1.00 79.05 H ATOM 13928 HE2 PHE A 999 0.644 104.310 50.051 1.00 71.83 H ATOM 13929 HZ PHE A 999 1.674 103.282 51.839 1.00 73.54 H ATOM 13930 N LEU A1000 -3.747 108.310 52.571 1.00 54.44 N ANISOU13930 N LEU A1000 6317 7700 6670 1224 -598 1942 N ATOM 13931 CA LEU A1000 -3.308 109.575 52.019 1.00 56.30 C ANISOU13931 CA LEU A1000 6581 7880 6933 1199 -689 1916 C ATOM 13932 C LEU A1000 -2.848 110.507 53.117 1.00 60.05 C ANISOU13932 C LEU A1000 7076 8337 7402 1324 -704 1843 C ATOM 13933 O LEU A1000 -2.200 111.514 52.840 1.00 76.85 O ANISOU13933 O LEU A1000 9234 10412 9554 1312 -780 1808 O ATOM 13934 CB LEU A1000 -4.415 110.242 51.212 1.00 73.86 C ANISOU13934 CB LEU A1000 8760 10076 9226 1162 -752 1975 C ATOM 13935 CG LEU A1000 -4.891 109.534 49.941 1.00 74.91 C ANISOU13935 CG LEU A1000 8878 10213 9372 1035 -767 2043 C ATOM 13936 CD1 LEU A1000 -5.646 108.287 50.241 1.00 82.01 C ANISOU13936 CD1 LEU A1000 9731 11158 10271 1042 -692 2084 C ATOM 13937 CD2 LEU A1000 -5.821 110.424 49.191 1.00 78.08 C ANISOU13937 CD2 LEU A1000 9247 10577 9843 1007 -846 2090 C ATOM 13938 H LEU A1000 -4.598 108.240 52.672 1.00 65.33 H ATOM 13939 HA LEU A1000 -2.558 109.416 51.426 1.00 67.57 H ATOM 13940 HB2 LEU A1000 -5.188 110.340 51.788 1.00 88.63 H ATOM 13941 HB3 LEU A1000 -4.103 111.121 50.946 1.00 88.63 H ATOM 13942 HG LEU A1000 -4.134 109.318 49.375 1.00 89.89 H ATOM 13943 HD11 LEU A1000 -5.925 107.878 49.407 1.00 98.41 H ATOM 13944 HD12 LEU A1000 -5.070 107.679 50.731 1.00 98.41 H ATOM 13945 HD13 LEU A1000 -6.424 108.510 50.777 1.00 98.41 H ATOM 13946 HD21 LEU A1000 -6.117 109.966 48.389 1.00 93.69 H ATOM 13947 HD22 LEU A1000 -6.583 110.630 49.755 1.00 93.69 H ATOM 13948 HD23 LEU A1000 -5.354 111.240 48.954 1.00 93.69 H ATOM 13949 N ASP A1001 -3.183 110.187 54.362 1.00 63.34 N ANISOU13949 N ASP A1001 7477 8799 7791 1447 -635 1822 N ATOM 13950 CA ASP A1001 -2.659 110.966 55.476 1.00 84.26 C ANISOU13950 CA ASP A1001 10155 11437 10422 1578 -650 1740 C ATOM 13951 C ASP A1001 -1.220 110.522 55.716 1.00 83.87 C ANISOU13951 C ASP A1001 10168 11381 10317 1560 -637 1680 C ATOM 13952 O ASP A1001 -0.401 111.288 56.237 1.00 85.88 O ANISOU13952 O ASP A1001 10461 11599 10570 1623 -685 1604 O ATOM 13953 CB ASP A1001 -3.509 110.804 56.739 1.00 91.25 C ANISOU13953 CB ASP A1001 11004 12381 11284 1728 -579 1738 C ATOM 13954 CG ASP A1001 -3.574 112.085 57.568 1.00 99.25 C ANISOU13954 CG ASP A1001 12025 13373 12314 1869 -633 1667 C ATOM 13955 OD1 ASP A1001 -3.575 113.188 56.973 1.00 95.46 O ANISOU13955 OD1 ASP A1001 11545 12828 11899 1840 -732 1653 O ATOM 13956 OD2 ASP A1001 -3.625 111.988 58.815 1.00102.77 O ANISOU13956 OD2 ASP A1001 12478 13861 12708 2002 -577 1617 O ATOM 13957 H ASP A1001 -3.700 109.537 54.585 1.00 76.01 H ATOM 13958 HA ASP A1001 -2.651 111.905 55.234 1.00101.11 H ATOM 13959 HB2 ASP A1001 -4.414 110.565 56.483 1.00109.50 H ATOM 13960 HB3 ASP A1001 -3.125 110.106 57.293 1.00109.50 H ATOM 13961 N ILE A1002 -0.928 109.282 55.316 1.00 84.80 N ANISOU13961 N ILE A1002 10293 11531 10398 1473 -580 1712 N ATOM 13962 CA ILE A1002 0.435 108.761 55.284 1.00 75.24 C ANISOU13962 CA ILE A1002 9137 10311 9142 1427 -571 1663 C ATOM 13963 C ILE A1002 1.133 109.291 54.036 1.00 73.54 C ANISOU13963 C ILE A1002 8943 10041 8958 1303 -646 1667 C ATOM 13964 O ILE A1002 2.269 109.771 54.103 1.00 61.20 O ANISOU13964 O ILE A1002 7420 8438 7394 1301 -685 1610 O ATOM 13965 CB ILE A1002 0.449 107.220 55.256 1.00 61.07 C ANISOU13965 CB ILE A1002 7337 8567 7301 1378 -487 1697 C ATOM 13966 CG1 ILE A1002 -0.273 106.671 56.480 1.00 71.08 C ANISOU13966 CG1 ILE A1002 8577 9892 8539 1498 -406 1711 C ATOM 13967 CG2 ILE A1002 1.873 106.687 55.198 1.00 70.90 C ANISOU13967 CG2 ILE A1002 8635 9800 8502 1331 -481 1643 C ATOM 13968 CD1 ILE A1002 -0.540 105.184 56.421 1.00 81.65 C ANISOU13968 CD1 ILE A1002 9892 11275 9856 1448 -329 1766 C ATOM 13969 H ILE A1002 -1.518 108.714 55.053 1.00101.76 H ATOM 13970 HA ILE A1002 0.921 109.064 56.067 1.00 90.29 H ATOM 13971 HB ILE A1002 -0.023 106.923 54.462 1.00 73.29 H ATOM 13972 HG12 ILE A1002 0.270 106.844 57.265 1.00 85.30 H ATOM 13973 HG13 ILE A1002 -1.128 107.122 56.566 1.00 85.30 H ATOM 13974 HG21 ILE A1002 1.847 105.718 55.182 1.00 85.07 H ATOM 13975 HG22 ILE A1002 2.303 107.021 54.395 1.00 85.07 H ATOM 13976 HG23 ILE A1002 2.356 106.992 55.983 1.00 85.07 H ATOM 13977 HD11 ILE A1002 -1.000 104.914 57.232 1.00 97.98 H ATOM 13978 HD12 ILE A1002 -1.094 104.993 55.648 1.00 97.98 H ATOM 13979 HD13 ILE A1002 0.305 104.714 56.348 1.00 97.98 H ATOM 13980 N LEU A1003 0.451 109.209 52.897 1.00 62.09 N ANISOU13980 N LEU A1003 7465 8589 7538 1203 -666 1738 N ATOM 13981 CA LEU A1003 1.036 109.671 51.642 1.00 65.85 C ANISOU13981 CA LEU A1003 7961 9026 8035 1085 -731 1755 C ATOM 13982 C LEU A1003 1.292 111.172 51.707 1.00 77.11 C ANISOU13982 C LEU A1003 9394 10389 9517 1122 -817 1729 C ATOM 13983 O LEU A1003 2.187 111.681 51.046 1.00 76.79 O ANISOU13983 O LEU A1003 9378 10308 9492 1053 -867 1723 O ATOM 13984 CB LEU A1003 0.133 109.329 50.453 1.00 56.00 C ANISOU13984 CB LEU A1003 6683 7791 6804 985 -743 1836 C ATOM 13985 CG LEU A1003 0.767 109.436 49.064 1.00 55.33 C ANISOU13985 CG LEU A1003 6623 7687 6711 854 -789 1862 C ATOM 13986 CD1 LEU A1003 2.043 108.617 48.956 1.00 55.48 C ANISOU13986 CD1 LEU A1003 6683 7724 6671 806 -748 1822 C ATOM 13987 CD2 LEU A1003 -0.216 108.991 48.000 1.00 62.52 C ANISOU13987 CD2 LEU A1003 7508 8616 7631 773 -802 1935 C ATOM 13988 H LEU A1003 -0.346 108.892 52.823 1.00 74.51 H ATOM 13989 HA LEU A1003 1.888 109.227 51.508 1.00 79.02 H ATOM 13990 HB2 LEU A1003 -0.175 108.415 50.559 1.00 67.20 H ATOM 13991 HB3 LEU A1003 -0.629 109.929 50.469 1.00 67.20 H ATOM 13992 HG LEU A1003 0.992 110.364 48.893 1.00 66.39 H ATOM 13993 HD11 LEU A1003 2.406 108.716 48.062 1.00 66.57 H ATOM 13994 HD12 LEU A1003 2.682 108.940 49.610 1.00 66.57 H ATOM 13995 HD13 LEU A1003 1.836 107.685 49.128 1.00 66.57 H ATOM 13996 HD21 LEU A1003 0.206 109.067 47.130 1.00 75.03 H ATOM 13997 HD22 LEU A1003 -0.466 108.069 48.168 1.00 75.03 H ATOM 13998 HD23 LEU A1003 -1.001 109.559 48.038 1.00 75.03 H ATOM 13999 N SER A1004 0.508 111.866 52.527 1.00 90.06 N ANISOU13999 N SER A1004 11008 12021 11191 1235 -834 1714 N ATOM 14000 CA SER A1004 0.663 113.303 52.750 1.00 81.18 C ANISOU14000 CA SER A1004 9885 10831 10128 1291 -924 1679 C ATOM 14001 C SER A1004 2.035 113.702 53.322 1.00 76.00 C ANISOU14001 C SER A1004 9272 10133 9470 1330 -954 1598 C ATOM 14002 O SER A1004 2.400 114.874 53.291 1.00 70.36 O ANISOU14002 O SER A1004 8562 9351 8821 1349 -1042 1573 O ATOM 14003 CB SER A1004 -0.444 113.794 53.689 1.00 80.67 C ANISOU14003 CB SER A1004 9784 10779 10087 1426 -924 1664 C ATOM 14004 OG SER A1004 -0.122 115.053 54.251 1.00 79.76 O ANISOU14004 OG SER A1004 9678 10604 10021 1515 -1006 1601 O ATOM 14005 H SER A1004 -0.138 111.519 52.977 1.00108.08 H ATOM 14006 HA SER A1004 0.554 113.761 51.902 1.00 97.41 H ATOM 14007 HB2 SER A1004 -1.269 113.876 53.186 1.00 96.80 H ATOM 14008 HB3 SER A1004 -0.557 113.150 54.406 1.00 96.80 H ATOM 14009 HG SER A1004 -0.739 115.306 54.762 1.00 95.71 H ATOM 14010 N GLU A1005 2.794 112.741 53.842 1.00 85.78 N ANISOU14010 N GLU A1005 10540 11407 10643 1342 -886 1559 N ATOM 14011 CA GLU A1005 4.107 113.041 54.427 1.00 89.55 C ANISOU14011 CA GLU A1005 11058 11844 11122 1383 -915 1479 C ATOM 14012 C GLU A1005 5.172 113.282 53.353 1.00 95.06 C ANISOU14012 C GLU A1005 11771 12496 11852 1254 -958 1498 C ATOM 14013 O GLU A1005 6.237 113.853 53.627 1.00 92.78 O ANISOU14013 O GLU A1005 11503 12151 11598 1272 -1008 1444 O ATOM 14014 CB GLU A1005 4.559 111.908 55.357 1.00 77.92 C ANISOU14014 CB GLU A1005 9613 10423 9570 1441 -830 1431 C ATOM 14015 CG GLU A1005 3.721 111.750 56.622 1.00 85.82 C ANISOU14015 CG GLU A1005 10604 11471 10534 1591 -785 1405 C ATOM 14016 CD GLU A1005 3.937 112.872 57.626 1.00 90.55 C ANISOU14016 CD GLU A1005 11218 12025 11161 1732 -855 1321 C ATOM 14017 OE1 GLU A1005 3.231 112.879 58.662 1.00 91.61 O ANISOU14017 OE1 GLU A1005 11345 12201 11261 1868 -822 1296 O ATOM 14018 OE2 GLU A1005 4.812 113.737 57.382 1.00 85.11 O ANISOU14018 OE2 GLU A1005 10547 11260 10532 1710 -942 1281 O ATOM 14019 H GLU A1005 2.576 111.910 53.871 1.00102.93 H ATOM 14020 HA GLU A1005 4.035 113.849 54.958 1.00107.46 H ATOM 14021 HB2 GLU A1005 4.515 111.071 54.869 1.00 93.51 H ATOM 14022 HB3 GLU A1005 5.474 112.079 55.631 1.00 93.51 H ATOM 14023 HG2 GLU A1005 2.782 111.743 56.379 1.00102.99 H ATOM 14024 HG3 GLU A1005 3.957 110.914 57.054 1.00102.99 H ATOM 14025 N PHE A1006 4.870 112.845 52.132 1.00 80.78 N ANISOU14025 N PHE A1006 9950 10713 10031 1128 -939 1576 N ATOM 14026 CA PHE A1006 5.822 112.885 51.029 1.00 73.54 C ANISOU14026 CA PHE A1006 9046 9774 9122 1003 -959 1607 C ATOM 14027 C PHE A1006 5.543 114.026 50.057 1.00 86.79 C ANISOU14027 C PHE A1006 10703 11402 10870 938 -1042 1670 C ATOM 14028 O PHE A1006 6.387 114.356 49.220 1.00 83.00 O ANISOU14028 O PHE A1006 10230 10895 10413 849 -1072 1699 O ATOM 14029 CB PHE A1006 5.771 111.574 50.249 1.00 71.60 C ANISOU14029 CB PHE A1006 8805 9595 8803 906 -884 1648 C ATOM 14030 CG PHE A1006 6.177 110.371 51.045 1.00 72.03 C ANISOU14030 CG PHE A1006 8880 9695 8793 948 -805 1595 C ATOM 14031 CD1 PHE A1006 5.268 109.727 51.874 1.00 87.50 C ANISOU14031 CD1 PHE A1006 10826 11697 10722 1028 -752 1590 C ATOM 14032 CD2 PHE A1006 7.459 109.869 50.948 1.00 49.85 C ANISOU14032 CD2 PHE A1006 6099 6885 5957 906 -781 1557 C ATOM 14033 CE1 PHE A1006 5.644 108.611 52.600 1.00 76.51 C ANISOU14033 CE1 PHE A1006 9452 10345 9273 1064 -681 1550 C ATOM 14034 CE2 PHE A1006 7.834 108.766 51.666 1.00 55.77 C ANISOU14034 CE2 PHE A1006 6867 7671 6651 942 -715 1510 C ATOM 14035 CZ PHE A1006 6.927 108.134 52.496 1.00 64.70 C ANISOU14035 CZ PHE A1006 7988 8844 7751 1021 -666 1508 C ATOM 14036 H PHE A1006 4.105 112.515 51.916 1.00 96.94 H ATOM 14037 HA PHE A1006 6.719 112.997 51.382 1.00 88.25 H ATOM 14038 HB2 PHE A1006 4.862 111.430 49.940 1.00 85.91 H ATOM 14039 HB3 PHE A1006 6.369 111.640 49.488 1.00 85.91 H ATOM 14040 HD1 PHE A1006 4.400 110.052 51.946 1.00105.00 H ATOM 14041 HD2 PHE A1006 8.077 110.288 50.394 1.00 59.82 H ATOM 14042 HE1 PHE A1006 5.032 108.188 53.158 1.00 91.81 H ATOM 14043 HE2 PHE A1006 8.703 108.441 51.595 1.00 66.92 H ATOM 14044 HZ PHE A1006 7.186 107.384 52.982 1.00 77.64 H ATOM 14045 N SER A1007 4.352 114.612 50.139 1.00 96.34 N ANISOU14045 N SER A1007 11885 12603 12117 983 -1079 1697 N ATOM 14046 CA SER A1007 3.994 115.687 49.216 1.00 90.98 C ANISOU14046 CA SER A1007 11185 11874 11508 923 -1163 1762 C ATOM 14047 C SER A1007 4.803 116.939 49.551 1.00 87.90 C ANISOU14047 C SER A1007 10796 11396 11205 960 -1253 1726 C ATOM 14048 O SER A1007 4.918 117.857 48.744 1.00 83.05 O ANISOU14048 O SER A1007 10168 10728 10657 895 -1328 1782 O ATOM 14049 CB SER A1007 2.476 115.946 49.213 1.00 72.86 C ANISOU14049 CB SER A1007 8857 9591 9236 962 -1181 1799 C ATOM 14050 OG SER A1007 1.931 116.004 50.515 1.00 64.77 O ANISOU14050 OG SER A1007 7821 8575 8215 1102 -1165 1736 O ATOM 14051 H SER A1007 3.741 114.411 50.710 1.00115.61 H ATOM 14052 HA SER A1007 4.242 115.414 48.319 1.00109.17 H ATOM 14053 HB2 SER A1007 2.308 116.792 48.769 1.00 87.43 H ATOM 14054 HB3 SER A1007 2.041 115.229 48.726 1.00 87.43 H ATOM 14055 HG SER A1007 2.293 116.624 50.951 1.00 77.73 H ATOM 14056 N SER A1008 5.383 116.950 50.745 1.00100.64 N ANISOU14056 N SER A1008 12426 12993 12822 1064 -1249 1634 N ATOM 14057 CA SER A1008 6.303 118.003 51.155 1.00102.53 C ANISOU14057 CA SER A1008 12667 13143 13148 1104 -1337 1586 C ATOM 14058 C SER A1008 7.536 118.043 50.264 1.00 93.34 C ANISOU14058 C SER A1008 11509 11951 12005 984 -1346 1625 C ATOM 14059 O SER A1008 7.966 119.104 49.822 1.00 88.81 O ANISOU14059 O SER A1008 10916 11300 11526 947 -1433 1656 O ATOM 14060 CB SER A1008 6.765 117.758 52.594 1.00104.37 C ANISOU14060 CB SER A1008 12923 13374 13357 1238 -1320 1474 C ATOM 14061 OG SER A1008 5.673 117.497 53.463 1.00108.80 O ANISOU14061 OG SER A1008 13480 13983 13874 1353 -1285 1441 O ATOM 14062 H SER A1008 5.257 116.347 51.346 1.00120.77 H ATOM 14063 HA SER A1008 5.858 118.864 51.111 1.00123.04 H ATOM 14064 HB2 SER A1008 7.362 116.994 52.604 1.00125.24 H ATOM 14065 HB3 SER A1008 7.234 118.546 52.910 1.00125.24 H ATOM 14066 HG SER A1008 5.952 117.366 54.244 1.00130.56 H ATOM 14067 N LYS A1009 8.106 116.872 50.014 1.00105.77 N ANISOU14067 N LYS A1009 13106 13589 13495 926 -1255 1625 N ATOM 14068 CA LYS A1009 9.445 116.787 49.448 1.00100.03 C ANISOU14068 CA LYS A1009 12385 12842 12781 840 -1249 1639 C ATOM 14069 C LYS A1009 9.555 117.285 48.009 1.00102.20 C ANISOU14069 C LYS A1009 12641 13105 13085 709 -1277 1747 C ATOM 14070 O LYS A1009 10.514 117.972 47.669 1.00111.40 O ANISOU14070 O LYS A1009 13792 14212 14324 664 -1324 1770 O ATOM 14071 CB LYS A1009 9.967 115.357 49.542 1.00 85.82 C ANISOU14071 CB LYS A1009 10612 11117 10879 816 -1143 1607 C ATOM 14072 CG LYS A1009 11.488 115.241 49.553 1.00 83.23 C ANISOU14072 CG LYS A1009 10292 10759 10570 782 -1137 1574 C ATOM 14073 CD LYS A1009 12.077 115.944 50.781 1.00 78.35 C ANISOU14073 CD LYS A1009 9678 10062 10031 894 -1204 1482 C ATOM 14074 CE LYS A1009 13.532 115.580 51.051 1.00 81.58 C ANISOU14074 CE LYS A1009 10097 10448 10451 882 -1187 1429 C ATOM 14075 NZ LYS A1009 14.415 115.759 49.865 1.00 90.80 N ANISOU14075 NZ LYS A1009 11242 11603 11653 752 -1184 1503 N ATOM 14076 H LYS A1009 7.737 116.109 50.163 1.00126.93 H ATOM 14077 HA LYS A1009 10.032 117.341 49.986 1.00120.04 H ATOM 14078 HB2 LYS A1009 9.636 114.959 50.362 1.00102.99 H ATOM 14079 HB3 LYS A1009 9.639 114.856 48.779 1.00102.99 H ATOM 14080 HG2 LYS A1009 11.740 114.305 49.585 1.00 99.87 H ATOM 14081 HG3 LYS A1009 11.849 115.662 48.757 1.00 99.87 H ATOM 14082 HD2 LYS A1009 12.030 116.903 50.646 1.00 94.02 H ATOM 14083 HD3 LYS A1009 11.559 115.695 51.563 1.00 94.02 H ATOM 14084 HE2 LYS A1009 13.871 116.146 51.762 1.00 97.89 H ATOM 14085 HE3 LYS A1009 13.579 114.649 51.319 1.00 97.89 H ATOM 14086 HZ1 LYS A1009 15.251 115.535 50.071 1.00108.95 H ATOM 14087 HZ2 LYS A1009 14.134 115.243 49.196 1.00108.95 H ATOM 14088 HZ3 LYS A1009 14.400 116.609 49.600 1.00108.95 H ATOM 14089 N LEU A1010 8.585 116.944 47.167 1.00104.38 N ANISOU14089 N LEU A1010 12914 13437 13308 651 -1250 1818 N ATOM 14090 CA LEU A1010 8.597 117.369 45.762 1.00112.75 C ANISOU14090 CA LEU A1010 13962 14498 14379 532 -1275 1927 C ATOM 14091 C LEU A1010 7.161 117.359 45.223 1.00 95.37 C ANISOU14091 C LEU A1010 11755 12330 12153 518 -1286 1984 C ATOM 14092 O LEU A1010 6.361 116.524 45.663 1.00 85.70 O ANISOU14092 O LEU A1010 10537 11158 10868 565 -1235 1950 O ATOM 14093 CB LEU A1010 9.477 116.404 44.945 1.00127.09 C ANISOU14093 CB LEU A1010 15797 16380 16111 436 -1194 1952 C ATOM 14094 CG LEU A1010 11.016 116.509 45.026 1.00128.61 C ANISOU14094 CG LEU A1010 15987 16541 16338 410 -1185 1930 C ATOM 14095 CD1 LEU A1010 11.659 115.430 44.195 1.00123.48 C ANISOU14095 CD1 LEU A1010 15355 15973 15590 324 -1096 1952 C ATOM 14096 CD2 LEU A1010 11.565 117.839 44.541 1.00123.06 C ANISOU14096 CD2 LEU A1010 15253 15757 15749 367 -1268 1997 C ATOM 14097 H LEU A1010 7.904 116.465 47.381 1.00125.25 H ATOM 14098 HA LEU A1010 8.957 118.267 45.688 1.00135.30 H ATOM 14099 HB2 LEU A1010 9.249 115.502 45.217 1.00152.51 H ATOM 14100 HB3 LEU A1010 9.243 116.517 44.011 1.00152.51 H ATOM 14101 HG LEU A1010 11.295 116.387 45.947 1.00154.33 H ATOM 14102 HD11 LEU A1010 12.624 115.514 44.260 1.00148.18 H ATOM 14103 HD12 LEU A1010 11.379 114.564 44.531 1.00148.18 H ATOM 14104 HD13 LEU A1010 11.379 115.534 43.272 1.00148.18 H ATOM 14105 HD21 LEU A1010 12.532 117.830 44.621 1.00147.68 H ATOM 14106 HD22 LEU A1010 11.311 117.965 43.613 1.00147.68 H ATOM 14107 HD23 LEU A1010 11.194 118.551 45.085 1.00147.68 H ATOM 14108 N LEU A1011 6.785 118.249 44.297 1.00116.42 N ANISOU14108 N LEU A1011 14403 14964 14867 457 -1354 2073 N ATOM 14109 CA LEU A1011 7.570 119.381 43.770 1.00122.85 C ANISOU14109 CA LEU A1011 15200 15707 15772 404 -1426 2132 C ATOM 14110 C LEU A1011 6.581 120.324 43.063 1.00124.22 C ANISOU14110 C LEU A1011 15353 15845 16000 375 -1509 2218 C ATOM 14111 O LEU A1011 5.616 119.866 42.433 1.00118.21 O ANISOU14111 O LEU A1011 14601 15140 15175 343 -1489 2261 O ATOM 14112 CB LEU A1011 8.638 118.923 42.756 1.00118.11 C ANISOU14112 CB LEU A1011 14611 15151 15116 294 -1370 2190 C ATOM 14113 CG LEU A1011 9.448 119.987 41.988 1.00112.45 C ANISOU14113 CG LEU A1011 13868 14375 14481 219 -1429 2280 C ATOM 14114 CD1 LEU A1011 10.040 120.969 42.956 1.00112.96 C ANISOU14114 CD1 LEU A1011 13906 14331 14683 287 -1507 2229 C ATOM 14115 CD2 LEU A1011 10.565 119.353 41.168 1.00102.20 C ANISOU14115 CD2 LEU A1011 12580 13137 13114 128 -1350 2321 C ATOM 14116 H LEU A1011 6.009 118.211 43.928 1.00139.70 H ATOM 14117 HA LEU A1011 8.002 119.857 44.496 1.00147.42 H ATOM 14118 HB2 LEU A1011 9.281 118.376 43.233 1.00141.73 H ATOM 14119 HB3 LEU A1011 8.195 118.376 42.089 1.00141.73 H ATOM 14120 HG LEU A1011 8.859 120.468 41.385 1.00134.93 H ATOM 14121 HD11 LEU A1011 10.546 121.632 42.462 1.00135.55 H ATOM 14122 HD12 LEU A1011 9.323 121.398 43.448 1.00135.55 H ATOM 14123 HD13 LEU A1011 10.624 120.495 43.568 1.00135.55 H ATOM 14124 HD21 LEU A1011 11.049 120.052 40.701 1.00122.64 H ATOM 14125 HD22 LEU A1011 11.163 118.877 41.765 1.00122.64 H ATOM 14126 HD23 LEU A1011 10.176 118.736 40.528 1.00122.64 H ATOM 14127 N ARG A1012 6.829 121.628 43.177 1.00119.40 N ANISOU14127 N ARG A1012 14715 15138 15515 388 -1610 2241 N ATOM 14128 CA ARG A1012 6.054 122.681 42.494 1.00114.36 C ANISOU14128 CA ARG A1012 14056 14449 14945 353 -1692 2310 C ATOM 14129 C ARG A1012 5.423 122.501 41.099 1.00106.84 C ANISOU14129 C ARG A1012 13122 13566 13908 256 -1655 2395 C ATOM 14130 O ARG A1012 4.292 122.939 40.884 1.00 99.58 O ANISOU14130 O ARG A1012 12204 12662 12969 279 -1659 2379 O ATOM 14131 CB ARG A1012 6.938 123.921 42.302 1.00119.19 C ANISOU14131 CB ARG A1012 14641 14963 15684 319 -1770 2345 C ATOM 14132 CG ARG A1012 7.513 124.439 43.620 1.00127.76 C ANISOU14132 CG ARG A1012 15711 15965 16869 424 -1823 2243 C ATOM 14133 CD ARG A1012 8.254 125.760 43.479 1.00138.38 C ANISOU14133 CD ARG A1012 17021 17196 18360 395 -1913 2267 C ATOM 14134 NE ARG A1012 8.702 126.248 44.784 1.00144.68 N ANISOU14134 NE ARG A1012 17808 17912 19250 506 -1970 2147 N ATOM 14135 CZ ARG A1012 9.340 127.397 44.990 1.00137.20 C ANISOU14135 CZ ARG A1012 16830 16853 18446 509 -2057 2130 C ATOM 14136 NH1 ARG A1012 9.608 128.212 43.977 1.00128.38 N ANISOU14136 NH1 ARG A1012 15683 15689 17406 404 -2099 2238 N ATOM 14137 NH2 ARG A1012 9.700 127.738 46.224 1.00131.45 N ANISOU14137 NH2 ARG A1012 16101 16060 17784 620 -2103 2002 N ATOM 14138 H ARG A1012 7.466 121.944 43.661 1.00143.29 H ATOM 14139 HA ARG A1012 5.341 122.946 43.096 1.00137.23 H ATOM 14140 HB2 ARG A1012 7.679 123.694 41.719 1.00143.03 H ATOM 14141 HB3 ARG A1012 6.408 124.630 41.906 1.00143.03 H ATOM 14142 HG2 ARG A1012 6.786 124.571 44.249 1.00153.32 H ATOM 14143 HG3 ARG A1012 8.137 123.784 43.969 1.00153.32 H ATOM 14144 HD2 ARG A1012 9.033 125.634 42.915 1.00166.05 H ATOM 14145 HD3 ARG A1012 7.660 126.423 43.092 1.00166.05 H ATOM 14146 HE ARG A1012 8.542 125.754 45.469 1.00173.61 H ATOM 14147 HH11 ARG A1012 9.375 127.995 43.178 1.00154.05 H ATOM 14148 HH12 ARG A1012 10.018 128.954 44.119 1.00154.05 H ATOM 14149 HH21 ARG A1012 9.526 127.213 46.882 1.00157.74 H ATOM 14150 HH22 ARG A1012 10.110 128.481 46.362 1.00157.74 H ATOM 14151 N GLN A1013 6.120 121.864 40.158 1.00108.90 N ANISOU14151 N GLN A1013 13394 13868 14116 152 -1621 2481 N ATOM 14152 CA GLN A1013 5.529 121.610 38.836 1.00107.69 C ANISOU14152 CA GLN A1013 13264 13786 13867 69 -1584 2547 C ATOM 14153 C GLN A1013 4.901 120.233 38.983 1.00102.92 C ANISOU14153 C GLN A1013 12686 13271 13146 93 -1511 2501 C ATOM 14154 O GLN A1013 3.832 119.963 38.427 1.00 79.81 O ANISOU14154 O GLN A1013 9771 10376 10177 76 -1508 2510 O ATOM 14155 CB GLN A1013 6.551 121.562 37.691 1.00111.18 C ANISOU14155 CB GLN A1013 13715 14268 14260 -36 -1550 2642 C ATOM 14156 CG GLN A1013 5.931 121.139 36.343 1.00110.55 C ANISOU14156 CG GLN A1013 13665 14264 14074 -112 -1517 2699 C ATOM 14157 CD GLN A1013 6.956 120.856 35.256 1.00112.84 C ANISOU14157 CD GLN A1013 13971 14620 14284 -201 -1461 2779 C ATOM 14158 OE1 GLN A1013 8.150 121.118 35.417 1.00120.80 O ANISOU14158 OE1 GLN A1013 14959 15609 15331 -219 -1451 2811 O ATOM 14159 NE2 GLN A1013 6.486 120.307 34.139 1.00102.05 N ANISOU14159 NE2 GLN A1013 12638 13332 12806 -253 -1425 2808 N ATOM 14160 H GLN A1013 6.990 122.131 40.079 1.00130.68 H ATOM 14161 HA GLN A1013 4.829 122.234 38.588 1.00129.23 H ATOM 14162 HB2 GLN A1013 6.939 122.444 37.578 1.00133.42 H ATOM 14163 HB3 GLN A1013 7.245 120.922 37.915 1.00133.42 H ATOM 14164 HG2 GLN A1013 5.411 120.332 36.478 1.00132.66 H ATOM 14165 HG3 GLN A1013 5.354 121.853 36.028 1.00132.66 H ATOM 14166 HE21 GLN A1013 5.647 120.134 34.065 1.00122.47 H ATOM 14167 HE22 GLN A1013 7.022 120.125 33.491 1.00122.47 H ATOM 14168 N ASP A1014 5.573 119.357 39.724 1.00114.93 N ANISOU14168 N ASP A1014 14215 14829 14623 133 -1454 2449 N ATOM 14169 CA ASP A1014 5.137 117.969 39.804 1.00112.24 C ANISOU14169 CA ASP A1014 13899 14574 14174 144 -1372 2398 C ATOM 14170 C ASP A1014 3.851 117.791 40.619 1.00107.33 C ANISOU14170 C ASP A1014 13263 13943 13574 229 -1386 2347 C ATOM 14171 O ASP A1014 3.136 116.808 40.439 1.00103.19 O ANISOU14171 O ASP A1014 12749 13480 12979 226 -1341 2336 O ATOM 14172 CB ASP A1014 6.241 117.068 40.356 1.00108.66 C ANISOU14172 CB ASP A1014 13460 14156 13669 157 -1286 2323 C ATOM 14173 CG ASP A1014 7.372 116.841 39.358 1.00112.15 C ANISOU14173 CG ASP A1014 13919 14641 14054 65 -1244 2376 C ATOM 14174 OD1 ASP A1014 8.298 117.681 39.292 1.00112.10 O ANISOU14174 OD1 ASP A1014 13895 14584 14116 42 -1273 2409 O ATOM 14175 OD2 ASP A1014 7.340 115.812 38.645 1.00109.48 O ANISOU14175 OD2 ASP A1014 13607 14387 13605 18 -1184 2383 O ATOM 14176 H ASP A1014 6.276 119.538 40.184 1.00137.91 H ATOM 14177 HA ASP A1014 4.946 117.664 38.903 1.00134.69 H ATOM 14178 HB2 ASP A1014 6.619 117.481 41.149 1.00130.39 H ATOM 14179 HB3 ASP A1014 5.861 116.204 40.581 1.00130.39 H ATOM 14180 N LYS A1015 3.554 118.739 41.503 1.00100.70 N ANISOU14180 N LYS A1015 12396 13028 12838 308 -1449 2315 N ATOM 14181 CA LYS A1015 2.316 118.691 42.273 1.00 92.33 C ANISOU14181 CA LYS A1015 11317 11962 11804 395 -1460 2268 C ATOM 14182 C LYS A1015 1.090 118.758 41.368 1.00 98.19 C ANISOU14182 C LYS A1015 12056 12714 12536 348 -1478 2310 C ATOM 14183 O LYS A1015 0.103 118.062 41.601 1.00103.04 O ANISOU14183 O LYS A1015 12662 13366 13124 381 -1448 2290 O ATOM 14184 CB LYS A1015 2.276 119.823 43.295 1.00 95.51 C ANISOU14184 CB LYS A1015 11694 12278 12318 490 -1527 2213 C ATOM 14185 CG LYS A1015 3.159 119.568 44.500 1.00 92.11 C ANISOU14185 CG LYS A1015 11269 11839 11889 572 -1494 2124 C ATOM 14186 CD LYS A1015 2.698 120.345 45.728 1.00 94.34 C ANISOU14186 CD LYS A1015 11529 12063 12254 703 -1550 2051 C ATOM 14187 CE LYS A1015 3.775 120.420 46.805 1.00 95.39 C ANISOU14187 CE LYS A1015 11674 12165 12407 778 -1543 1959 C ATOM 14188 NZ LYS A1015 5.141 120.718 46.286 1.00 99.77 N ANISOU14188 NZ LYS A1015 12237 12682 12990 699 -1561 1985 N ATOM 14189 H LYS A1015 4.052 119.419 41.676 1.00120.84 H ATOM 14190 HA LYS A1015 2.281 117.851 42.758 1.00110.80 H ATOM 14191 HB2 LYS A1015 2.578 120.641 42.870 1.00114.61 H ATOM 14192 HB3 LYS A1015 1.365 119.931 43.610 1.00114.61 H ATOM 14193 HG2 LYS A1015 3.137 118.623 44.716 1.00110.53 H ATOM 14194 HG3 LYS A1015 4.066 119.843 44.293 1.00110.53 H ATOM 14195 HD2 LYS A1015 2.472 121.251 45.464 1.00113.21 H ATOM 14196 HD3 LYS A1015 1.921 119.906 46.108 1.00113.21 H ATOM 14197 HE2 LYS A1015 3.538 121.121 47.432 1.00114.47 H ATOM 14198 HE3 LYS A1015 3.813 119.568 47.266 1.00114.47 H ATOM 14199 HZ1 LYS A1015 5.722 120.749 46.960 1.00119.73 H ATOM 14200 HZ2 LYS A1015 5.394 120.084 45.714 1.00119.73 H ATOM 14201 HZ3 LYS A1015 5.143 121.503 45.867 1.00119.73 H ATOM 14202 N ARG A1016 1.155 119.596 40.337 1.00 97.94 N ANISOU14202 N ARG A1016 12030 12649 12535 271 -1529 2370 N ATOM 14203 CA ARG A1016 0.112 119.621 39.315 1.00104.23 C ANISOU14203 CA ARG A1016 12830 13459 13312 216 -1550 2415 C ATOM 14204 C ARG A1016 -0.013 118.236 38.666 1.00108.08 C ANISOU14204 C ARG A1016 13345 14037 13683 166 -1481 2427 C ATOM 14205 O ARG A1016 -1.100 117.647 38.645 1.00103.75 O ANISOU14205 O ARG A1016 12788 13513 13119 183 -1472 2414 O ATOM 14206 CB ARG A1016 0.410 120.700 38.256 1.00108.21 C ANISOU14206 CB ARG A1016 13340 13920 13855 136 -1608 2486 C ATOM 14207 CG ARG A1016 -0.555 120.712 37.052 1.00111.44 C ANISOU14207 CG ARG A1016 13761 14347 14233 72 -1631 2537 C ATOM 14208 CD ARG A1016 0.076 121.277 35.773 1.00116.92 C ANISOU14208 CD ARG A1016 14475 15042 14906 -25 -1652 2621 C ATOM 14209 NE ARG A1016 -0.164 122.712 35.601 1.00128.26 N ANISOU14209 NE ARG A1016 15888 16393 16452 -34 -1736 2656 N ATOM 14210 CZ ARG A1016 -0.156 123.347 34.428 1.00127.97 C ANISOU14210 CZ ARG A1016 15861 16348 16413 -111 -1771 2735 C ATOM 14211 NH1 ARG A1016 0.082 122.685 33.300 1.00129.08 N ANISOU14211 NH1 ARG A1016 16038 16566 16441 -181 -1728 2784 N ATOM 14212 NH2 ARG A1016 -0.384 124.652 34.381 1.00118.76 N ANISOU14212 NH2 ARG A1016 14669 15098 15358 -115 -1852 2763 N ATOM 14213 H ARG A1016 1.791 120.159 40.206 1.00117.53 H ATOM 14214 HA ARG A1016 -0.736 119.835 39.732 1.00125.07 H ATOM 14215 HB2 ARG A1016 0.359 121.571 38.681 1.00129.85 H ATOM 14216 HB3 ARG A1016 1.306 120.558 37.913 1.00129.85 H ATOM 14217 HG2 ARG A1016 -0.838 119.802 36.868 1.00133.73 H ATOM 14218 HG3 ARG A1016 -1.325 121.259 37.272 1.00133.73 H ATOM 14219 HD2 ARG A1016 1.035 121.136 35.806 1.00140.30 H ATOM 14220 HD3 ARG A1016 -0.300 120.817 35.006 1.00140.30 H ATOM 14221 HE ARG A1016 -0.321 123.178 36.306 1.00153.91 H ATOM 14222 HH11 ARG A1016 0.231 121.839 33.321 1.00154.90 H ATOM 14223 HH12 ARG A1016 0.085 123.104 32.548 1.00154.90 H ATOM 14224 HH21 ARG A1016 -0.539 125.088 35.106 1.00142.52 H ATOM 14225 HH22 ARG A1016 -0.379 125.063 33.625 1.00142.52 H ATOM 14226 N THR A1017 1.097 117.719 38.142 1.00107.08 N ANISOU14226 N THR A1017 13247 13958 13482 108 -1436 2450 N ATOM 14227 CA THR A1017 1.070 116.448 37.425 1.00101.96 C ANISOU14227 CA THR A1017 12628 13393 12720 59 -1379 2455 C ATOM 14228 C THR A1017 0.577 115.316 38.335 1.00 96.15 C ANISOU14228 C THR A1017 11880 12692 11960 123 -1330 2396 C ATOM 14229 O THR A1017 -0.016 114.347 37.861 1.00 96.10 O ANISOU14229 O THR A1017 11883 12735 11895 100 -1306 2393 O ATOM 14230 CB THR A1017 2.462 116.077 36.829 1.00 97.04 C ANISOU14230 CB THR A1017 12034 12818 12018 -3 -1331 2481 C ATOM 14231 OG1 THR A1017 3.499 116.569 37.676 1.00 99.67 O ANISOU14231 OG1 THR A1017 12352 13114 12405 30 -1330 2468 O ATOM 14232 CG2 THR A1017 2.653 116.683 35.447 1.00100.39 C ANISOU14232 CG2 THR A1017 12478 13249 12416 -88 -1357 2554 C ATOM 14233 H THR A1017 1.874 118.083 38.188 1.00128.50 H ATOM 14234 HA THR A1017 0.445 116.523 36.686 1.00122.35 H ATOM 14235 HB THR A1017 2.535 115.113 36.754 1.00116.45 H ATOM 14236 HG1 THR A1017 3.430 116.229 38.441 1.00119.61 H ATOM 14237 HG21 THR A1017 3.524 116.440 35.096 1.00120.46 H ATOM 14238 HG22 THR A1017 1.968 116.355 34.844 1.00120.46 H ATOM 14239 HG23 THR A1017 2.592 117.650 35.497 1.00120.46 H ATOM 14240 N VAL A1018 0.821 115.447 39.638 1.00 91.28 N ANISOU14240 N VAL A1018 11241 12050 11392 206 -1318 2350 N ATOM 14241 CA VAL A1018 0.346 114.467 40.611 1.00 87.59 C ANISOU14241 CA VAL A1018 10756 11615 10910 277 -1268 2301 C ATOM 14242 C VAL A1018 -1.162 114.576 40.751 1.00 81.94 C ANISOU14242 C VAL A1018 10008 10880 10244 314 -1296 2301 C ATOM 14243 O VAL A1018 -1.883 113.574 40.728 1.00 71.55 O ANISOU14243 O VAL A1018 8682 9606 8899 317 -1263 2298 O ATOM 14244 CB VAL A1018 1.018 114.664 42.001 1.00 89.07 C ANISOU14244 CB VAL A1018 10935 11774 11133 365 -1236 2222 C ATOM 14245 CG1 VAL A1018 0.067 114.278 43.159 1.00 96.64 C ANISOU14245 CG1 VAL A1018 11863 12738 12120 466 -1206 2172 C ATOM 14246 CG2 VAL A1018 2.300 113.855 42.093 1.00 62.25 C ANISOU14246 CG2 VAL A1018 7568 8415 7668 340 -1164 2178 C ATOM 14247 H VAL A1018 1.262 116.099 39.985 1.00109.54 H ATOM 14248 HA VAL A1018 0.558 113.575 40.296 1.00105.11 H ATOM 14249 HB VAL A1018 1.250 115.600 42.107 1.00106.88 H ATOM 14250 HG11 VAL A1018 0.525 114.416 44.003 1.00115.97 H ATOM 14251 HG12 VAL A1018 -0.724 114.838 43.116 1.00115.97 H ATOM 14252 HG13 VAL A1018 -0.182 113.345 43.065 1.00115.97 H ATOM 14253 HG21 VAL A1018 2.699 113.994 42.966 1.00 74.70 H ATOM 14254 HG22 VAL A1018 2.090 112.916 41.971 1.00 74.70 H ATOM 14255 HG23 VAL A1018 2.910 114.151 41.399 1.00 74.70 H ATOM 14256 N TYR A1019 -1.621 115.811 40.903 1.00 91.37 N ANISOU14256 N TYR A1019 11183 12010 11524 343 -1360 2307 N ATOM 14257 CA TYR A1019 -3.031 116.099 41.099 1.00 97.37 C ANISOU14257 CA TYR A1019 11906 12744 12345 386 -1392 2306 C ATOM 14258 C TYR A1019 -3.821 115.674 39.863 1.00102.04 C ANISOU14258 C TYR A1019 12506 13357 12907 306 -1410 2351 C ATOM 14259 O TYR A1019 -4.916 115.116 39.971 1.00 96.47 O ANISOU14259 O TYR A1019 11771 12665 12217 328 -1403 2351 O ATOM 14260 CB TYR A1019 -3.212 117.591 41.384 1.00 95.31 C ANISOU14260 CB TYR A1019 11627 12405 12180 425 -1466 2300 C ATOM 14261 CG TYR A1019 -4.515 117.950 42.066 1.00101.97 C ANISOU14261 CG TYR A1019 12426 13223 13097 508 -1489 2276 C ATOM 14262 CD1 TYR A1019 -5.731 117.524 41.551 1.00107.12 C ANISOU14262 CD1 TYR A1019 13056 13891 13753 485 -1493 2305 C ATOM 14263 CD2 TYR A1019 -4.529 118.719 43.227 1.00 98.69 C ANISOU14263 CD2 TYR A1019 11985 12766 12745 614 -1508 2224 C ATOM 14264 CE1 TYR A1019 -6.920 117.851 42.160 1.00106.05 C ANISOU14264 CE1 TYR A1019 12872 13734 13687 561 -1510 2289 C ATOM 14265 CE2 TYR A1019 -5.717 119.053 43.846 1.00 98.57 C ANISOU14265 CE2 TYR A1019 11926 12735 12791 697 -1524 2201 C ATOM 14266 CZ TYR A1019 -6.912 118.613 43.304 1.00105.65 C ANISOU14266 CZ TYR A1019 12798 13651 13694 667 -1522 2238 C ATOM 14267 OH TYR A1019 -8.119 118.923 43.889 1.00108.08 O ANISOU14267 OH TYR A1019 13054 13944 14065 748 -1534 2222 O ATOM 14268 H TYR A1019 -1.123 116.513 40.896 1.00109.65 H ATOM 14269 HA TYR A1019 -3.361 115.598 41.862 1.00116.84 H ATOM 14270 HB2 TYR A1019 -2.489 117.886 41.959 1.00114.37 H ATOM 14271 HB3 TYR A1019 -3.178 118.073 40.543 1.00114.37 H ATOM 14272 HD1 TYR A1019 -5.742 117.010 40.776 1.00128.54 H ATOM 14273 HD2 TYR A1019 -3.725 119.016 43.589 1.00118.42 H ATOM 14274 HE1 TYR A1019 -7.726 117.558 41.800 1.00127.26 H ATOM 14275 HE2 TYR A1019 -5.715 119.568 44.621 1.00118.28 H ATOM 14276 HH TYR A1019 -8.748 118.586 43.446 1.00129.69 H ATOM 14277 N VAL A1020 -3.251 115.921 38.686 1.00110.46 N ANISOU14277 N VAL A1020 13611 14428 13931 217 -1434 2390 N ATOM 14278 CA VAL A1020 -3.839 115.431 37.444 1.00113.93 C ANISOU14278 CA VAL A1020 14070 14896 14323 144 -1451 2426 C ATOM 14279 C VAL A1020 -4.013 113.916 37.524 1.00108.95 C ANISOU14279 C VAL A1020 13440 14328 13628 144 -1394 2405 C ATOM 14280 O VAL A1020 -5.012 113.377 37.045 1.00113.29 O ANISOU14280 O VAL A1020 13978 14887 14180 129 -1414 2417 O ATOM 14281 CB VAL A1020 -2.969 115.805 36.219 1.00111.37 C ANISOU14281 CB VAL A1020 13792 14585 13941 56 -1467 2470 C ATOM 14282 CG1 VAL A1020 -3.389 115.010 34.973 1.00106.82 C ANISOU14282 CG1 VAL A1020 13246 14057 13285 -8 -1472 2493 C ATOM 14283 CG2 VAL A1020 -3.057 117.298 35.953 1.00102.75 C ANISOU14283 CG2 VAL A1020 12691 13424 12924 45 -1536 2505 C ATOM 14284 H VAL A1020 -2.525 116.370 38.581 1.00132.55 H ATOM 14285 HA VAL A1020 -4.715 115.831 37.327 1.00136.72 H ATOM 14286 HB VAL A1020 -2.044 115.590 36.413 1.00133.65 H ATOM 14287 HG11 VAL A1020 -2.824 115.270 34.228 1.00128.19 H ATOM 14288 HG12 VAL A1020 -3.284 114.063 35.153 1.00128.19 H ATOM 14289 HG13 VAL A1020 -4.316 115.208 34.770 1.00128.19 H ATOM 14290 HG21 VAL A1020 -2.507 117.515 35.184 1.00123.30 H ATOM 14291 HG22 VAL A1020 -3.981 117.534 35.777 1.00123.30 H ATOM 14292 HG23 VAL A1020 -2.737 117.777 36.734 1.00123.30 H ATOM 14293 N TYR A1021 -3.047 113.236 38.140 1.00100.83 N ANISOU14293 N TYR A1021 12422 13337 12552 163 -1330 2375 N ATOM 14294 CA TYR A1021 -3.111 111.783 38.269 1.00 92.56 C ANISOU14294 CA TYR A1021 11374 12346 11448 163 -1277 2354 C ATOM 14295 C TYR A1021 -4.096 111.367 39.364 1.00 86.15 C ANISOU14295 C TYR A1021 10507 11526 10699 243 -1255 2336 C ATOM 14296 O TYR A1021 -4.691 110.293 39.299 1.00 80.49 O ANISOU14296 O TYR A1021 9773 10838 9970 239 -1236 2337 O ATOM 14297 CB TYR A1021 -1.726 111.190 38.543 1.00 78.33 C ANISOU14297 CB TYR A1021 9601 10587 9573 156 -1215 2328 C ATOM 14298 CG TYR A1021 -1.691 109.692 38.367 1.00 85.61 C ANISOU14298 CG TYR A1021 10532 11568 10427 137 -1172 2309 C ATOM 14299 CD1 TYR A1021 -2.012 108.841 39.418 1.00 87.05 C ANISOU14299 CD1 TYR A1021 10683 11758 10633 197 -1116 2263 C ATOM 14300 CD2 TYR A1021 -1.362 109.127 37.148 1.00 94.20 C ANISOU14300 CD2 TYR A1021 11661 12699 11433 63 -1180 2319 C ATOM 14301 CE1 TYR A1021 -1.992 107.474 39.264 1.00 82.36 C ANISOU14301 CE1 TYR A1021 10095 11206 9993 177 -1077 2234 C ATOM 14302 CE2 TYR A1021 -1.340 107.756 36.982 1.00103.48 C ANISOU14302 CE2 TYR A1021 12843 13922 12554 50 -1149 2290 C ATOM 14303 CZ TYR A1021 -1.658 106.935 38.045 1.00 99.83 C ANISOU14303 CZ TYR A1021 12347 13456 12130 104 -1098 2244 C ATOM 14304 OH TYR A1021 -1.638 105.568 37.891 1.00109.55 O ANISOU14304 OH TYR A1021 13580 14721 13320 89 -1069 2207 O ATOM 14305 H TYR A1021 -2.347 113.591 38.491 1.00120.99 H ATOM 14306 HA TYR A1021 -3.429 111.411 37.431 1.00111.07 H ATOM 14307 HB2 TYR A1021 -1.087 111.580 37.927 1.00 94.00 H ATOM 14308 HB3 TYR A1021 -1.471 111.391 39.457 1.00 94.00 H ATOM 14309 HD1 TYR A1021 -2.239 109.203 40.244 1.00104.46 H ATOM 14310 HD2 TYR A1021 -1.148 109.679 36.430 1.00113.05 H ATOM 14311 HE1 TYR A1021 -2.206 106.919 39.978 1.00 98.84 H ATOM 14312 HE2 TYR A1021 -1.113 107.388 36.158 1.00124.18 H ATOM 14313 HH TYR A1021 -1.847 105.194 38.614 1.00131.45 H ATOM 14314 N LEU A1022 -4.260 112.230 40.362 1.00 79.50 N ANISOU14314 N LEU A1022 9635 10643 9926 318 -1260 2321 N ATOM 14315 CA LEU A1022 -5.219 112.014 41.443 1.00 74.19 C ANISOU14315 CA LEU A1022 8907 9967 9315 406 -1235 2308 C ATOM 14316 C LEU A1022 -6.660 112.123 40.944 1.00 88.94 C ANISOU14316 C LEU A1022 10738 11812 11244 395 -1283 2341 C ATOM 14317 O LEU A1022 -7.522 111.311 41.303 1.00 69.82 O ANISOU14317 O LEU A1022 8271 9408 8848 423 -1255 2350 O ATOM 14318 CB LEU A1022 -4.973 113.047 42.545 1.00 63.77 C ANISOU14318 CB LEU A1022 7572 8611 8047 496 -1239 2277 C ATOM 14319 CG LEU A1022 -5.944 113.103 43.723 1.00 63.41 C ANISOU14319 CG LEU A1022 7468 8561 8063 605 -1215 2260 C ATOM 14320 CD1 LEU A1022 -5.765 111.911 44.633 1.00 64.59 C ANISOU14320 CD1 LEU A1022 7605 8763 8172 655 -1119 2229 C ATOM 14321 CD2 LEU A1022 -5.767 114.400 44.492 1.00 66.46 C ANISOU14321 CD2 LEU A1022 7847 8899 8504 685 -1250 2224 C ATOM 14322 H LEU A1022 -3.819 112.965 40.437 1.00 95.39 H ATOM 14323 HA LEU A1022 -5.090 111.128 41.817 1.00 89.03 H ATOM 14324 HB2 LEU A1022 -4.092 112.880 42.916 1.00 76.52 H ATOM 14325 HB3 LEU A1022 -4.980 113.925 42.134 1.00 76.52 H ATOM 14326 HG LEU A1022 -6.852 113.082 43.381 1.00 76.09 H ATOM 14327 HD11 LEU A1022 -6.395 111.978 45.368 1.00 77.50 H ATOM 14328 HD12 LEU A1022 -5.931 111.100 44.128 1.00 77.50 H ATOM 14329 HD13 LEU A1022 -4.857 111.909 44.975 1.00 77.50 H ATOM 14330 HD21 LEU A1022 -6.393 114.415 45.234 1.00 79.75 H ATOM 14331 HD22 LEU A1022 -4.858 114.448 44.825 1.00 79.75 H ATOM 14332 HD23 LEU A1022 -5.942 115.146 43.897 1.00 79.75 H ATOM 14333 N GLU A1023 -6.903 113.143 40.120 1.00104.01 N ANISOU14333 N GLU A1023 12661 13677 13180 352 -1356 2362 N ATOM 14334 CA GLU A1023 -8.215 113.404 39.527 1.00100.21 C ANISOU14334 CA GLU A1023 12150 13165 12759 335 -1414 2393 C ATOM 14335 C GLU A1023 -8.749 112.195 38.758 1.00 99.04 C ANISOU14335 C GLU A1023 12001 13050 12580 281 -1414 2414 C ATOM 14336 O GLU A1023 -9.964 111.996 38.648 1.00 95.68 O ANISOU14336 O GLU A1023 11529 12608 12218 290 -1442 2434 O ATOM 14337 CB GLU A1023 -8.117 114.610 38.587 1.00104.10 C ANISOU14337 CB GLU A1023 12675 13613 13266 283 -1490 2414 C ATOM 14338 CG GLU A1023 -8.277 115.966 39.279 1.00105.52 C ANISOU14338 CG GLU A1023 12831 13735 13527 346 -1526 2400 C ATOM 14339 CD GLU A1023 -9.732 116.431 39.410 1.00108.13 C ANISOU14339 CD GLU A1023 13108 14026 13950 385 -1571 2408 C ATOM 14340 OE1 GLU A1023 -9.951 117.490 40.045 1.00 82.08 O ANISOU14340 OE1 GLU A1023 9785 10682 10721 447 -1601 2388 O ATOM 14341 OE2 GLU A1023 -10.651 115.752 38.889 1.00119.76 O ANISOU14341 OE2 GLU A1023 14560 15511 15432 357 -1581 2433 O ATOM 14342 H GLU A1023 -6.305 113.715 39.884 1.00124.81 H ATOM 14343 HA GLU A1023 -8.846 113.618 40.231 1.00120.25 H ATOM 14344 HB2 GLU A1023 -7.247 114.600 38.158 1.00124.92 H ATOM 14345 HB3 GLU A1023 -8.813 114.538 37.916 1.00124.92 H ATOM 14346 HG2 GLU A1023 -7.904 115.907 40.172 1.00126.62 H ATOM 14347 HG3 GLU A1023 -7.797 116.636 38.767 1.00126.62 H ATOM 14348 N LYS A1024 -7.836 111.397 38.216 1.00101.61 N ANISOU14348 N LYS A1024 12373 13420 12814 227 -1387 2408 N ATOM 14349 CA LYS A1024 -8.218 110.194 37.491 1.00 99.11 C ANISOU14349 CA LYS A1024 12060 13134 12463 180 -1395 2418 C ATOM 14350 C LYS A1024 -8.878 109.206 38.441 1.00 88.66 C ANISOU14350 C LYS A1024 10673 11824 11189 235 -1347 2416 C ATOM 14351 O LYS A1024 -9.536 108.264 37.999 1.00 92.45 O ANISOU14351 O LYS A1024 11132 12312 11682 209 -1367 2431 O ATOM 14352 CB LYS A1024 -6.997 109.532 36.840 1.00 95.48 C ANISOU14352 CB LYS A1024 11663 12725 11889 124 -1370 2403 C ATOM 14353 CG LYS A1024 -6.111 110.485 36.056 1.00 92.48 C ANISOU14353 CG LYS A1024 11341 12342 11456 76 -1394 2411 C ATOM 14354 CD LYS A1024 -4.848 109.799 35.580 1.00100.42 C ANISOU14354 CD LYS A1024 12400 13405 12351 33 -1353 2394 C ATOM 14355 CE LYS A1024 -4.130 110.633 34.537 1.00102.32 C ANISOU14355 CE LYS A1024 12692 13649 12535 -25 -1379 2418 C ATOM 14356 NZ LYS A1024 -3.153 109.814 33.772 1.00101.09 N ANISOU14356 NZ LYS A1024 12587 13560 12263 -72 -1348 2406 N ATOM 14357 H LYS A1024 -6.988 111.530 38.255 1.00121.93 H ATOM 14358 HA LYS A1024 -8.853 110.423 36.795 1.00118.93 H ATOM 14359 HB2 LYS A1024 -6.454 109.129 37.536 1.00114.57 H ATOM 14360 HB3 LYS A1024 -7.306 108.846 36.228 1.00114.57 H ATOM 14361 HG2 LYS A1024 -6.594 110.806 35.278 1.00110.98 H ATOM 14362 HG3 LYS A1024 -5.858 111.228 36.625 1.00110.98 H ATOM 14363 HD2 LYS A1024 -4.249 109.671 36.333 1.00120.51 H ATOM 14364 HD3 LYS A1024 -5.076 108.944 35.183 1.00120.51 H ATOM 14365 HE2 LYS A1024 -4.779 110.995 33.913 1.00122.78 H ATOM 14366 HE3 LYS A1024 -3.648 111.351 34.976 1.00122.78 H ATOM 14367 HZ1 LYS A1024 -2.742 110.319 33.166 1.00121.31 H ATOM 14368 HZ2 LYS A1024 -2.545 109.473 34.325 1.00121.31 H ATOM 14369 HZ3 LYS A1024 -3.574 109.148 33.358 1.00121.31 H ATOM 14370 N PHE A1025 -8.689 109.421 39.742 1.00 88.71 N ANISOU14370 N PHE A1025 10648 11832 11224 314 -1288 2398 N ATOM 14371 CA PHE A1025 -9.209 108.512 40.757 1.00 97.38 C ANISOU14371 CA PHE A1025 11686 12952 12364 375 -1226 2402 C ATOM 14372 C PHE A1025 -10.338 109.152 41.526 1.00 96.58 C ANISOU14372 C PHE A1025 11515 12820 12362 450 -1226 2418 C ATOM 14373 O PHE A1025 -11.356 108.508 41.806 1.00 75.49 O ANISOU14373 O PHE A1025 8778 10149 9757 473 -1211 2446 O ATOM 14374 CB PHE A1025 -8.098 108.078 41.707 1.00 84.88 C ANISOU14374 CB PHE A1025 10122 11406 10722 417 -1142 2363 C ATOM 14375 CG PHE A1025 -7.151 107.140 41.077 1.00 70.43 C ANISOU14375 CG PHE A1025 8345 9610 8805 350 -1124 2336 C ATOM 14376 CD1 PHE A1025 -7.390 105.785 41.114 1.00 65.88 C ANISOU14376 CD1 PHE A1025 7749 9056 8228 336 -1090 2329 C ATOM 14377 CD2 PHE A1025 -6.068 107.615 40.373 1.00 74.07 C ANISOU14377 CD2 PHE A1025 8872 10077 9192 298 -1146 2323 C ATOM 14378 CE1 PHE A1025 -6.544 104.914 40.494 1.00 74.41 C ANISOU14378 CE1 PHE A1025 8877 10166 9230 278 -1081 2298 C ATOM 14379 CE2 PHE A1025 -5.211 106.753 39.749 1.00 88.87 C ANISOU14379 CE2 PHE A1025 10794 11989 10984 240 -1128 2297 C ATOM 14380 CZ PHE A1025 -5.444 105.397 39.810 1.00 89.05 C ANISOU14380 CZ PHE A1025 10799 12034 11001 232 -1097 2279 C ATOM 14381 H PHE A1025 -8.259 110.093 40.063 1.00106.45 H ATOM 14382 HA PHE A1025 -9.557 107.718 40.320 1.00116.86 H ATOM 14383 HB2 PHE A1025 -7.601 108.860 41.992 1.00101.86 H ATOM 14384 HB3 PHE A1025 -8.492 107.636 42.475 1.00101.86 H ATOM 14385 HD1 PHE A1025 -8.130 105.460 41.574 1.00 79.06 H ATOM 14386 HD2 PHE A1025 -5.911 108.531 40.332 1.00 88.88 H ATOM 14387 HE1 PHE A1025 -6.702 103.998 40.538 1.00 89.30 H ATOM 14388 HE2 PHE A1025 -4.472 107.080 39.290 1.00106.64 H ATOM 14389 HZ PHE A1025 -4.861 104.806 39.391 1.00106.85 H ATOM 14390 N MET A1026 -10.159 110.427 41.858 1.00101.89 N ANISOU14390 N MET A1026 12199 13463 13052 489 -1246 2399 N ATOM 14391 CA MET A1026 -11.167 111.125 42.651 1.00 95.06 C ANISOU14391 CA MET A1026 11270 12572 12276 573 -1246 2404 C ATOM 14392 C MET A1026 -12.185 111.883 41.807 1.00106.56 C ANISOU14392 C MET A1026 12709 13978 13801 538 -1333 2429 C ATOM 14393 O MET A1026 -11.873 112.507 40.779 1.00102.60 O ANISOU14393 O MET A1026 12259 13448 13276 468 -1402 2432 O ATOM 14394 CB MET A1026 -10.536 112.050 43.721 1.00 79.10 C ANISOU14394 CB MET A1026 9258 10546 10249 662 -1220 2360 C ATOM 14395 CG MET A1026 -9.961 113.357 43.193 1.00 86.69 C ANISOU14395 CG MET A1026 10270 11461 11209 633 -1294 2342 C ATOM 14396 SD MET A1026 -9.962 114.686 44.406 1.00 90.31 S ANISOU14396 SD MET A1026 10708 11885 11722 755 -1303 2294 S ATOM 14397 CE MET A1026 -11.593 114.595 45.137 1.00106.42 C ANISOU14397 CE MET A1026 12656 13932 13849 845 -1279 2310 C ATOM 14398 H MET A1026 -9.477 110.903 41.641 1.00122.27 H ATOM 14399 HA MET A1026 -11.657 110.447 43.142 1.00114.07 H ATOM 14400 HB2 MET A1026 -11.218 112.274 44.374 1.00 94.92 H ATOM 14401 HB3 MET A1026 -9.815 111.569 44.157 1.00 94.92 H ATOM 14402 HG2 MET A1026 -9.043 113.207 42.918 1.00104.03 H ATOM 14403 HG3 MET A1026 -10.489 113.647 42.433 1.00104.03 H ATOM 14404 HE1 MET A1026 -11.676 115.288 45.810 1.00127.71 H ATOM 14405 HE2 MET A1026 -12.257 114.726 44.443 1.00127.71 H ATOM 14406 HE3 MET A1026 -11.707 113.722 45.544 1.00127.71 H ATOM 14407 N THR A1027 -13.413 111.839 42.298 1.00104.80 N ANISOU14407 N THR A1027 12409 13745 13666 592 -1325 2450 N ATOM 14408 CA THR A1027 -14.541 112.422 41.608 1.00 92.45 C ANISOU14408 CA THR A1027 10814 12132 12180 567 -1402 2476 C ATOM 14409 C THR A1027 -14.968 113.746 42.224 1.00 96.49 C ANISOU14409 C THR A1027 11299 12608 12754 644 -1426 2455 C ATOM 14410 O THR A1027 -14.501 114.141 43.289 1.00 93.38 O ANISOU14410 O THR A1027 10902 12230 12348 729 -1378 2419 O ATOM 14411 CB THR A1027 -15.742 111.465 41.627 1.00 88.81 C ANISOU14411 CB THR A1027 10274 11675 11793 569 -1388 2517 C ATOM 14412 OG1 THR A1027 -16.227 111.316 42.968 1.00 80.83 O ANISOU14412 OG1 THR A1027 9190 10691 10833 673 -1306 2520 O ATOM 14413 CG2 THR A1027 -15.345 110.104 41.067 1.00 92.68 C ANISOU14413 CG2 THR A1027 10787 12196 12232 500 -1374 2532 C ATOM 14414 H THR A1027 -13.620 111.468 43.046 1.00125.76 H ATOM 14415 HA THR A1027 -14.298 112.584 40.683 1.00110.94 H ATOM 14416 HB THR A1027 -16.448 111.828 41.070 1.00106.57 H ATOM 14417 HG1 THR A1027 -15.622 111.004 43.460 1.00 97.00 H ATOM 14418 HG21 THR A1027 -16.108 109.505 41.081 1.00111.22 H ATOM 14419 HG22 THR A1027 -15.037 110.200 40.152 1.00111.22 H ATOM 14420 HG23 THR A1027 -14.632 109.721 41.602 1.00111.22 H ATOM 14421 N PHE A1028 -15.874 114.417 41.525 1.00101.14 N ANISOU14421 N PHE A1028 11870 13147 13410 616 -1505 2472 N ATOM 14422 CA PHE A1028 -16.414 115.700 41.935 1.00 94.67 C ANISOU14422 CA PHE A1028 11024 12286 12661 680 -1544 2452 C ATOM 14423 C PHE A1028 -17.167 115.545 43.253 1.00 94.73 C ANISOU14423 C PHE A1028 10947 12318 12727 798 -1473 2445 C ATOM 14424 O PHE A1028 -16.927 116.280 44.219 1.00 84.25 O ANISOU14424 O PHE A1028 9613 10993 11403 893 -1451 2402 O ATOM 14425 CB PHE A1028 -17.363 116.200 40.847 1.00 90.49 C ANISOU14425 CB PHE A1028 10486 11702 12195 619 -1639 2479 C ATOM 14426 CG PHE A1028 -17.766 117.625 41.006 1.00 82.65 C ANISOU14426 CG PHE A1028 9481 10655 11265 664 -1700 2456 C ATOM 14427 CD1 PHE A1028 -16.917 118.640 40.601 1.00 84.44 C ANISOU14427 CD1 PHE A1028 9774 10849 11459 634 -1753 2435 C ATOM 14428 CD2 PHE A1028 -18.993 117.956 41.551 1.00 80.27 C ANISOU14428 CD2 PHE A1028 9099 10336 11062 736 -1703 2456 C ATOM 14429 CE1 PHE A1028 -17.274 119.964 40.741 1.00 69.29 C ANISOU14429 CE1 PHE A1028 7845 8876 9607 674 -1815 2412 C ATOM 14430 CE2 PHE A1028 -19.364 119.281 41.691 1.00 97.90 C ANISOU14430 CE2 PHE A1028 11323 12519 13356 780 -1764 2428 C ATOM 14431 CZ PHE A1028 -18.498 120.290 41.286 1.00 90.10 C ANISOU14431 CZ PHE A1028 10404 11493 12336 749 -1823 2404 C ATOM 14432 H PHE A1028 -16.202 114.135 40.782 1.00121.36 H ATOM 14433 HA PHE A1028 -15.696 116.343 42.051 1.00113.61 H ATOM 14434 HB2 PHE A1028 -16.926 116.110 39.986 1.00108.59 H ATOM 14435 HB3 PHE A1028 -18.169 115.660 40.865 1.00108.59 H ATOM 14436 HD1 PHE A1028 -16.090 118.425 40.235 1.00101.33 H ATOM 14437 HD2 PHE A1028 -19.573 117.283 41.824 1.00 96.32 H ATOM 14438 HE1 PHE A1028 -16.693 120.635 40.466 1.00 83.15 H ATOM 14439 HE2 PHE A1028 -20.189 119.497 42.061 1.00117.48 H ATOM 14440 HZ PHE A1028 -18.744 121.181 41.380 1.00108.12 H ATOM 14441 N GLN A1029 -18.069 114.566 43.299 1.00 89.51 N ANISOU14441 N GLN A1029 10219 11678 12113 795 -1436 2487 N ATOM 14442 CA GLN A1029 -18.883 114.340 44.490 1.00 96.69 C ANISOU14442 CA GLN A1029 11038 12618 13082 904 -1358 2494 C ATOM 14443 C GLN A1029 -17.994 113.939 45.661 1.00102.50 C ANISOU14443 C GLN A1029 11786 13415 13744 982 -1257 2466 C ATOM 14444 O GLN A1029 -18.449 113.839 46.799 1.00107.39 O ANISOU14444 O GLN A1029 12344 14072 14388 1089 -1178 2464 O ATOM 14445 CB GLN A1029 -19.955 113.267 44.232 1.00104.28 C ANISOU14445 CB GLN A1029 11921 13584 14115 872 -1337 2555 C ATOM 14446 CG GLN A1029 -20.996 113.052 45.361 1.00107.73 C ANISOU14446 CG GLN A1029 12249 14052 14633 977 -1253 2578 C ATOM 14447 CD GLN A1029 -21.967 114.223 45.563 1.00111.07 C ANISOU14447 CD GLN A1029 12623 14438 15141 1041 -1296 2562 C ATOM 14448 OE1 GLN A1029 -21.619 115.387 45.361 1.00109.32 O ANISOU14448 OE1 GLN A1029 12454 14181 14903 1050 -1365 2515 O ATOM 14449 NE2 GLN A1029 -23.193 113.908 45.981 1.00107.30 N ANISOU14449 NE2 GLN A1029 12040 13969 14761 1087 -1254 2602 N ATOM 14450 H GLN A1029 -18.228 114.020 42.654 1.00107.41 H ATOM 14451 HA GLN A1029 -19.335 115.166 44.726 1.00116.03 H ATOM 14452 HB2 GLN A1029 -20.445 113.514 43.432 1.00125.13 H ATOM 14453 HB3 GLN A1029 -19.508 112.419 44.086 1.00125.13 H ATOM 14454 HG2 GLN A1029 -21.523 112.265 45.151 1.00129.28 H ATOM 14455 HG3 GLN A1029 -20.523 112.914 46.197 1.00129.28 H ATOM 14456 HE21 GLN A1029 -23.401 113.085 46.122 1.00128.76 H ATOM 14457 HE22 GLN A1029 -23.776 114.527 46.110 1.00128.76 H ATOM 14458 N MET A1030 -16.721 113.697 45.363 1.00112.04 N ANISOU14458 N MET A1030 13077 14636 14860 930 -1257 2446 N ATOM 14459 CA MET A1030 -15.722 113.420 46.390 1.00115.25 C ANISOU14459 CA MET A1030 13510 15092 15189 998 -1175 2410 C ATOM 14460 C MET A1030 -14.990 114.684 46.846 1.00102.02 C ANISOU14460 C MET A1030 11882 13392 13488 1059 -1209 2345 C ATOM 14461 O MET A1030 -14.860 114.937 48.042 1.00 88.59 O ANISOU14461 O MET A1030 10164 11719 11775 1176 -1154 2305 O ATOM 14462 CB MET A1030 -14.728 112.368 45.879 1.00113.17 C ANISOU14462 CB MET A1030 13302 14855 14842 913 -1152 2421 C ATOM 14463 CG MET A1030 -15.172 110.946 46.191 1.00118.15 C ANISOU14463 CG MET A1030 13878 15531 15484 913 -1073 2466 C ATOM 14464 SD MET A1030 -14.466 109.640 45.163 1.00101.40 S ANISOU14464 SD MET A1030 11806 13422 13301 787 -1084 2488 S ATOM 14465 CE MET A1030 -12.732 109.953 45.433 1.00112.40 C ANISOU14465 CE MET A1030 13295 14835 14575 792 -1064 2427 C ATOM 14466 H MET A1030 -16.408 113.688 44.562 1.00134.45 H ATOM 14467 HA MET A1030 -16.174 113.039 47.158 1.00138.30 H ATOM 14468 HB2 MET A1030 -14.645 112.452 44.916 1.00135.80 H ATOM 14469 HB3 MET A1030 -13.867 112.514 46.301 1.00135.80 H ATOM 14470 HG2 MET A1030 -14.934 110.749 47.110 1.00141.79 H ATOM 14471 HG3 MET A1030 -16.136 110.900 46.093 1.00141.79 H ATOM 14472 HE1 MET A1030 -12.213 109.308 44.927 1.00134.87 H ATOM 14473 HE2 MET A1030 -12.524 110.852 45.135 1.00134.87 H ATOM 14474 HE3 MET A1030 -12.540 109.864 46.380 1.00134.87 H ATOM 14475 N SER A1031 -14.522 115.479 45.893 1.00 95.85 N ANISOU14475 N SER A1031 11159 12557 12702 982 -1303 2334 N ATOM 14476 CA SER A1031 -13.832 116.714 46.220 1.00 85.96 C ANISOU14476 CA SER A1031 9948 11268 11445 1028 -1351 2277 C ATOM 14477 C SER A1031 -14.760 117.670 46.955 1.00 93.56 C ANISOU14477 C SER A1031 10855 12207 12485 1139 -1372 2246 C ATOM 14478 O SER A1031 -14.311 118.649 47.552 1.00 99.76 O ANISOU14478 O SER A1031 11661 12968 13275 1213 -1403 2186 O ATOM 14479 CB SER A1031 -13.307 117.374 44.948 1.00 82.84 C ANISOU14479 CB SER A1031 9615 10818 11043 916 -1445 2287 C ATOM 14480 OG SER A1031 -14.279 118.246 44.410 1.00 81.91 O ANISOU14480 OG SER A1031 9471 10646 11005 903 -1524 2299 O ATOM 14481 H SER A1031 -14.591 115.324 45.050 1.00115.02 H ATOM 14482 HA SER A1031 -13.077 116.518 46.796 1.00103.15 H ATOM 14483 HB2 SER A1031 -12.508 117.881 45.160 1.00 99.41 H ATOM 14484 HB3 SER A1031 -13.102 116.686 44.296 1.00 99.41 H ATOM 14485 HG SER A1031 -13.986 118.606 43.711 1.00 98.29 H ATOM 14486 N LEU A1032 -16.056 117.377 46.914 1.00 96.76 N ANISOU14486 N LEU A1032 11188 12620 12956 1152 -1359 2284 N ATOM 14487 CA LEU A1032 -17.046 118.210 47.576 1.00102.52 C ANISOU14487 CA LEU A1032 11857 13334 13762 1257 -1373 2258 C ATOM 14488 C LEU A1032 -17.351 117.762 48.997 1.00109.66 C ANISOU14488 C LEU A1032 12706 14306 14653 1393 -1263 2239 C ATOM 14489 O LEU A1032 -17.594 118.598 49.861 1.00114.83 O ANISOU14489 O LEU A1032 13341 14959 15331 1512 -1267 2183 O ATOM 14490 CB LEU A1032 -18.343 118.241 46.771 1.00100.54 C ANISOU14490 CB LEU A1032 11552 13050 13599 1203 -1421 2308 C ATOM 14491 CG LEU A1032 -18.399 119.166 45.553 1.00100.60 C ANISOU14491 CG LEU A1032 11601 12981 13642 1110 -1543 2312 C ATOM 14492 CD1 LEU A1032 -19.824 119.171 45.037 1.00105.45 C ANISOU14492 CD1 LEU A1032 12147 13569 14350 1088 -1578 2353 C ATOM 14493 CD2 LEU A1032 -17.941 120.597 45.855 1.00 94.91 C ANISOU14493 CD2 LEU A1032 10915 12212 12935 1166 -1611 2246 C ATOM 14494 H LEU A1032 -16.387 116.697 46.505 1.00116.11 H ATOM 14495 HA LEU A1032 -16.706 119.118 47.621 1.00123.02 H ATOM 14496 HB2 LEU A1032 -18.519 117.342 46.452 1.00120.65 H ATOM 14497 HB3 LEU A1032 -19.059 118.513 47.366 1.00120.65 H ATOM 14498 HG LEU A1032 -17.828 118.808 44.856 1.00120.72 H ATOM 14499 HD11 LEU A1032 -19.877 119.754 44.263 1.00126.54 H ATOM 14500 HD12 LEU A1032 -20.072 118.267 44.788 1.00126.54 H ATOM 14501 HD13 LEU A1032 -20.412 119.496 45.737 1.00126.54 H ATOM 14502 HD21 LEU A1032 -18.001 121.126 45.045 1.00113.89 H ATOM 14503 HD22 LEU A1032 -18.515 120.974 46.540 1.00113.89 H ATOM 14504 HD23 LEU A1032 -17.023 120.574 46.168 1.00113.89 H ATOM 14505 N ARG A1033 -17.367 116.456 49.243 1.00113.77 N ANISOU14505 N ARG A1033 13202 14889 15138 1380 -1166 2284 N ATOM 14506 CA ARG A1033 -17.688 115.954 50.581 1.00112.48 C ANISOU14506 CA ARG A1033 12985 14798 14956 1506 -1047 2277 C ATOM 14507 C ARG A1033 -16.604 116.319 51.590 1.00117.29 C ANISOU14507 C ARG A1033 13650 15433 15481 1604 -1016 2199 C ATOM 14508 O ARG A1033 -15.423 116.038 51.374 1.00115.39 O ANISOU14508 O ARG A1033 13481 15191 15170 1551 -1022 2183 O ATOM 14509 CB ARG A1033 -17.921 114.443 50.547 1.00 99.75 C ANISOU14509 CB ARG A1033 11334 13238 13331 1459 -955 2350 C ATOM 14510 CG ARG A1033 -19.143 114.077 49.720 1.00111.04 C ANISOU14510 CG ARG A1033 12693 14639 14858 1385 -985 2422 C ATOM 14511 CD ARG A1033 -19.334 112.576 49.616 1.00106.38 C ANISOU14511 CD ARG A1033 12063 14087 14269 1330 -911 2494 C ATOM 14512 NE ARG A1033 -19.450 111.996 50.952 1.00117.91 N ANISOU14512 NE ARG A1033 13475 15623 15701 1442 -778 2502 N ATOM 14513 CZ ARG A1033 -20.577 111.571 51.521 1.00123.97 C ANISOU14513 CZ ARG A1033 14141 16424 16538 1498 -702 2555 C ATOM 14514 NH1 ARG A1033 -21.744 111.625 50.887 1.00126.71 N ANISOU14514 NH1 ARG A1033 14416 16730 16997 1453 -747 2604 N ATOM 14515 NH2 ARG A1033 -20.528 111.081 52.753 1.00116.67 N ANISOU14515 NH2 ARG A1033 13186 15575 15567 1602 -576 2561 N ATOM 14516 H ARG A1033 -17.198 115.844 48.663 1.00136.53 H ATOM 14517 HA ARG A1033 -18.513 116.370 50.876 1.00134.98 H ATOM 14518 HB2 ARG A1033 -17.148 114.010 50.153 1.00119.71 H ATOM 14519 HB3 ARG A1033 -18.061 114.122 51.452 1.00119.71 H ATOM 14520 HG2 ARG A1033 -19.934 114.454 50.137 1.00133.25 H ATOM 14521 HG3 ARG A1033 -19.037 114.431 48.823 1.00133.25 H ATOM 14522 HD2 ARG A1033 -20.148 112.385 49.125 1.00127.65 H ATOM 14523 HD3 ARG A1033 -18.567 112.181 49.173 1.00127.65 H ATOM 14524 HE ARG A1033 -18.727 111.923 51.411 1.00141.49 H ATOM 14525 HH11 ARG A1033 -21.786 111.945 50.090 1.00152.05 H ATOM 14526 HH12 ARG A1033 -22.458 111.341 51.275 1.00152.05 H ATOM 14527 HH21 ARG A1033 -19.777 111.039 53.170 1.00140.00 H ATOM 14528 HH22 ARG A1033 -21.246 110.796 53.131 1.00140.00 H ATOM 14529 N ARG A1034 -17.025 116.955 52.685 1.00119.28 N ANISOU14529 N ARG A1034 13871 15708 15742 1748 -986 2145 N ATOM 14530 CA ARG A1034 -16.113 117.451 53.715 1.00105.86 C ANISOU14530 CA ARG A1034 12224 14025 13972 1858 -971 2054 C ATOM 14531 C ARG A1034 -16.500 116.909 55.085 1.00108.28 C ANISOU14531 C ARG A1034 12488 14421 14231 1995 -838 2040 C ATOM 14532 O ARG A1034 -16.411 117.619 56.088 1.00100.42 O ANISOU14532 O ARG A1034 11504 13440 13210 2127 -831 1956 O ATOM 14533 CB ARG A1034 -16.145 118.976 53.760 1.00 92.51 C ANISOU14533 CB ARG A1034 10551 12267 12334 1915 -1084 1976 C ATOM 14534 CG ARG A1034 -15.846 119.647 52.434 1.00107.11 C ANISOU14534 CG ARG A1034 12439 14025 14233 1787 -1216 1993 C ATOM 14535 CD ARG A1034 -14.471 119.260 51.905 1.00108.46 C ANISOU14535 CD ARG A1034 12689 14184 14337 1689 -1231 1998 C ATOM 14536 NE ARG A1034 -13.996 120.107 50.808 1.00110.40 N ANISOU14536 NE ARG A1034 12982 14345 14618 1586 -1353 1999 N ATOM 14537 CZ ARG A1034 -13.741 121.412 50.908 1.00114.42 C ANISOU14537 CZ ARG A1034 13516 14789 15171 1630 -1450 1934 C ATOM 14538 NH1 ARG A1034 -13.925 122.057 52.058 1.00119.30 N ANISOU14538 NH1 ARG A1034 14117 15412 15802 1782 -1450 1853 N ATOM 14539 NH2 ARG A1034 -13.298 122.080 49.849 1.00107.47 N ANISOU14539 NH2 ARG A1034 12677 13838 14319 1523 -1545 1948 N ATOM 14540 H ARG A1034 -17.853 117.114 52.856 1.00143.13 H ATOM 14541 HA ARG A1034 -15.208 117.166 53.513 1.00127.03 H ATOM 14542 HB2 ARG A1034 -17.029 119.260 54.041 1.00111.02 H ATOM 14543 HB3 ARG A1034 -15.484 119.282 54.400 1.00111.02 H ATOM 14544 HG2 ARG A1034 -16.510 119.375 51.781 1.00128.53 H ATOM 14545 HG3 ARG A1034 -15.866 120.610 52.551 1.00128.53 H ATOM 14546 HD2 ARG A1034 -13.829 119.325 52.629 1.00130.16 H ATOM 14547 HD3 ARG A1034 -14.508 118.347 51.580 1.00130.16 H ATOM 14548 HE ARG A1034 -13.873 119.735 50.043 1.00132.47 H ATOM 14549 HH11 ARG A1034 -14.207 121.630 52.749 1.00143.17 H ATOM 14550 HH12 ARG A1034 -13.759 122.899 52.110 1.00143.17 H ATOM 14551 HH21 ARG A1034 -13.180 121.672 49.101 1.00128.97 H ATOM 14552 HH22 ARG A1034 -13.139 122.923 49.908 1.00128.97 H ATOM 14553 N GLU A1035 -16.913 115.644 55.117 1.00115.39 N ANISOU14553 N GLU A1035 13342 15380 15120 1961 -736 2122 N ATOM 14554 CA GLU A1035 -17.423 115.012 56.331 1.00113.51 C ANISOU14554 CA GLU A1035 13053 15232 14844 2077 -598 2134 C ATOM 14555 C GLU A1035 -16.430 113.973 56.852 1.00113.24 C ANISOU14555 C GLU A1035 13066 15252 14705 2077 -511 2137 C ATOM 14556 O GLU A1035 -16.495 113.552 58.009 1.00111.16 O ANISOU14556 O GLU A1035 12790 15066 14380 2187 -400 2127 O ATOM 14557 CB GLU A1035 -18.774 114.350 56.041 1.00113.20 C ANISOU14557 CB GLU A1035 12907 15214 14890 2042 -545 2237 C ATOM 14558 CG GLU A1035 -19.788 115.267 55.342 1.00122.37 C ANISOU14558 CG GLU A1035 14019 16312 16165 2019 -640 2243 C ATOM 14559 CD GLU A1035 -20.291 116.392 56.236 1.00124.79 C ANISOU14559 CD GLU A1035 14303 16628 16482 2168 -645 2165 C ATOM 14560 OE1 GLU A1035 -20.239 116.238 57.477 1.00125.42 O ANISOU14560 OE1 GLU A1035 14378 16784 16491 2296 -543 2131 O ATOM 14561 OE2 GLU A1035 -20.721 117.438 55.696 1.00115.14 O ANISOU14561 OE2 GLU A1035 13074 15338 15336 2157 -755 2134 O ATOM 14562 H GLU A1035 -16.908 115.122 54.434 1.00138.47 H ATOM 14563 HA GLU A1035 -17.551 115.686 57.017 1.00136.21 H ATOM 14564 HB2 GLU A1035 -18.628 113.582 55.468 1.00135.84 H ATOM 14565 HB3 GLU A1035 -19.166 114.063 56.880 1.00135.84 H ATOM 14566 HG2 GLU A1035 -19.367 115.668 54.565 1.00146.85 H ATOM 14567 HG3 GLU A1035 -20.554 114.739 55.067 1.00146.85 H ATOM 14568 N VAL A1037 -14.163 112.099 58.181 1.00 97.23 N ANISOU14568 N VAL A1037 11161 13330 12451 2113 -347 2104 N ATOM 14569 CA VAL A1037 -14.247 110.751 57.618 1.00 96.73 C ANISOU14569 CA VAL A1037 11067 13284 12402 2004 -298 2203 C ATOM 14570 C VAL A1037 -13.676 110.728 56.213 1.00 87.26 C ANISOU14570 C VAL A1037 9908 12012 11233 1848 -403 2217 C ATOM 14571 O VAL A1037 -13.181 109.707 55.746 1.00 87.07 O ANISOU14571 O VAL A1037 9901 11993 11189 1757 -385 2259 O ATOM 14572 CB VAL A1037 -15.695 110.231 57.609 1.00108.68 C ANISOU14572 CB VAL A1037 12468 14828 13998 2004 -234 2303 C ATOM 14573 CG1 VAL A1037 -15.818 108.942 56.786 1.00 97.25 C ANISOU14573 CG1 VAL A1037 10986 13371 12594 1870 -219 2401 C ATOM 14574 CG2 VAL A1037 -16.174 110.011 59.041 1.00113.22 C ANISOU14574 CG2 VAL A1037 13002 15491 14525 2153 -104 2306 C ATOM 14575 HA VAL A1037 -13.718 110.149 58.165 1.00116.08 H ATOM 14576 HB VAL A1037 -16.267 110.900 57.203 1.00130.42 H ATOM 14577 HG11 VAL A1037 -16.742 108.645 56.802 1.00116.70 H ATOM 14578 HG12 VAL A1037 -15.545 109.124 55.873 1.00116.70 H ATOM 14579 HG13 VAL A1037 -15.245 108.264 57.175 1.00116.70 H ATOM 14580 HG21 VAL A1037 -17.087 109.683 59.021 1.00135.86 H ATOM 14581 HG22 VAL A1037 -15.597 109.359 59.469 1.00135.86 H ATOM 14582 HG23 VAL A1037 -16.134 110.853 59.519 1.00135.86 H ATOM 14583 N TRP A1038 -13.759 111.864 55.541 1.00 96.58 N ANISOU14583 N TRP A1038 11105 13128 12464 1820 -514 2182 N ATOM 14584 CA TRP A1038 -13.140 112.036 54.239 1.00100.29 C ANISOU14584 CA TRP A1038 11623 13531 12951 1682 -619 2189 C ATOM 14585 C TRP A1038 -11.911 112.922 54.389 1.00 80.74 C ANISOU14585 C TRP A1038 9234 11021 10424 1707 -683 2097 C ATOM 14586 O TRP A1038 -11.258 113.278 53.410 1.00 67.55 O ANISOU14586 O TRP A1038 7611 9296 8761 1607 -771 2093 O ATOM 14587 CB TRP A1038 -14.154 112.655 53.274 1.00106.90 C ANISOU14587 CB TRP A1038 12414 14314 13890 1619 -703 2228 C ATOM 14588 CG TRP A1038 -15.199 111.684 52.869 1.00100.47 C ANISOU14588 CG TRP A1038 11520 13516 13136 1562 -661 2321 C ATOM 14589 CD1 TRP A1038 -16.297 111.292 53.584 1.00 98.42 C ANISOU14589 CD1 TRP A1038 11173 13303 12921 1637 -575 2366 C ATOM 14590 CD2 TRP A1038 -15.233 110.956 51.647 1.00 96.69 C ANISOU14590 CD2 TRP A1038 11044 13007 12687 1417 -705 2380 C ATOM 14591 NE1 TRP A1038 -17.010 110.355 52.872 1.00100.79 N ANISOU14591 NE1 TRP A1038 11414 13595 13288 1542 -569 2453 N ATOM 14592 CE2 TRP A1038 -16.378 110.135 51.677 1.00 98.73 C ANISOU14592 CE2 TRP A1038 11210 13286 13016 1409 -652 2457 C ATOM 14593 CE3 TRP A1038 -14.401 110.919 50.528 1.00 92.47 C ANISOU14593 CE3 TRP A1038 10579 12432 12124 1296 -785 2373 C ATOM 14594 CZ2 TRP A1038 -16.716 109.291 50.618 1.00100.91 C ANISOU14594 CZ2 TRP A1038 11465 13535 13342 1286 -689 2520 C ATOM 14595 CZ3 TRP A1038 -14.732 110.081 49.484 1.00 94.95 C ANISOU14595 CZ3 TRP A1038 10877 12728 12471 1178 -814 2433 C ATOM 14596 CH2 TRP A1038 -15.879 109.278 49.532 1.00 95.11 C ANISOU14596 CH2 TRP A1038 10809 12762 12568 1174 -772 2501 C ATOM 14597 H TRP A1038 -14.175 112.562 55.823 1.00115.90 H ATOM 14598 HA TRP A1038 -12.862 111.174 53.891 1.00120.35 H ATOM 14599 HB2 TRP A1038 -14.590 113.405 53.707 1.00128.29 H ATOM 14600 HB3 TRP A1038 -13.692 112.952 52.474 1.00128.29 H ATOM 14601 HD1 TRP A1038 -16.522 111.604 54.431 1.00118.11 H ATOM 14602 HE1 TRP A1038 -17.739 109.978 53.130 1.00120.95 H ATOM 14603 HE3 TRP A1038 -13.638 111.449 50.486 1.00110.97 H ATOM 14604 HZ2 TRP A1038 -17.476 108.756 50.650 1.00121.09 H ATOM 14605 HZ3 TRP A1038 -14.186 110.051 48.732 1.00113.94 H ATOM 14606 HH2 TRP A1038 -16.077 108.723 48.813 1.00114.14 H ATOM 14607 N LEU A1039 -11.589 113.249 55.635 1.00 76.65 N ANISOU14607 N LEU A1039 8736 10536 9852 1843 -637 2024 N ATOM 14608 CA LEU A1039 -10.542 114.220 55.932 1.00 88.84 C ANISOU14608 CA LEU A1039 10353 12038 11366 1888 -707 1926 C ATOM 14609 C LEU A1039 -9.151 113.929 55.332 1.00 97.67 C ANISOU14609 C LEU A1039 11544 13128 12439 1792 -744 1915 C ATOM 14610 O LEU A1039 -8.454 114.879 54.956 1.00 94.47 O ANISOU14610 O LEU A1039 11182 12659 12054 1770 -842 1869 O ATOM 14611 CB LEU A1039 -10.425 114.411 57.446 1.00 96.62 C ANISOU14611 CB LEU A1039 11351 13071 12290 2053 -642 1845 C ATOM 14612 CG LEU A1039 -11.367 115.443 58.058 1.00 96.43 C ANISOU14612 CG LEU A1039 11286 13042 12311 2169 -663 1799 C ATOM 14613 CD1 LEU A1039 -11.273 115.387 59.573 1.00101.47 C ANISOU14613 CD1 LEU A1039 11939 13745 12869 2327 -578 1727 C ATOM 14614 CD2 LEU A1039 -11.051 116.849 57.564 1.00 92.43 C ANISOU14614 CD2 LEU A1039 10809 12441 11868 2156 -807 1737 C ATOM 14615 H LEU A1039 -11.966 112.919 56.334 1.00 91.98 H ATOM 14616 HA LEU A1039 -10.825 115.073 55.567 1.00106.61 H ATOM 14617 HB2 LEU A1039 -10.607 113.561 57.877 1.00115.94 H ATOM 14618 HB3 LEU A1039 -9.519 114.688 57.651 1.00115.94 H ATOM 14619 HG LEU A1039 -12.279 115.231 57.805 1.00115.72 H ATOM 14620 HD11 LEU A1039 -11.876 116.047 59.951 1.00121.76 H ATOM 14621 HD12 LEU A1039 -11.524 114.500 59.872 1.00121.76 H ATOM 14622 HD13 LEU A1039 -10.361 115.581 59.839 1.00121.76 H ATOM 14623 HD21 LEU A1039 -11.669 117.474 57.974 1.00110.91 H ATOM 14624 HD22 LEU A1039 -10.141 117.073 57.812 1.00110.91 H ATOM 14625 HD23 LEU A1039 -11.148 116.873 56.599 1.00110.91 H ATOM 14626 N PRO A1040 -8.729 112.638 55.264 1.00 95.81 N ANISOU14626 N PRO A1040 11319 12938 12148 1738 -669 1957 N ATOM 14627 CA PRO A1040 -7.417 112.300 54.679 1.00 80.77 C ANISOU14627 CA PRO A1040 9484 11007 10199 1638 -696 1936 C ATOM 14628 C PRO A1040 -7.210 112.840 53.263 1.00 80.91 C ANISOU14628 C PRO A1040 9519 10956 10266 1501 -798 1961 C ATOM 14629 O PRO A1040 -6.119 113.301 52.912 1.00 61.08 O ANISOU14629 O PRO A1040 7066 8403 7740 1455 -854 1919 O ATOM 14630 CB PRO A1040 -7.438 110.774 54.620 1.00 76.36 C ANISOU14630 CB PRO A1040 8913 10499 9600 1579 -603 1987 C ATOM 14631 CG PRO A1040 -8.404 110.348 55.645 1.00 79.78 C ANISOU14631 CG PRO A1040 9285 10997 10032 1693 -512 2018 C ATOM 14632 CD PRO A1040 -9.384 111.454 55.857 1.00 90.00 C ANISOU14632 CD PRO A1040 10534 12275 11388 1772 -551 2010 C ATOM 14633 HA PRO A1040 -6.694 112.597 55.254 1.00 96.93 H ATOM 14634 HB2 PRO A1040 -7.727 110.487 53.739 1.00 91.63 H ATOM 14635 HB3 PRO A1040 -6.554 110.428 54.819 1.00 91.63 H ATOM 14636 HG2 PRO A1040 -8.863 109.551 55.336 1.00 95.74 H ATOM 14637 HG3 PRO A1040 -7.929 110.161 56.469 1.00 95.74 H ATOM 14638 HD2 PRO A1040 -10.213 111.261 55.393 1.00108.01 H ATOM 14639 HD3 PRO A1040 -9.533 111.592 56.805 1.00108.01 H ATOM 14640 N LEU A1041 -8.262 112.755 52.455 1.00 93.35 N ANISOU14640 N LEU A1041 11043 12524 11900 1436 -820 2034 N ATOM 14641 CA LEU A1041 -8.246 113.274 51.096 1.00 90.53 C ANISOU14641 CA LEU A1041 10700 12110 11587 1314 -918 2068 C ATOM 14642 C LEU A1041 -8.189 114.798 51.067 1.00 88.77 C ANISOU14642 C LEU A1041 10486 11825 11419 1355 -1018 2034 C ATOM 14643 O LEU A1041 -7.401 115.367 50.318 1.00105.08 O ANISOU14643 O LEU A1041 12596 13841 13490 1278 -1092 2027 O ATOM 14644 CB LEU A1041 -9.482 112.791 50.342 1.00 98.01 C ANISOU14644 CB LEU A1041 11588 13064 12589 1251 -921 2151 C ATOM 14645 CG LEU A1041 -9.612 113.245 48.891 1.00 82.90 C ANISOU14645 CG LEU A1041 9688 11096 10714 1126 -1020 2192 C ATOM 14646 CD1 LEU A1041 -8.600 112.544 47.984 1.00 78.48 C ANISOU14646 CD1 LEU A1041 9187 10540 10090 1005 -1024 2201 C ATOM 14647 CD2 LEU A1041 -11.016 112.984 48.434 1.00 64.96 C ANISOU14647 CD2 LEU A1041 7350 8820 8510 1100 -1028 2250 C ATOM 14648 H LEU A1041 -9.010 112.393 52.678 1.00112.02 H ATOM 14649 HA LEU A1041 -7.462 112.935 50.637 1.00108.63 H ATOM 14650 HB2 LEU A1041 -9.477 111.821 50.340 1.00117.62 H ATOM 14651 HB3 LEU A1041 -10.268 113.107 50.814 1.00117.62 H ATOM 14652 HG LEU A1041 -9.451 114.200 48.841 1.00 99.48 H ATOM 14653 HD11 LEU A1041 -8.719 112.862 47.075 1.00 94.17 H ATOM 14654 HD12 LEU A1041 -7.704 112.750 48.293 1.00 94.17 H ATOM 14655 HD13 LEU A1041 -8.752 111.587 48.023 1.00 94.17 H ATOM 14656 HD21 LEU A1041 -11.106 113.270 47.512 1.00 77.95 H ATOM 14657 HD22 LEU A1041 -11.199 112.034 48.506 1.00 77.95 H ATOM 14658 HD23 LEU A1041 -11.629 113.482 48.997 1.00 77.95 H ATOM 14659 N MET A1042 -9.026 115.460 51.864 1.00 83.29 N ANISOU14659 N MET A1042 9749 11129 10767 1471 -1019 2005 N ATOM 14660 CA MET A1042 -8.996 116.918 51.943 1.00 91.57 C ANISOU14660 CA MET A1042 10808 12111 11874 1519 -1117 1952 C ATOM 14661 C MET A1042 -7.604 117.348 52.404 1.00 95.92 C ANISOU14661 C MET A1042 11421 12638 12388 1553 -1146 1881 C ATOM 14662 O MET A1042 -7.072 118.362 51.944 1.00 92.94 O ANISOU14662 O MET A1042 11070 12186 12055 1520 -1246 1860 O ATOM 14663 CB MET A1042 -10.102 117.437 52.884 1.00 94.36 C ANISOU14663 CB MET A1042 11107 12478 12268 1655 -1100 1917 C ATOM 14664 CG MET A1042 -9.985 118.914 53.323 1.00106.29 C ANISOU14664 CG MET A1042 12630 13924 13830 1743 -1196 1834 C ATOM 14665 SD MET A1042 -10.175 120.151 52.008 1.00160.89 S ANISOU14665 SD MET A1042 19550 20735 20844 1638 -1345 1858 S ATOM 14666 CE MET A1042 -9.928 121.682 52.920 1.00124.65 C ANISOU14666 CE MET A1042 14975 16081 16307 1778 -1441 1742 C ATOM 14667 H MET A1042 -9.617 115.090 52.367 1.00 99.94 H ATOM 14668 HA MET A1042 -9.161 117.284 51.060 1.00109.89 H ATOM 14669 HB2 MET A1042 -10.955 117.336 52.434 1.00113.24 H ATOM 14670 HB3 MET A1042 -10.096 116.895 53.688 1.00113.24 H ATOM 14671 HG2 MET A1042 -10.670 119.089 53.987 1.00127.55 H ATOM 14672 HG3 MET A1042 -9.110 119.046 53.720 1.00127.55 H ATOM 14673 HE1 MET A1042 -10.008 122.430 52.308 1.00149.58 H ATOM 14674 HE2 MET A1042 -10.603 121.748 53.614 1.00149.58 H ATOM 14675 HE3 MET A1042 -9.044 121.673 53.318 1.00149.58 H ATOM 14676 N SER A1043 -7.012 116.546 53.289 1.00 94.36 N ANISOU14676 N SER A1043 11244 12496 12112 1616 -1059 1848 N ATOM 14677 CA SER A1043 -5.675 116.808 53.818 1.00 85.39 C ANISOU14677 CA SER A1043 10167 11339 10938 1654 -1077 1773 C ATOM 14678 C SER A1043 -4.616 116.728 52.723 1.00 84.52 C ANISOU14678 C SER A1043 10103 11186 10824 1505 -1120 1795 C ATOM 14679 O SER A1043 -3.867 117.687 52.509 1.00 86.37 O ANISOU14679 O SER A1043 10364 11352 11100 1491 -1209 1764 O ATOM 14680 CB SER A1043 -5.337 115.820 54.940 1.00 90.72 C ANISOU14680 CB SER A1043 10859 12087 11524 1740 -966 1733 C ATOM 14681 OG SER A1043 -6.298 115.864 55.983 1.00 90.99 O ANISOU14681 OG SER A1043 10855 12164 11552 1871 -910 1705 O ATOM 14682 H SER A1043 -7.372 115.831 53.603 1.00113.23 H ATOM 14683 HA SER A1043 -5.654 117.704 54.190 1.00102.47 H ATOM 14684 HB2 SER A1043 -5.315 114.923 54.572 1.00108.86 H ATOM 14685 HB3 SER A1043 -4.468 116.047 55.306 1.00108.86 H ATOM 14686 HG SER A1043 -7.058 115.667 55.682 1.00109.19 H ATOM 14687 N TYR A1044 -4.569 115.586 52.034 1.00 88.29 N ANISOU14687 N TYR A1044 10586 11705 11256 1397 -1059 1852 N ATOM 14688 CA TYR A1044 -3.556 115.307 51.010 1.00 94.77 C ANISOU14688 CA TYR A1044 11451 12505 12054 1260 -1079 1874 C ATOM 14689 C TYR A1044 -3.545 116.366 49.909 1.00 96.44 C ANISOU14689 C TYR A1044 11663 12649 12333 1176 -1188 1915 C ATOM 14690 O TYR A1044 -2.488 116.676 49.341 1.00 88.48 O ANISOU14690 O TYR A1044 10692 11604 11322 1103 -1228 1914 O ATOM 14691 CB TYR A1044 -3.810 113.921 50.395 1.00 95.40 C ANISOU14691 CB TYR A1044 11524 12641 12082 1169 -1004 1929 C ATOM 14692 CG TYR A1044 -2.863 113.513 49.275 1.00 99.62 C ANISOU14692 CG TYR A1044 12102 13169 12581 1032 -1017 1953 C ATOM 14693 CD1 TYR A1044 -1.530 113.913 49.269 1.00 99.87 C ANISOU14693 CD1 TYR A1044 12179 13168 12597 1012 -1042 1910 C ATOM 14694 CD2 TYR A1044 -3.312 112.724 48.219 1.00 84.42 C ANISOU14694 CD2 TYR A1044 10169 11270 10638 926 -1005 2017 C ATOM 14695 CE1 TYR A1044 -0.673 113.533 48.245 1.00 88.54 C ANISOU14695 CE1 TYR A1044 10778 11736 11127 892 -1045 1935 C ATOM 14696 CE2 TYR A1044 -2.469 112.344 47.193 1.00 76.37 C ANISOU14696 CE2 TYR A1044 9189 10254 9576 812 -1014 2035 C ATOM 14697 CZ TYR A1044 -1.151 112.742 47.206 1.00 81.97 C ANISOU14697 CZ TYR A1044 9941 10939 10266 795 -1028 1996 C ATOM 14698 OH TYR A1044 -0.336 112.339 46.164 1.00 79.56 O ANISOU14698 OH TYR A1044 9670 10645 9914 685 -1028 2019 O ATOM 14699 H TYR A1044 -5.127 114.941 52.145 1.00105.95 H ATOM 14700 HA TYR A1044 -2.679 115.297 51.425 1.00113.73 H ATOM 14701 HB2 TYR A1044 -3.733 113.256 51.097 1.00114.48 H ATOM 14702 HB3 TYR A1044 -4.711 113.907 50.034 1.00114.48 H ATOM 14703 HD1 TYR A1044 -1.207 114.439 49.965 1.00119.84 H ATOM 14704 HD2 TYR A1044 -4.200 112.448 48.204 1.00101.31 H ATOM 14705 HE1 TYR A1044 0.217 113.805 48.254 1.00106.25 H ATOM 14706 HE2 TYR A1044 -2.789 111.814 46.499 1.00 91.65 H ATOM 14707 HH TYR A1044 -0.773 111.870 45.622 1.00 95.47 H ATOM 14708 N ARG A1045 -4.724 116.922 49.627 1.00 92.01 N ANISOU14708 N ARG A1045 11056 12069 11832 1189 -1234 1956 N ATOM 14709 CA ARG A1045 -4.898 117.850 48.516 1.00 81.23 C ANISOU14709 CA ARG A1045 9691 10642 10531 1103 -1334 2003 C ATOM 14710 C ARG A1045 -4.128 119.158 48.666 1.00 88.15 C ANISOU14710 C ARG A1045 10589 11439 11464 1127 -1423 1956 C ATOM 14711 O ARG A1045 -3.666 119.714 47.667 1.00 92.22 O ANISOU14711 O ARG A1045 11127 11907 12006 1025 -1484 1990 O ATOM 14712 CB ARG A1045 -6.373 118.126 48.280 1.00 87.76 C ANISOU14712 CB ARG A1045 10471 11462 11412 1114 -1354 2030 C ATOM 14713 CG ARG A1045 -7.062 117.003 47.518 1.00 97.57 C ANISOU14713 CG ARG A1045 11696 12753 12622 1030 -1304 2098 C ATOM 14714 CD ARG A1045 -8.219 117.520 46.689 1.00100.73 C ANISOU14714 CD ARG A1045 12066 13118 13087 983 -1365 2138 C ATOM 14715 NE ARG A1045 -9.346 117.934 47.517 1.00100.91 N ANISOU14715 NE ARG A1045 12033 13138 13171 1094 -1362 2115 N ATOM 14716 CZ ARG A1045 -10.285 118.791 47.130 1.00105.12 C ANISOU14716 CZ ARG A1045 12537 13625 13780 1093 -1430 2124 C ATOM 14717 NH1 ARG A1045 -10.236 119.338 45.921 1.00 96.64 N ANISOU14717 NH1 ARG A1045 11490 12501 12729 986 -1507 2158 N ATOM 14718 NH2 ARG A1045 -11.269 119.110 47.960 1.00116.57 N ANISOU14718 NH2 ARG A1045 13932 15080 15280 1204 -1419 2099 N ATOM 14719 H ARG A1045 -5.445 116.774 50.072 1.00110.41 H ATOM 14720 HA ARG A1045 -4.561 117.418 47.715 1.00 97.47 H ATOM 14721 HB2 ARG A1045 -6.817 118.226 49.136 1.00105.31 H ATOM 14722 HB3 ARG A1045 -6.464 118.941 47.761 1.00105.31 H ATOM 14723 HG2 ARG A1045 -6.424 116.583 46.921 1.00117.08 H ATOM 14724 HG3 ARG A1045 -7.408 116.353 48.150 1.00117.08 H ATOM 14725 HD2 ARG A1045 -7.924 118.288 46.174 1.00120.87 H ATOM 14726 HD3 ARG A1045 -8.524 116.817 46.094 1.00120.87 H ATOM 14727 HE ARG A1045 -9.406 117.602 48.308 1.00121.09 H ATOM 14728 HH11 ARG A1045 -9.597 119.134 45.382 1.00115.97 H ATOM 14729 HH12 ARG A1045 -10.845 119.893 45.675 1.00115.97 H ATOM 14730 HH21 ARG A1045 -11.303 118.758 48.744 1.00139.88 H ATOM 14731 HH22 ARG A1045 -11.878 119.665 47.712 1.00139.88 H ATOM 14732 N ASN A1046 -3.986 119.654 49.893 1.00 96.36 N ANISOU14732 N ASN A1046 11624 12464 12525 1263 -1433 1878 N ATOM 14733 CA ASN A1046 -3.008 120.712 50.143 1.00104.63 C ANISOU14733 CA ASN A1046 12696 13435 13623 1289 -1515 1822 C ATOM 14734 C ASN A1046 -1.614 120.179 49.796 1.00 93.97 C ANISOU14734 C ASN A1046 11385 12091 12228 1209 -1492 1838 C ATOM 14735 O ASN A1046 -1.066 119.324 50.500 1.00 61.60 O ANISOU14735 O ASN A1046 7310 8040 8057 1249 -1410 1787 O ATOM 14736 CB ASN A1046 -3.066 121.184 51.592 1.00107.41 C ANISOU14736 CB ASN A1046 13041 13779 13992 1461 -1526 1722 C ATOM 14737 CG ASN A1046 -4.431 121.719 51.974 1.00111.95 C ANISOU14737 CG ASN A1046 13575 14352 14608 1548 -1544 1701 C ATOM 14738 OD1 ASN A1046 -5.405 120.966 52.048 1.00111.39 O ANISOU14738 OD1 ASN A1046 13472 14348 14503 1561 -1469 1738 O ATOM 14739 ND2 ASN A1046 -4.506 123.025 52.233 1.00108.06 N ANISOU14739 ND2 ASN A1046 13080 13786 14193 1612 -1641 1638 N ATOM 14740 H ASN A1046 -4.432 119.403 50.584 1.00115.63 H ATOM 14741 HA ASN A1046 -3.199 121.469 49.567 1.00125.55 H ATOM 14742 HB2 ASN A1046 -2.862 120.437 52.176 1.00128.89 H ATOM 14743 HB3 ASN A1046 -2.418 121.894 51.720 1.00128.89 H ATOM 14744 HD21 ASN A1046 -5.259 123.377 52.454 1.00129.67 H ATOM 14745 HD22 ASN A1046 -3.802 123.516 52.178 1.00129.67 H ATOM 14746 N SER A1047 -1.068 120.675 48.689 1.00101.16 N ANISOU14746 N SER A1047 12311 12954 13171 1088 -1548 1889 N ATOM 14747 CA SER A1047 0.157 120.134 48.105 1.00102.07 C ANISOU14747 CA SER A1047 12459 13083 13242 990 -1519 1919 C ATOM 14748 C SER A1047 -0.118 118.772 47.466 1.00 92.97 C ANISOU14748 C SER A1047 11317 12016 11990 909 -1422 1965 C ATOM 14749 O SER A1047 -1.034 118.620 46.659 1.00 79.86 O ANISOU14749 O SER A1047 9640 10376 10328 852 -1429 2034 O ATOM 14750 CB SER A1047 1.262 119.993 49.157 1.00 94.91 C ANISOU14750 CB SER A1047 11577 12165 12318 1065 -1493 1826 C ATOM 14751 OG SER A1047 1.053 118.829 49.949 1.00 92.28 O ANISOU14751 OG SER A1047 11254 11910 11896 1127 -1388 1779 O ATOM 14752 H SER A1047 -1.394 121.338 48.249 1.00121.39 H ATOM 14753 HA SER A1047 0.472 120.736 47.413 1.00122.49 H ATOM 14754 HB2 SER A1047 2.119 119.920 48.708 1.00113.89 H ATOM 14755 HB3 SER A1047 1.253 120.773 49.732 1.00113.89 H ATOM 14756 HG SER A1047 0.313 118.879 50.342 1.00110.73 H TER 14757 SER A1047 ATOM 14758 N LYS B 321 16.787 145.001 65.453 1.00 74.17 N ANISOU14758 N LYS B 321 8436 8850 10897 -386 -933 204 N ATOM 14759 CA LYS B 321 17.038 143.829 66.293 1.00 97.93 C ANISOU14759 CA LYS B 321 11485 11873 13850 -369 -899 178 C ATOM 14760 C LYS B 321 18.507 143.403 66.255 1.00 98.95 C ANISOU14760 C LYS B 321 11690 12083 13823 -355 -914 127 C ATOM 14761 O LYS B 321 18.949 142.674 65.359 1.00 93.93 O ANISOU14761 O LYS B 321 11086 11479 13125 -360 -995 123 O ATOM 14762 CB LYS B 321 16.111 142.674 65.906 1.00 93.33 C ANISOU14762 CB LYS B 321 10884 11250 13329 -377 -949 213 C ATOM 14763 CG LYS B 321 14.676 142.936 66.346 1.00108.53 C ANISOU14763 CG LYS B 321 12740 13095 15402 -385 -909 255 C ATOM 14764 CD LYS B 321 13.729 141.792 66.012 1.00106.89 C ANISOU14764 CD LYS B 321 12512 12845 15258 -394 -954 288 C ATOM 14765 CE LYS B 321 12.542 141.743 66.978 1.00101.57 C ANISOU14765 CE LYS B 321 11789 12103 14699 -393 -882 313 C ATOM 14766 NZ LYS B 321 12.390 140.390 67.589 1.00 99.75 N ANISOU14766 NZ LYS B 321 11585 11867 14451 -382 -865 306 N ATOM 14767 HA LYS B 321 16.833 144.065 67.211 1.00117.51 H ATOM 14768 HB2 LYS B 321 16.118 142.568 64.942 1.00112.00 H ATOM 14769 HB3 LYS B 321 16.417 141.860 66.335 1.00112.00 H ATOM 14770 HG2 LYS B 321 14.661 143.066 67.307 1.00130.24 H ATOM 14771 HG3 LYS B 321 14.351 143.733 65.899 1.00130.24 H ATOM 14772 HD2 LYS B 321 13.384 141.913 65.114 1.00128.27 H ATOM 14773 HD3 LYS B 321 14.208 140.951 66.077 1.00128.27 H ATOM 14774 HE2 LYS B 321 12.683 142.385 67.691 1.00121.88 H ATOM 14775 HE3 LYS B 321 11.727 141.951 66.494 1.00121.88 H ATOM 14776 HZ1 LYS B 321 11.696 140.384 68.146 1.00119.71 H ATOM 14777 HZ2 LYS B 321 12.256 139.783 66.953 1.00119.71 H ATOM 14778 HZ3 LYS B 321 13.126 140.177 68.042 1.00119.71 H ATOM 14779 N ARG B 322 19.242 143.870 67.261 1.00 84.27 N ANISOU14779 N ARG B 322 9858 10256 11904 -338 -834 87 N ATOM 14780 CA ARG B 322 20.690 143.730 67.334 1.00 76.40 C ANISOU14780 CA ARG B 322 8929 9337 10762 -323 -835 34 C ATOM 14781 C ARG B 322 21.158 142.287 67.480 1.00 65.51 C ANISOU14781 C ARG B 322 7604 7989 9299 -311 -858 13 C ATOM 14782 O ARG B 322 20.621 141.525 68.293 1.00 55.31 O ANISOU14782 O ARG B 322 6309 6668 8039 -301 -815 18 O ATOM 14783 CB ARG B 322 21.214 144.541 68.526 1.00 79.61 C ANISOU14783 CB ARG B 322 9347 9764 11138 -307 -733 -2 C ATOM 14784 CG ARG B 322 20.913 146.035 68.451 1.00 72.72 C ANISOU14784 CG ARG B 322 8426 8867 10336 -317 -704 12 C ATOM 14785 CD ARG B 322 21.859 146.753 67.508 1.00 70.89 C ANISOU14785 CD ARG B 322 8217 8685 10033 -325 -757 -5 C ATOM 14786 NE ARG B 322 23.186 146.889 68.104 1.00 78.20 N ANISOU14786 NE ARG B 322 9201 9680 10833 -307 -714 -64 N ATOM 14787 CZ ARG B 322 23.605 147.934 68.814 1.00 70.21 C ANISOU14787 CZ ARG B 322 8185 8682 9809 -299 -640 -91 C ATOM 14788 NH1 ARG B 322 22.812 148.980 69.022 1.00 73.33 N ANISOU14788 NH1 ARG B 322 8523 9027 10313 -308 -599 -64 N ATOM 14789 NH2 ARG B 322 24.841 147.935 69.309 1.00 57.28 N ANISOU14789 NH2 ARG B 322 6603 7110 8050 -282 -607 -145 N ATOM 14790 H ARG B 322 18.909 144.286 67.936 1.00101.12 H ATOM 14791 HA ARG B 322 21.084 144.094 66.526 1.00 91.68 H ATOM 14792 HB2 ARG B 322 20.807 144.198 69.337 1.00 95.53 H ATOM 14793 HB3 ARG B 322 22.177 144.436 68.573 1.00 95.53 H ATOM 14794 HG2 ARG B 322 20.008 146.163 68.128 1.00 87.26 H ATOM 14795 HG3 ARG B 322 21.012 146.425 69.334 1.00 87.26 H ATOM 14796 HD2 ARG B 322 21.943 146.243 66.687 1.00 85.07 H ATOM 14797 HD3 ARG B 322 21.515 147.641 67.321 1.00 85.07 H ATOM 14798 HE ARG B 322 23.741 146.242 67.987 1.00 93.84 H ATOM 14799 HH11 ARG B 322 22.013 148.984 68.704 1.00 88.00 H ATOM 14800 HH12 ARG B 322 23.095 149.651 69.480 1.00 88.00 H ATOM 14801 HH21 ARG B 322 25.358 147.261 69.174 1.00 68.73 H ATOM 14802 HH22 ARG B 322 25.121 148.608 69.765 1.00 68.73 H ATOM 14803 N LYS B 323 22.181 141.939 66.698 1.00 61.67 N ANISOU14803 N LYS B 323 7166 7562 8703 -310 -924 -13 N ATOM 14804 CA LYS B 323 22.827 140.625 66.772 1.00 77.45 C ANISOU14804 CA LYS B 323 9223 9600 10605 -297 -950 -40 C ATOM 14805 C LYS B 323 23.779 140.525 67.992 1.00 62.62 C ANISOU14805 C LYS B 323 7395 7768 8629 -271 -868 -92 C ATOM 14806 O LYS B 323 24.329 139.458 68.288 1.00 57.50 O ANISOU14806 O LYS B 323 6796 7152 7900 -256 -873 -118 O ATOM 14807 CB LYS B 323 23.594 140.341 65.468 1.00 71.35 C ANISOU14807 CB LYS B 323 8483 8876 9750 -307 -1051 -50 C ATOM 14808 CG LYS B 323 22.786 140.586 64.177 1.00 73.95 C ANISOU14808 CG LYS B 323 8765 9169 10165 -333 -1135 -2 C ATOM 14809 CD LYS B 323 22.469 139.299 63.402 1.00 88.37 C ANISOU14809 CD LYS B 323 10599 10987 11990 -341 -1218 16 C ATOM 14810 CE LYS B 323 23.407 139.099 62.207 1.00 80.75 C ANISOU14810 CE LYS B 323 9673 10081 10927 -348 -1310 -2 C ATOM 14811 NZ LYS B 323 23.308 137.730 61.611 1.00 78.89 N ANISOU14811 NZ LYS B 323 9457 9849 10669 -351 -1382 4 N ATOM 14812 H LYS B 323 22.526 142.457 66.105 1.00 74.00 H ATOM 14813 HA LYS B 323 22.144 139.944 66.871 1.00 92.94 H ATOM 14814 HB2 LYS B 323 24.376 140.914 65.438 1.00 85.62 H ATOM 14815 HB3 LYS B 323 23.871 139.411 65.469 1.00 85.62 H ATOM 14816 HG2 LYS B 323 21.944 141.008 64.409 1.00 88.75 H ATOM 14817 HG3 LYS B 323 23.297 141.167 63.592 1.00 88.75 H ATOM 14818 HD2 LYS B 323 22.569 138.539 63.996 1.00106.04 H ATOM 14819 HD3 LYS B 323 21.560 139.345 63.068 1.00106.04 H ATOM 14820 HE2 LYS B 323 23.182 139.743 61.518 1.00 96.90 H ATOM 14821 HE3 LYS B 323 24.322 139.232 62.499 1.00 96.90 H ATOM 14822 HZ1 LYS B 323 23.867 137.657 60.922 1.00 94.67 H ATOM 14823 HZ2 LYS B 323 23.518 137.116 62.220 1.00 94.67 H ATOM 14824 HZ3 LYS B 323 22.477 137.582 61.326 1.00 94.67 H ATOM 14825 N LEU B 324 23.949 141.642 68.697 1.00 43.20 N ANISOU14825 N LEU B 324 4921 5312 6181 -265 -794 -107 N ATOM 14826 CA LEU B 324 24.824 141.727 69.862 1.00 38.69 C ANISOU14826 CA LEU B 324 4391 4784 5524 -241 -712 -157 C ATOM 14827 C LEU B 324 24.268 140.928 71.032 1.00 35.13 C ANISOU14827 C LEU B 324 3940 4304 5105 -225 -645 -153 C ATOM 14828 O LEU B 324 23.144 141.147 71.468 1.00 69.61 O ANISOU14828 O LEU B 324 8255 8607 9587 -231 -605 -119 O ATOM 14829 CB LEU B 324 24.989 143.203 70.269 1.00 32.41 C ANISOU14829 CB LEU B 324 3572 3991 4751 -242 -650 -169 C ATOM 14830 CG LEU B 324 25.948 143.562 71.412 1.00 39.13 C ANISOU14830 CG LEU B 324 4461 4891 5516 -218 -563 -222 C ATOM 14831 CD1 LEU B 324 27.395 143.433 70.974 1.00 21.64 C ANISOU14831 CD1 LEU B 324 2310 2757 3157 -210 -602 -270 C ATOM 14832 CD2 LEU B 324 25.680 144.972 71.945 1.00 35.87 C ANISOU14832 CD2 LEU B 324 4006 4457 5167 -221 -492 -222 C ATOM 14833 H LEU B 324 23.555 142.385 68.514 1.00 51.84 H ATOM 14834 HA LEU B 324 25.698 141.372 69.635 1.00 46.43 H ATOM 14835 HB2 LEU B 324 25.293 143.691 69.488 1.00 38.89 H ATOM 14836 HB3 LEU B 324 24.115 143.536 70.525 1.00 38.89 H ATOM 14837 HG LEU B 324 25.806 142.940 72.143 1.00 46.96 H ATOM 14838 HD11 LEU B 324 27.972 143.666 71.718 1.00 25.97 H ATOM 14839 HD12 LEU B 324 27.561 142.517 70.701 1.00 25.97 H ATOM 14840 HD13 LEU B 324 27.555 144.034 70.230 1.00 25.97 H ATOM 14841 HD21 LEU B 324 26.304 145.162 72.664 1.00 43.05 H ATOM 14842 HD22 LEU B 324 25.801 145.610 71.225 1.00 43.05 H ATOM 14843 HD23 LEU B 324 24.770 145.016 72.277 1.00 43.05 H ATOM 14844 N ILE B 325 25.059 140.011 71.559 1.00 35.88 N ANISOU14844 N ILE B 325 4093 4443 5097 -205 -631 -190 N ATOM 14845 CA ILE B 325 24.611 139.164 72.662 1.00 39.29 C ANISOU14845 CA ILE B 325 4530 4851 5548 -189 -570 -188 C ATOM 14846 C ILE B 325 24.488 139.950 73.979 1.00 22.62 C ANISOU14846 C ILE B 325 2400 2729 3464 -175 -459 -203 C ATOM 14847 O ILE B 325 25.458 140.486 74.489 1.00 43.50 O ANISOU14847 O ILE B 325 5076 5426 6025 -161 -414 -247 O ATOM 14848 CB ILE B 325 25.558 137.950 72.837 1.00 22.19 C ANISOU14848 CB ILE B 325 2433 2738 3258 -169 -589 -224 C ATOM 14849 CG1 ILE B 325 25.780 137.257 71.493 1.00 23.08 C ANISOU14849 CG1 ILE B 325 2565 2867 3337 -183 -700 -214 C ATOM 14850 CG2 ILE B 325 25.021 136.995 73.855 1.00 28.15 C ANISOU14850 CG2 ILE B 325 3192 3464 4039 -155 -535 -216 C ATOM 14851 CD1 ILE B 325 26.682 136.023 71.535 1.00 29.89 C ANISOU14851 CD1 ILE B 325 3495 3780 4082 -165 -728 -247 C ATOM 14852 H ILE B 325 25.864 139.854 71.299 1.00 43.06 H ATOM 14853 HA ILE B 325 23.731 138.819 72.446 1.00 47.15 H ATOM 14854 HB ILE B 325 26.415 138.278 73.152 1.00 26.62 H ATOM 14855 HG12 ILE B 325 24.918 136.976 71.146 1.00 27.70 H ATOM 14856 HG13 ILE B 325 26.184 137.892 70.881 1.00 27.70 H ATOM 14857 HG21 ILE B 325 25.634 136.249 73.942 1.00 33.78 H ATOM 14858 HG22 ILE B 325 24.937 137.455 74.705 1.00 33.78 H ATOM 14859 HG23 ILE B 325 24.152 136.678 73.563 1.00 33.78 H ATOM 14860 HD11 ILE B 325 26.759 135.658 70.639 1.00 35.87 H ATOM 14861 HD12 ILE B 325 27.557 136.283 71.863 1.00 35.87 H ATOM 14862 HD13 ILE B 325 26.289 135.364 72.128 1.00 35.87 H ATOM 14863 N VAL B 326 23.280 140.014 74.526 1.00 48.40 N ANISOU14863 N VAL B 326 5614 5929 6849 -181 -414 -166 N ATOM 14864 CA VAL B 326 23.036 140.624 75.836 1.00 38.77 C ANISOU14864 CA VAL B 326 4374 4694 5663 -168 -306 -177 C ATOM 14865 C VAL B 326 22.413 139.580 76.749 1.00 26.84 C ANISOU14865 C VAL B 326 2865 3152 4182 -156 -261 -165 C ATOM 14866 O VAL B 326 21.500 138.879 76.338 1.00 54.33 O ANISOU14866 O VAL B 326 6321 6583 7737 -168 -302 -125 O ATOM 14867 CB VAL B 326 22.078 141.837 75.727 1.00 27.67 C ANISOU14867 CB VAL B 326 2897 3232 4384 -186 -283 -144 C ATOM 14868 CG1 VAL B 326 21.875 142.495 77.081 1.00 41.26 C ANISOU14868 CG1 VAL B 326 4598 4941 6137 -173 -171 -158 C ATOM 14869 CG2 VAL B 326 22.615 142.855 74.757 1.00 30.18 C ANISOU14869 CG2 VAL B 326 3210 3576 4680 -200 -331 -151 C ATOM 14870 H VAL B 326 22.569 139.705 74.153 1.00 58.09 H ATOM 14871 HA VAL B 326 23.875 140.920 76.223 1.00 46.53 H ATOM 14872 HB VAL B 326 21.215 141.535 75.404 1.00 33.20 H ATOM 14873 HG11 VAL B 326 21.273 143.248 76.978 1.00 49.51 H ATOM 14874 HG12 VAL B 326 21.494 141.847 77.693 1.00 49.51 H ATOM 14875 HG13 VAL B 326 22.733 142.801 77.414 1.00 49.51 H ATOM 14876 HG21 VAL B 326 21.997 143.601 74.709 1.00 36.21 H ATOM 14877 HG22 VAL B 326 23.481 143.162 75.068 1.00 36.21 H ATOM 14878 HG23 VAL B 326 22.705 142.442 73.884 1.00 36.21 H ATOM 14879 N ASP B 327 22.906 139.487 77.979 1.00 28.30 N ANISOU14879 N ASP B 327 3078 3364 4309 -132 -178 -199 N ATOM 14880 CA ASP B 327 22.451 138.500 78.956 1.00 26.35 C ANISOU14880 CA ASP B 327 2839 3095 4076 -118 -128 -192 C ATOM 14881 C ASP B 327 21.553 139.159 80.007 1.00 30.25 C ANISOU14881 C ASP B 327 3282 3542 4670 -117 -34 -177 C ATOM 14882 O ASP B 327 21.907 140.181 80.577 1.00 38.97 O ANISOU14882 O ASP B 327 4379 4666 5763 -111 27 -202 O ATOM 14883 CB ASP B 327 23.650 137.862 79.674 1.00 33.67 C ANISOU14883 CB ASP B 327 3837 4091 4865 -90 -97 -243 C ATOM 14884 CG ASP B 327 24.528 136.985 78.759 1.00 28.04 C ANISOU14884 CG ASP B 327 3180 3425 4049 -88 -185 -259 C ATOM 14885 OD1 ASP B 327 24.007 136.216 77.932 1.00 37.21 O ANISOU14885 OD1 ASP B 327 4333 4557 5248 -101 -258 -227 O ATOM 14886 OD2 ASP B 327 25.763 137.058 78.889 1.00 31.12 O ANISOU14886 OD2 ASP B 327 3621 3884 4318 -71 -181 -307 O ATOM 14887 H ASP B 327 23.526 140.001 78.281 1.00 33.96 H ATOM 14888 HA ASP B 327 21.947 137.803 78.508 1.00 31.62 H ATOM 14889 HB2 ASP B 327 24.210 138.567 80.035 1.00 40.40 H ATOM 14890 HB3 ASP B 327 23.321 137.302 80.394 1.00 40.40 H ATOM 14891 N SER B 328 20.389 138.580 80.272 1.00 42.45 N ANISOU14891 N SER B 328 4791 5025 6314 -124 -22 -137 N ATOM 14892 CA SER B 328 19.483 139.157 81.263 1.00 41.62 C ANISOU14892 CA SER B 328 4636 4872 6307 -124 66 -121 C ATOM 14893 C SER B 328 19.901 138.730 82.660 1.00 44.39 C ANISOU14893 C SER B 328 5020 5250 6596 -97 155 -152 C ATOM 14894 O SER B 328 19.725 139.467 83.631 1.00 38.87 O ANISOU14894 O SER B 328 4298 4545 5926 -90 241 -163 O ATOM 14895 CB SER B 328 18.048 138.713 81.003 1.00 40.96 C ANISOU14895 CB SER B 328 4498 4709 6356 -143 45 -65 C ATOM 14896 OG SER B 328 17.738 138.784 79.628 1.00 52.66 O ANISOU14896 OG SER B 328 5959 6171 7879 -165 -51 -36 O ATOM 14897 H SER B 328 20.100 137.861 79.898 1.00 50.94 H ATOM 14898 HA SER B 328 19.520 140.125 81.211 1.00 49.95 H ATOM 14899 HB2 SER B 328 17.943 137.797 81.303 1.00 49.15 H ATOM 14900 HB3 SER B 328 17.445 139.293 81.492 1.00 49.15 H ATOM 14901 HG SER B 328 16.946 138.537 79.499 1.00 63.19 H ATOM 14902 N VAL B 329 20.446 137.522 82.740 1.00 39.97 N ANISOU14902 N VAL B 329 4515 4721 5950 -83 132 -166 N ATOM 14903 CA VAL B 329 20.916 136.939 83.986 1.00 26.20 C ANISOU14903 CA VAL B 329 2812 3008 4136 -56 206 -195 C ATOM 14904 C VAL B 329 22.399 136.670 83.842 1.00 36.39 C ANISOU14904 C VAL B 329 4173 4380 5273 -37 181 -244 C ATOM 14905 O VAL B 329 22.821 135.858 83.018 1.00 41.02 O ANISOU14905 O VAL B 329 4795 4987 5805 -39 103 -244 O ATOM 14906 CB VAL B 329 20.194 135.618 84.268 1.00 38.12 C ANISOU14906 CB VAL B 329 4324 4479 5682 -53 203 -164 C ATOM 14907 CG1 VAL B 329 20.847 134.854 85.430 1.00 24.42 C ANISOU14907 CG1 VAL B 329 2641 2784 3853 -24 266 -196 C ATOM 14908 CG2 VAL B 329 18.733 135.879 84.526 1.00 25.08 C ANISOU14908 CG2 VAL B 329 2603 2748 4180 -70 235 -118 C ATOM 14909 H VAL B 329 20.557 137.006 82.061 1.00 47.96 H ATOM 14910 HA VAL B 329 20.769 137.551 84.724 1.00 31.44 H ATOM 14911 HB VAL B 329 20.256 135.058 83.478 1.00 45.75 H ATOM 14912 HG11 VAL B 329 20.362 134.027 85.575 1.00 29.30 H ATOM 14913 HG12 VAL B 329 21.770 134.661 85.201 1.00 29.30 H ATOM 14914 HG13 VAL B 329 20.812 135.403 86.228 1.00 29.30 H ATOM 14915 HG21 VAL B 329 18.288 135.036 84.703 1.00 30.10 H ATOM 14916 HG22 VAL B 329 18.649 136.465 85.295 1.00 30.10 H ATOM 14917 HG23 VAL B 329 18.345 136.301 83.744 1.00 30.10 H ATOM 14918 N LYS B 330 23.194 137.356 84.649 1.00 38.06 N ANISOU14918 N LYS B 330 4404 4639 5417 -19 249 -287 N ATOM 14919 CA LYS B 330 24.639 137.291 84.514 1.00 35.84 C ANISOU14919 CA LYS B 330 4187 4439 4993 -2 229 -338 C ATOM 14920 C LYS B 330 25.286 136.298 85.492 1.00 48.96 C ANISOU14920 C LYS B 330 5905 6141 6556 27 273 -367 C ATOM 14921 O LYS B 330 26.344 135.735 85.196 1.00 45.85 O ANISOU14921 O LYS B 330 5570 5805 6046 41 233 -399 O ATOM 14922 CB LYS B 330 25.220 138.684 84.730 1.00 25.25 C ANISOU14922 CB LYS B 330 2835 3130 3627 -1 272 -372 C ATOM 14923 CG LYS B 330 24.699 139.729 83.754 1.00 37.22 C ANISOU14923 CG LYS B 330 4299 4612 5231 -29 228 -346 C ATOM 14924 CD LYS B 330 25.151 141.139 84.113 1.00 25.54 C ANISOU14924 CD LYS B 330 2804 3157 3742 -27 283 -377 C ATOM 14925 CE LYS B 330 24.619 141.603 85.466 1.00 34.11 C ANISOU14925 CE LYS B 330 3857 4220 4882 -16 392 -380 C ATOM 14926 NZ LYS B 330 25.264 142.859 85.938 1.00 44.06 N ANISOU14926 NZ LYS B 330 5114 5517 6111 -10 450 -420 N ATOM 14927 H LYS B 330 22.921 137.867 85.284 1.00 45.67 H ATOM 14928 HA LYS B 330 24.860 137.010 83.612 1.00 43.01 H ATOM 14929 HB2 LYS B 330 24.997 138.979 85.627 1.00 30.29 H ATOM 14930 HB3 LYS B 330 26.183 138.639 84.630 1.00 30.29 H ATOM 14931 HG2 LYS B 330 25.028 139.524 82.865 1.00 44.66 H ATOM 14932 HG3 LYS B 330 23.729 139.713 83.761 1.00 44.66 H ATOM 14933 HD2 LYS B 330 26.120 141.161 84.148 1.00 30.65 H ATOM 14934 HD3 LYS B 330 24.829 141.755 83.437 1.00 30.65 H ATOM 14935 HE2 LYS B 330 23.665 141.765 85.392 1.00 40.93 H ATOM 14936 HE3 LYS B 330 24.788 140.912 86.126 1.00 40.93 H ATOM 14937 HZ1 LYS B 330 24.928 143.096 86.728 1.00 52.87 H ATOM 14938 HZ2 LYS B 330 26.142 142.737 86.023 1.00 52.87 H ATOM 14939 HZ3 LYS B 330 25.118 143.515 85.354 1.00 52.87 H ATOM 14940 N GLU B 331 24.643 136.079 86.640 1.00 35.52 N ANISOU14940 N GLU B 331 4185 4410 4902 38 354 -356 N ATOM 14941 CA GLU B 331 25.227 135.282 87.714 1.00 45.71 C ANISOU14941 CA GLU B 331 5524 5738 6104 67 409 -384 C ATOM 14942 C GLU B 331 24.348 134.132 88.113 1.00 35.19 C ANISOU14942 C GLU B 331 4186 4357 4826 69 418 -347 C ATOM 14943 O GLU B 331 23.130 134.238 88.077 1.00 28.23 O ANISOU14943 O GLU B 331 3249 3407 4069 51 427 -303 O ATOM 14944 CB GLU B 331 25.439 136.123 88.973 1.00 36.74 C ANISOU14944 CB GLU B 331 4380 4625 4956 84 515 -414 C ATOM 14945 CG GLU B 331 26.386 137.280 88.809 1.00 52.10 C ANISOU14945 CG GLU B 331 6335 6623 6839 86 522 -458 C ATOM 14946 CD GLU B 331 26.529 138.097 90.084 1.00 67.52 C ANISOU14946 CD GLU B 331 8274 8594 8786 102 629 -487 C ATOM 14947 OE1 GLU B 331 26.822 137.491 91.149 1.00 58.89 O ANISOU14947 OE1 GLU B 331 7213 7527 7636 127 689 -506 O ATOM 14948 OE2 GLU B 331 26.342 139.340 90.005 1.00 62.28 O ANISOU14948 OE2 GLU B 331 7569 7919 8175 89 653 -491 O ATOM 14949 H GLU B 331 23.860 136.385 86.821 1.00 42.63 H ATOM 14950 HA GLU B 331 26.085 134.931 87.428 1.00 54.85 H ATOM 14951 HB2 GLU B 331 24.583 136.483 89.252 1.00 44.09 H ATOM 14952 HB3 GLU B 331 25.794 135.551 89.671 1.00 44.09 H ATOM 14953 HG2 GLU B 331 27.262 136.941 88.569 1.00 62.53 H ATOM 14954 HG3 GLU B 331 26.052 137.866 88.112 1.00 62.53 H ATOM 14955 N LEU B 332 24.984 133.041 88.528 1.00 42.04 N ANISOU14955 N LEU B 332 5111 5261 5601 92 420 -365 N ATOM 14956 CA LEU B 332 24.266 131.934 89.115 1.00 38.32 C ANISOU14956 CA LEU B 332 4640 4750 5168 98 444 -336 C ATOM 14957 C LEU B 332 23.915 132.296 90.540 1.00 23.82 C ANISOU14957 C LEU B 332 2785 2906 3359 112 556 -341 C ATOM 14958 O LEU B 332 24.730 132.776 91.293 1.00 55.45 O ANISOU14958 O LEU B 332 6815 6965 7287 133 613 -383 O ATOM 14959 CB LEU B 332 25.089 130.652 89.070 1.00 23.33 C ANISOU14959 CB LEU B 332 2811 2895 3160 118 408 -354 C ATOM 14960 CG LEU B 332 25.345 130.071 87.683 1.00 23.14 C ANISOU14960 CG LEU B 332 2807 2874 3113 104 295 -345 C ATOM 14961 CD1 LEU B 332 26.393 128.988 87.736 1.00 36.75 C ANISOU14961 CD1 LEU B 332 4603 4653 4708 128 269 -375 C ATOM 14962 CD2 LEU B 332 24.109 129.510 87.106 1.00 23.53 C ANISOU14962 CD2 LEU B 332 2815 2849 3278 81 252 -290 C ATOM 14963 H LEU B 332 25.835 132.923 88.478 1.00 50.45 H ATOM 14964 HA LEU B 332 23.442 131.787 88.624 1.00 45.98 H ATOM 14965 HB2 LEU B 332 25.953 130.830 89.473 1.00 28.00 H ATOM 14966 HB3 LEU B 332 24.625 129.974 89.586 1.00 28.00 H ATOM 14967 HG LEU B 332 25.663 130.774 87.095 1.00 27.77 H ATOM 14968 HD11 LEU B 332 26.532 128.641 86.841 1.00 44.10 H ATOM 14969 HD12 LEU B 332 27.219 129.365 88.077 1.00 44.10 H ATOM 14970 HD13 LEU B 332 26.085 128.280 88.322 1.00 44.10 H ATOM 14971 HD21 LEU B 332 24.306 129.151 86.227 1.00 28.24 H ATOM 14972 HD22 LEU B 332 23.781 128.805 87.686 1.00 28.24 H ATOM 14973 HD23 LEU B 332 23.446 130.215 87.034 1.00 28.24 H ATOM 14974 N ASP B 333 22.661 132.078 90.874 1.00 52.12 N ANISOU14974 N ASP B 333 6323 6422 7060 100 584 -297 N ATOM 14975 CA ASP B 333 22.107 132.283 92.196 1.00 36.18 C ANISOU14975 CA ASP B 333 4279 4382 5085 111 687 -293 C ATOM 14976 C ASP B 333 23.013 131.616 93.217 1.00 46.98 C ANISOU14976 C ASP B 333 5707 5808 6334 145 739 -329 C ATOM 14977 O ASP B 333 23.660 130.621 92.907 1.00 53.47 O ANISOU14977 O ASP B 333 6582 6660 7072 157 691 -338 O ATOM 14978 CB ASP B 333 20.745 131.599 92.156 1.00 39.94 C ANISOU14978 CB ASP B 333 4714 4779 5681 94 681 -237 C ATOM 14979 CG ASP B 333 19.907 131.866 93.348 1.00 80.17 C ANISOU14979 CG ASP B 333 9770 9839 10852 98 778 -222 C ATOM 14980 OD1 ASP B 333 20.449 132.357 94.365 1.00110.37 O ANISOU14980 OD1 ASP B 333 13609 13705 14622 118 857 -257 O ATOM 14981 OD2 ASP B 333 18.687 131.580 93.253 1.00 91.03 O ANISOU14981 OD2 ASP B 333 11100 11144 12343 79 776 -176 O ATOM 14982 H ASP B 333 22.074 131.793 90.314 1.00 62.55 H ATOM 14983 HA ASP B 333 22.006 133.227 92.395 1.00 43.41 H ATOM 14984 HB2 ASP B 333 20.260 131.912 91.376 1.00 47.92 H ATOM 14985 HB3 ASP B 333 20.879 130.640 92.096 1.00 47.92 H ATOM 14986 N SER B 334 23.073 132.149 94.432 1.00 66.97 N ANISOU14986 N SER B 334 8231 8356 8857 161 836 -349 N ATOM 14987 CA SER B 334 23.818 131.483 95.500 1.00 55.73 C ANISOU14987 CA SER B 334 6861 6983 7329 194 892 -379 C ATOM 14988 C SER B 334 23.109 130.210 95.955 1.00 49.84 C ANISOU14988 C SER B 334 6123 6197 6619 199 905 -342 C ATOM 14989 O SER B 334 23.750 129.210 96.249 1.00 55.18 O ANISOU14989 O SER B 334 6855 6908 7204 221 900 -356 O ATOM 14990 CB SER B 334 24.011 132.412 96.693 1.00 45.51 C ANISOU14990 CB SER B 334 5554 5716 6023 209 995 -409 C ATOM 14991 OG SER B 334 24.883 133.472 96.364 1.00 70.11 O ANISOU14991 OG SER B 334 8676 8882 9082 210 986 -451 O ATOM 14992 H SER B 334 22.696 132.886 94.665 1.00 80.36 H ATOM 14993 HA SER B 334 24.695 131.236 95.167 1.00 66.87 H ATOM 14994 HB2 SER B 334 23.150 132.778 96.950 1.00 54.62 H ATOM 14995 HB3 SER B 334 24.391 131.907 97.429 1.00 54.62 H ATOM 14996 HG SER B 334 24.982 133.978 97.027 1.00 84.14 H ATOM 14997 N LYS B 335 21.786 130.246 96.020 1.00 41.68 N ANISOU14997 N LYS B 335 5030 5088 5716 178 921 -296 N ATOM 14998 CA LYS B 335 21.041 129.067 96.407 1.00 36.41 C ANISOU14998 CA LYS B 335 4366 4378 5092 180 932 -259 C ATOM 14999 C LYS B 335 21.368 127.907 95.456 1.00 44.92 C ANISOU14999 C LYS B 335 5486 5459 6125 178 838 -249 C ATOM 15000 O LYS B 335 21.400 126.752 95.878 1.00 66.67 O ANISOU15000 O LYS B 335 8275 8212 8845 193 846 -240 O ATOM 15001 CB LYS B 335 19.532 129.348 96.430 1.00 57.31 C ANISOU15001 CB LYS B 335 6940 6941 7896 154 953 -210 C ATOM 15002 CG LYS B 335 18.947 129.707 97.808 1.00 56.36 C ANISOU15002 CG LYS B 335 6789 6804 7823 163 1064 -207 C ATOM 15003 CD LYS B 335 17.669 130.522 97.635 1.00 75.98 C ANISOU15003 CD LYS B 335 9194 9218 10456 134 1079 -171 C ATOM 15004 CE LYS B 335 16.697 130.420 98.801 1.00 79.07 C ANISOU15004 CE LYS B 335 9550 9567 10926 136 1169 -148 C ATOM 15005 NZ LYS B 335 15.364 131.010 98.412 1.00 84.43 N ANISOU15005 NZ LYS B 335 10151 10169 11757 105 1165 -107 N ATOM 15006 H LYS B 335 21.302 130.936 95.847 1.00 50.01 H ATOM 15007 HA LYS B 335 21.310 128.804 97.301 1.00 43.70 H ATOM 15008 HB2 LYS B 335 19.349 130.091 95.834 1.00 68.78 H ATOM 15009 HB3 LYS B 335 19.067 128.558 96.113 1.00 68.78 H ATOM 15010 HG2 LYS B 335 18.731 128.894 98.292 1.00 67.64 H ATOM 15011 HG3 LYS B 335 19.588 130.239 98.305 1.00 67.64 H ATOM 15012 HD2 LYS B 335 17.908 131.456 97.532 1.00 91.17 H ATOM 15013 HD3 LYS B 335 17.209 130.212 96.840 1.00 91.17 H ATOM 15014 HE2 LYS B 335 16.565 129.488 99.034 1.00 94.88 H ATOM 15015 HE3 LYS B 335 17.045 130.915 99.559 1.00 94.88 H ATOM 15016 HZ1 LYS B 335 14.795 130.951 99.093 1.00101.31 H ATOM 15017 HZ2 LYS B 335 15.464 131.867 98.192 1.00101.31 H ATOM 15018 HZ3 LYS B 335 15.029 130.570 97.715 1.00101.31 H ATOM 15019 N THR B 336 21.636 128.201 94.184 1.00 41.80 N ANISOU15019 N THR B 336 5089 5068 5726 161 751 -251 N ATOM 15020 CA THR B 336 21.829 127.123 93.212 1.00 47.30 C ANISOU15020 CA THR B 336 5818 5761 6393 156 658 -238 C ATOM 15021 C THR B 336 23.247 126.562 93.224 1.00 45.18 C ANISOU15021 C THR B 336 5625 5570 5971 183 636 -283 C ATOM 15022 O THR B 336 23.476 125.436 92.779 1.00 53.14 O ANISOU15022 O THR B 336 6671 6580 6939 187 579 -276 O ATOM 15023 CB THR B 336 21.407 127.508 91.772 1.00 31.46 C ANISOU15023 CB THR B 336 3777 3723 4455 125 567 -216 C ATOM 15024 OG1 THR B 336 22.320 128.448 91.228 1.00 43.45 O ANISOU15024 OG1 THR B 336 5308 5293 5910 124 539 -253 O ATOM 15025 CG2 THR B 336 20.003 128.072 91.763 1.00 50.06 C ANISOU15025 CG2 THR B 336 6056 6001 6962 99 589 -173 C ATOM 15026 H THR B 336 21.711 128.995 93.864 1.00 50.16 H ATOM 15027 HA THR B 336 21.248 126.393 93.477 1.00 56.76 H ATOM 15028 HB THR B 336 21.412 126.710 91.220 1.00 37.76 H ATOM 15029 HG1 THR B 336 22.334 129.142 91.701 1.00 52.15 H ATOM 15030 HG21 THR B 336 19.747 128.310 90.858 1.00 60.07 H ATOM 15031 HG22 THR B 336 19.378 127.412 92.104 1.00 60.07 H ATOM 15032 HG23 THR B 336 19.960 128.864 92.321 1.00 60.07 H ATOM 15033 N ILE B 337 24.198 127.319 93.754 1.00 46.24 N ANISOU15033 N ILE B 337 5783 5767 6019 202 680 -329 N ATOM 15034 CA ILE B 337 25.497 126.727 94.028 1.00 40.96 C ANISOU15034 CA ILE B 337 5186 5171 5205 231 676 -372 C ATOM 15035 C ILE B 337 25.333 125.707 95.155 1.00 40.18 C ANISOU15035 C ILE B 337 5114 5068 5086 255 737 -363 C ATOM 15036 O ILE B 337 25.860 124.610 95.062 1.00 41.18 O ANISOU15036 O ILE B 337 5292 5216 5139 270 703 -368 O ATOM 15037 CB ILE B 337 26.571 127.759 94.402 1.00 28.88 C ANISOU15037 CB ILE B 337 3676 3712 3586 247 714 -426 C ATOM 15038 CG1 ILE B 337 26.780 128.744 93.248 1.00 28.54 C ANISOU15038 CG1 ILE B 337 3610 3675 3559 225 651 -435 C ATOM 15039 CG2 ILE B 337 27.877 127.026 94.818 1.00 42.01 C ANISOU15039 CG2 ILE B 337 5415 5449 5097 281 716 -469 C ATOM 15040 CD1 ILE B 337 28.202 128.890 92.778 1.00 44.64 C ANISOU15040 CD1 ILE B 337 5703 5791 5465 238 608 -486 C ATOM 15041 H ILE B 337 24.122 128.151 93.958 1.00 55.49 H ATOM 15042 HA ILE B 337 25.800 126.254 93.238 1.00 49.15 H ATOM 15043 HB ILE B 337 26.252 128.260 95.168 1.00 34.66 H ATOM 15044 HG12 ILE B 337 26.251 128.447 92.491 1.00 34.25 H ATOM 15045 HG13 ILE B 337 26.476 129.620 93.532 1.00 34.25 H ATOM 15046 HG21 ILE B 337 28.548 127.687 95.051 1.00 50.41 H ATOM 15047 HG22 ILE B 337 27.691 126.459 95.582 1.00 50.41 H ATOM 15048 HG23 ILE B 337 28.187 126.488 94.073 1.00 50.41 H ATOM 15049 HD11 ILE B 337 28.229 129.531 92.050 1.00 53.56 H ATOM 15050 HD12 ILE B 337 28.747 129.203 93.516 1.00 53.56 H ATOM 15051 HD13 ILE B 337 28.523 128.027 92.472 1.00 53.56 H ATOM 15052 N ARG B 338 24.614 126.053 96.218 1.00 30.17 N ANISOU15052 N ARG B 338 3811 3771 3882 257 826 -348 N ATOM 15053 CA ARG B 338 24.394 125.087 97.293 1.00 42.43 C ANISOU15053 CA ARG B 338 5385 5315 5420 278 886 -336 C ATOM 15054 C ARG B 338 23.798 123.776 96.756 1.00 41.46 C ANISOU15054 C ARG B 338 5271 5145 5339 268 827 -295 C ATOM 15055 O ARG B 338 24.091 122.690 97.259 1.00 46.49 O ANISOU15055 O ARG B 338 5952 5795 5917 290 839 -294 O ATOM 15056 CB ARG B 338 23.497 125.663 98.395 1.00 50.34 C ANISOU15056 CB ARG B 338 6337 6282 6507 276 984 -319 C ATOM 15057 CG ARG B 338 24.271 126.303 99.549 1.00 66.90 C ANISOU15057 CG ARG B 338 8455 8442 8523 304 1071 -364 C ATOM 15058 CD ARG B 338 23.372 127.137 100.488 1.00 78.61 C ANISOU15058 CD ARG B 338 9879 9890 10099 297 1164 -350 C ATOM 15059 NE ARG B 338 23.337 128.555 100.113 1.00 82.79 N ANISOU15059 NE ARG B 338 10365 10421 10669 280 1165 -366 N ATOM 15060 CZ ARG B 338 22.978 129.549 100.925 1.00 97.04 C ANISOU15060 CZ ARG B 338 12129 12221 12521 279 1247 -375 C ATOM 15061 NH1 ARG B 338 22.626 129.295 102.184 1.00109.92 N ANISOU15061 NH1 ARG B 338 13757 13848 14161 295 1335 -369 N ATOM 15062 NH2 ARG B 338 22.987 130.809 100.485 1.00 90.32 N ANISOU15062 NH2 ARG B 338 11241 11371 11705 263 1241 -389 N ATOM 15063 H ARG B 338 24.248 126.822 96.341 1.00 36.21 H ATOM 15064 HA ARG B 338 25.251 124.874 97.696 1.00 50.91 H ATOM 15065 HB2 ARG B 338 22.925 126.344 98.008 1.00 60.40 H ATOM 15066 HB3 ARG B 338 22.955 124.948 98.763 1.00 60.40 H ATOM 15067 HG2 ARG B 338 24.686 125.603 100.077 1.00 80.28 H ATOM 15068 HG3 ARG B 338 24.951 126.891 99.185 1.00 80.28 H ATOM 15069 HD2 ARG B 338 22.466 126.793 100.448 1.00 94.33 H ATOM 15070 HD3 ARG B 338 23.713 127.073 101.393 1.00 94.33 H ATOM 15071 HE ARG B 338 23.566 128.760 99.309 1.00 99.34 H ATOM 15072 HH11 ARG B 338 22.621 128.485 102.474 1.00131.91 H ATOM 15073 HH12 ARG B 338 22.397 129.940 102.705 1.00131.91 H ATOM 15074 HH21 ARG B 338 23.215 130.979 99.674 1.00108.38 H ATOM 15075 HH22 ARG B 338 22.757 131.449 101.011 1.00108.38 H ATOM 15076 N ALA B 339 22.973 123.878 95.721 1.00 29.70 N ANISOU15076 N ALA B 339 3737 3598 3948 237 764 -260 N ATOM 15077 CA ALA B 339 22.312 122.705 95.168 1.00 26.86 C ANISOU15077 CA ALA B 339 3378 3188 3640 225 708 -220 C ATOM 15078 C ALA B 339 23.281 121.834 94.354 1.00 36.44 C ANISOU15078 C ALA B 339 4651 4441 4751 234 624 -239 C ATOM 15079 O ALA B 339 23.235 120.609 94.419 1.00 26.83 O ANISOU15079 O ALA B 339 3466 3213 3516 243 605 -224 O ATOM 15080 CB ALA B 339 21.128 123.137 94.324 1.00 28.39 C ANISOU15080 CB ALA B 339 3504 3310 3972 188 667 -178 C ATOM 15081 H ALA B 339 22.780 124.614 95.321 1.00 35.64 H ATOM 15082 HA ALA B 339 21.973 122.165 95.899 1.00 32.24 H ATOM 15083 HB1 ALA B 339 20.695 122.349 93.961 1.00 34.07 H ATOM 15084 HB2 ALA B 339 20.506 123.629 94.883 1.00 34.07 H ATOM 15085 HB3 ALA B 339 21.445 123.704 93.603 1.00 34.07 H ATOM 15086 N GLN B 340 24.153 122.480 93.585 1.00 40.06 N ANISOU15086 N GLN B 340 5126 4948 5146 232 573 -273 N ATOM 15087 CA GLN B 340 25.215 121.788 92.869 1.00 28.80 C ANISOU15087 CA GLN B 340 3759 3571 3611 243 498 -300 C ATOM 15088 C GLN B 340 26.091 120.969 93.816 1.00 31.29 C ANISOU15088 C GLN B 340 4140 3939 3812 280 541 -328 C ATOM 15089 O GLN B 340 26.388 119.821 93.508 1.00 50.12 O ANISOU15089 O GLN B 340 6565 6328 6151 289 494 -324 O ATOM 15090 CB GLN B 340 26.082 122.779 92.087 1.00 28.37 C ANISOU15090 CB GLN B 340 3712 3568 3500 238 454 -337 C ATOM 15091 CG GLN B 340 25.410 123.399 90.879 1.00 26.62 C ANISOU15091 CG GLN B 340 3439 3304 3372 203 386 -312 C ATOM 15092 CD GLN B 340 26.322 124.368 90.162 1.00 49.56 C ANISOU15092 CD GLN B 340 6353 6262 6214 199 347 -350 C ATOM 15093 OE1 GLN B 340 27.408 124.682 90.666 1.00 71.77 O ANISOU15093 OE1 GLN B 340 9207 9142 8919 222 379 -396 O ATOM 15094 NE2 GLN B 340 25.903 124.847 88.977 1.00 38.15 N ANISOU15094 NE2 GLN B 340 4872 4789 4834 169 276 -331 N ATOM 15095 H GLN B 340 24.149 123.331 93.462 1.00 48.07 H ATOM 15096 HA GLN B 340 24.814 121.177 92.231 1.00 34.56 H ATOM 15097 HB2 GLN B 340 26.340 123.501 92.681 1.00 34.05 H ATOM 15098 HB3 GLN B 340 26.876 122.316 91.775 1.00 34.05 H ATOM 15099 HG2 GLN B 340 25.164 122.698 90.256 1.00 31.95 H ATOM 15100 HG3 GLN B 340 24.620 123.883 91.167 1.00 31.95 H ATOM 15101 HE21 GLN B 340 25.144 124.599 88.657 1.00 45.78 H ATOM 15102 HE22 GLN B 340 26.395 125.400 88.539 1.00 45.78 H ATOM 15103 N LEU B 341 26.504 121.548 94.948 1.00 30.65 N ANISOU15103 N LEU B 341 4066 3895 3683 302 628 -355 N ATOM 15104 CA LEU B 341 27.323 120.842 95.936 1.00 37.18 C ANISOU15104 CA LEU B 341 4953 4773 4402 338 676 -381 C ATOM 15105 C LEU B 341 26.661 119.568 96.443 1.00 39.69 C ANISOU15105 C LEU B 341 5280 5046 4754 345 694 -344 C ATOM 15106 O LEU B 341 27.329 118.578 96.705 1.00 45.59 O ANISOU15106 O LEU B 341 6084 5826 5414 369 686 -357 O ATOM 15107 CB LEU B 341 27.580 121.706 97.167 1.00 39.81 C ANISOU15107 CB LEU B 341 5280 5140 4706 357 778 -408 C ATOM 15108 CG LEU B 341 28.239 123.075 97.036 1.00 51.17 C ANISOU15108 CG LEU B 341 6708 6626 6107 356 789 -449 C ATOM 15109 CD1 LEU B 341 28.597 123.577 98.420 1.00 45.25 C ANISOU15109 CD1 LEU B 341 5966 5916 5311 382 893 -478 C ATOM 15110 CD2 LEU B 341 29.476 123.039 96.144 1.00 57.51 C ANISOU15110 CD2 LEU B 341 7559 7491 6800 362 713 -490 C ATOM 15111 H LEU B 341 26.320 122.359 95.168 1.00 36.77 H ATOM 15112 HA LEU B 341 28.177 120.608 95.540 1.00 44.62 H ATOM 15113 HB2 LEU B 341 26.724 121.856 97.597 1.00 47.77 H ATOM 15114 HB3 LEU B 341 28.142 121.191 97.768 1.00 47.77 H ATOM 15115 HG LEU B 341 27.604 123.696 96.645 1.00 61.40 H ATOM 15116 HD11 LEU B 341 29.016 124.448 98.341 1.00 54.30 H ATOM 15117 HD12 LEU B 341 27.787 123.646 98.950 1.00 54.30 H ATOM 15118 HD13 LEU B 341 29.211 122.950 98.834 1.00 54.30 H ATOM 15119 HD21 LEU B 341 29.855 123.931 96.094 1.00 69.01 H ATOM 15120 HD22 LEU B 341 30.123 122.426 96.527 1.00 69.01 H ATOM 15121 HD23 LEU B 341 29.218 122.739 95.258 1.00 69.01 H ATOM 15122 N SER B 342 25.342 119.602 96.597 1.00 46.32 N ANISOU15122 N SER B 342 6064 5812 5724 324 720 -297 N ATOM 15123 CA SER B 342 24.621 118.504 97.248 1.00 50.14 C ANISOU15123 CA SER B 342 6550 6250 6250 330 753 -260 C ATOM 15124 C SER B 342 24.187 117.373 96.327 1.00 39.43 C ANISOU15124 C SER B 342 5200 4849 4932 314 671 -227 C ATOM 15125 O SER B 342 23.884 116.295 96.816 1.00 40.48 O ANISOU15125 O SER B 342 5352 4958 5071 325 689 -205 O ATOM 15126 CB SER B 342 23.398 119.035 98.000 1.00 48.22 C ANISOU15126 CB SER B 342 6245 5950 6127 316 830 -226 C ATOM 15127 OG SER B 342 22.684 119.955 97.201 1.00 57.94 O ANISOU15127 OG SER B 342 7416 7141 7459 283 798 -210 O ATOM 15128 H SER B 342 24.837 120.247 96.334 1.00 55.59 H ATOM 15129 HA SER B 342 25.213 118.114 97.911 1.00 60.16 H ATOM 15130 HB2 SER B 342 22.817 118.291 98.223 1.00 57.87 H ATOM 15131 HB3 SER B 342 23.693 119.481 98.809 1.00 57.87 H ATOM 15132 HG SER B 342 23.177 120.604 96.999 1.00 69.53 H ATOM 15133 N ASP B 343 24.172 117.604 95.013 1.00 32.03 N ANISOU15133 N ASP B 343 4247 3901 4020 291 582 -225 N ATOM 15134 CA ASP B 343 23.728 116.587 94.059 1.00 33.03 C ANISOU15134 CA ASP B 343 4375 3985 4189 274 499 -195 C ATOM 15135 C ASP B 343 24.455 116.711 92.705 1.00 41.31 C ANISOU15135 C ASP B 343 5442 5066 5187 263 397 -218 C ATOM 15136 O ASP B 343 24.138 117.594 91.899 1.00 48.27 O ANISOU15136 O ASP B 343 6282 5933 6125 238 360 -214 O ATOM 15137 CB ASP B 343 22.204 116.698 93.895 1.00 39.31 C ANISOU15137 CB ASP B 343 5100 4694 5141 243 506 -143 C ATOM 15138 CG ASP B 343 21.614 115.723 92.858 1.00 36.11 C ANISOU15138 CG ASP B 343 4687 4237 4794 222 420 -109 C ATOM 15139 OD1 ASP B 343 22.245 114.689 92.522 1.00 28.21 O ANISOU15139 OD1 ASP B 343 3739 3260 3720 234 371 -120 O ATOM 15140 OD2 ASP B 343 20.473 116.012 92.403 1.00 34.35 O ANISOU15140 OD2 ASP B 343 4404 3950 4696 192 405 -72 O ATOM 15141 H ASP B 343 24.414 118.345 94.649 1.00 38.43 H ATOM 15142 HA ASP B 343 23.925 115.709 94.422 1.00 39.64 H ATOM 15143 HB2 ASP B 343 21.784 116.513 94.749 1.00 47.17 H ATOM 15144 HB3 ASP B 343 21.986 117.600 93.611 1.00 47.17 H ATOM 15145 N TYR B 344 25.413 115.818 92.450 1.00 33.17 N ANISOU15145 N TYR B 344 4474 4080 4051 283 352 -242 N ATOM 15146 CA TYR B 344 26.164 115.846 91.185 1.00 39.96 C ANISOU15146 CA TYR B 344 5355 4974 4853 274 255 -266 C ATOM 15147 C TYR B 344 25.946 114.600 90.328 1.00 25.80 C ANISOU15147 C TYR B 344 3578 3150 3075 265 173 -244 C ATOM 15148 O TYR B 344 26.707 114.352 89.405 1.00 33.13 O ANISOU15148 O TYR B 344 4538 4114 3936 264 94 -268 O ATOM 15149 CB TYR B 344 27.673 116.076 91.430 1.00 25.00 C ANISOU15149 CB TYR B 344 3520 3169 2808 304 261 -324 C ATOM 15150 CG TYR B 344 28.279 115.150 92.466 1.00 43.36 C ANISOU15150 CG TYR B 344 5903 5527 5045 339 310 -339 C ATOM 15151 CD1 TYR B 344 28.649 113.862 92.132 1.00 43.71 C ANISOU15151 CD1 TYR B 344 5993 5576 5038 350 258 -338 C ATOM 15152 CD2 TYR B 344 28.479 115.566 93.776 1.00 42.53 C ANISOU15152 CD2 TYR B 344 5804 5447 4907 363 408 -354 C ATOM 15153 CE1 TYR B 344 29.185 113.021 93.058 1.00 40.70 C ANISOU15153 CE1 TYR B 344 5663 5223 4579 383 301 -350 C ATOM 15154 CE2 TYR B 344 29.021 114.721 94.711 1.00 30.95 C ANISOU15154 CE2 TYR B 344 4390 4011 3360 396 452 -366 C ATOM 15155 CZ TYR B 344 29.368 113.448 94.343 1.00 42.94 C ANISOU15155 CZ TYR B 344 5953 5532 4830 406 398 -363 C ATOM 15156 OH TYR B 344 29.904 112.571 95.258 1.00 57.33 O ANISOU15156 OH TYR B 344 7827 7382 6572 440 440 -373 O ATOM 15157 H TYR B 344 25.649 115.189 92.987 1.00 39.81 H ATOM 15158 HA TYR B 344 25.845 116.601 90.668 1.00 47.95 H ATOM 15159 HB2 TYR B 344 28.148 115.938 90.596 1.00 30.00 H ATOM 15160 HB3 TYR B 344 27.804 116.987 91.735 1.00 30.00 H ATOM 15161 HD1 TYR B 344 28.522 113.561 91.261 1.00 52.45 H ATOM 15162 HD2 TYR B 344 28.237 116.429 94.024 1.00 51.03 H ATOM 15163 HE1 TYR B 344 29.423 112.154 92.817 1.00 48.84 H ATOM 15164 HE2 TYR B 344 29.145 115.008 95.587 1.00 37.14 H ATOM 15165 HH TYR B 344 29.969 112.943 96.008 1.00 68.79 H ATOM 15166 N SER B 345 24.889 113.848 90.620 1.00 40.18 N ANISOU15166 N SER B 345 5375 4905 4987 256 191 -200 N ATOM 15167 CA SER B 345 24.537 112.634 89.871 1.00 34.59 C ANISOU15167 CA SER B 345 4676 4159 4307 245 119 -175 C ATOM 15168 C SER B 345 24.374 112.812 88.363 1.00 24.54 C ANISOU15168 C SER B 345 3379 2873 3073 216 17 -170 C ATOM 15169 O SER B 345 24.575 111.874 87.612 1.00 56.48 O ANISOU15169 O SER B 345 7449 6915 7095 213 -56 -169 O ATOM 15170 CB SER B 345 23.243 112.028 90.431 1.00 37.75 C ANISOU15170 CB SER B 345 5041 4483 4822 235 162 -125 C ATOM 15171 OG SER B 345 22.216 112.999 90.552 1.00 46.97 O ANISOU15171 OG SER B 345 6140 5603 6102 212 200 -99 O ATOM 15172 H SER B 345 24.344 114.022 91.262 1.00 48.22 H ATOM 15173 HA SER B 345 25.242 111.981 90.007 1.00 41.51 H ATOM 15174 HB2 SER B 345 22.942 111.327 89.832 1.00 45.31 H ATOM 15175 HB3 SER B 345 23.426 111.656 91.307 1.00 45.31 H ATOM 15176 HG SER B 345 22.461 113.613 91.070 1.00 56.36 H ATOM 15177 N ASP B 346 23.987 113.997 87.915 1.00 39.48 N ANISOU15177 N ASP B 346 5222 4754 5025 193 10 -166 N ATOM 15178 CA ASP B 346 23.707 114.210 86.494 1.00 33.54 C ANISOU15178 CA ASP B 346 4440 3983 4321 164 -85 -155 C ATOM 15179 C ASP B 346 24.969 114.487 85.701 1.00 37.25 C ANISOU15179 C ASP B 346 4952 4524 4679 170 -149 -200 C ATOM 15180 O ASP B 346 24.923 114.619 84.472 1.00 25.43 O ANISOU15180 O ASP B 346 3439 3023 3202 148 -233 -197 O ATOM 15181 CB ASP B 346 22.674 115.342 86.297 1.00 35.37 C ANISOU15181 CB ASP B 346 4599 4168 4674 136 -68 -127 C ATOM 15182 CG ASP B 346 23.072 116.653 86.977 1.00 48.62 C ANISOU15182 CG ASP B 346 6267 5883 6323 145 1 -153 C ATOM 15183 OD1 ASP B 346 23.921 116.641 87.903 1.00 38.04 O ANISOU15183 OD1 ASP B 346 4972 4594 4888 175 59 -185 O ATOM 15184 OD2 ASP B 346 22.516 117.706 86.577 1.00 61.02 O ANISOU15184 OD2 ASP B 346 7785 7430 7970 123 -3 -140 O ATOM 15185 H ASP B 346 23.878 114.694 88.407 1.00 47.38 H ATOM 15186 HA ASP B 346 23.316 113.398 86.137 1.00 40.25 H ATOM 15187 HB2 ASP B 346 22.577 115.517 85.348 1.00 42.45 H ATOM 15188 HB3 ASP B 346 21.824 115.060 86.669 1.00 42.45 H ATOM 15189 N ILE B 347 26.083 114.602 86.429 1.00 47.33 N ANISOU15189 N ILE B 347 6279 5867 5837 201 -106 -242 N ATOM 15190 CA ILE B 347 27.401 114.885 85.850 1.00 45.76 C ANISOU15190 CA ILE B 347 6125 5743 5518 211 -155 -290 C ATOM 15191 C ILE B 347 28.390 113.802 86.282 1.00 34.43 C ANISOU15191 C ILE B 347 4762 4356 3965 244 -155 -319 C ATOM 15192 O ILE B 347 29.590 114.015 86.346 1.00 50.86 O ANISOU15192 O ILE B 347 6889 6507 5929 264 -158 -364 O ATOM 15193 CB ILE B 347 27.920 116.300 86.243 1.00 29.96 C ANISOU15193 CB ILE B 347 4116 3788 3482 217 -105 -321 C ATOM 15194 CG1 ILE B 347 28.096 116.440 87.759 1.00 30.85 C ANISOU15194 CG1 ILE B 347 4244 3918 3561 245 3 -333 C ATOM 15195 CG2 ILE B 347 26.974 117.371 85.729 1.00 42.64 C ANISOU15195 CG2 ILE B 347 5651 5347 5203 185 -112 -293 C ATOM 15196 CD1 ILE B 347 28.901 117.676 88.165 1.00 30.39 C ANISOU15196 CD1 ILE B 347 4192 3919 3437 256 48 -374 C ATOM 15197 H ILE B 347 26.101 114.518 87.284 1.00 56.79 H ATOM 15198 HA ILE B 347 27.330 114.853 84.883 1.00 54.91 H ATOM 15199 HB ILE B 347 28.785 116.432 85.824 1.00 35.96 H ATOM 15200 HG12 ILE B 347 27.221 116.506 88.172 1.00 37.02 H ATOM 15201 HG13 ILE B 347 28.562 115.658 88.094 1.00 37.02 H ATOM 15202 HG21 ILE B 347 27.316 118.243 85.984 1.00 51.17 H ATOM 15203 HG22 ILE B 347 26.921 117.307 84.762 1.00 51.17 H ATOM 15204 HG23 ILE B 347 26.097 117.232 86.119 1.00 51.17 H ATOM 15205 HD11 ILE B 347 28.973 117.701 89.132 1.00 36.47 H ATOM 15206 HD12 ILE B 347 29.784 117.621 87.768 1.00 36.47 H ATOM 15207 HD13 ILE B 347 28.443 118.469 87.846 1.00 36.47 H ATOM 15208 N VAL B 348 27.850 112.635 86.590 1.00 46.38 N ANISOU15208 N VAL B 348 5462 4750 7410 -847 237 -771 N ATOM 15209 CA VAL B 348 28.636 111.472 86.947 1.00 39.06 C ANISOU15209 CA VAL B 348 4582 3888 6373 -848 214 -727 C ATOM 15210 C VAL B 348 27.993 110.281 86.208 1.00 32.81 C ANISOU15210 C VAL B 348 3834 3089 5545 -792 184 -691 C ATOM 15211 O VAL B 348 26.840 110.345 85.836 1.00 34.94 O ANISOU15211 O VAL B 348 4097 3312 5867 -777 190 -723 O ATOM 15212 CB VAL B 348 28.665 111.334 88.492 1.00 51.72 C ANISOU15212 CB VAL B 348 6186 5534 7931 -937 242 -793 C ATOM 15213 CG1 VAL B 348 28.040 110.029 88.964 1.00 50.94 C ANISOU15213 CG1 VAL B 348 6133 5462 7760 -951 233 -808 C ATOM 15214 CG2 VAL B 348 30.081 111.501 89.022 1.00 33.50 C ANISOU15214 CG2 VAL B 348 3878 3280 5573 -963 241 -764 C ATOM 15215 H VAL B 348 27.002 112.489 86.599 1.00 55.65 H ATOM 15216 HA VAL B 348 29.546 111.581 86.627 1.00 46.88 H ATOM 15217 HB VAL B 348 28.135 112.054 88.867 1.00 62.06 H ATOM 15218 HG11 VAL B 348 28.082 109.991 89.932 1.00 61.13 H ATOM 15219 HG12 VAL B 348 27.115 109.998 88.671 1.00 61.13 H ATOM 15220 HG13 VAL B 348 28.533 109.287 88.581 1.00 61.13 H ATOM 15221 HG21 VAL B 348 30.069 111.410 89.988 1.00 40.21 H ATOM 15222 HG22 VAL B 348 30.647 110.816 88.632 1.00 40.21 H ATOM 15223 HG23 VAL B 348 30.408 112.380 88.776 1.00 40.21 H ATOM 15224 N THR B 349 28.734 109.212 85.951 1.00 46.01 N ANISOU15224 N THR B 349 5550 4806 7127 -758 151 -624 N ATOM 15225 CA THR B 349 28.172 108.069 85.225 1.00 32.16 C ANISOU15225 CA THR B 349 3838 3047 5336 -702 121 -586 C ATOM 15226 C THR B 349 28.725 106.728 85.687 1.00 37.28 C ANISOU15226 C THR B 349 4538 3760 5868 -708 98 -553 C ATOM 15227 O THR B 349 29.471 106.658 86.660 1.00 37.16 O ANISOU15227 O THR B 349 4527 3794 5799 -761 109 -565 O ATOM 15228 CB THR B 349 28.397 108.173 83.695 1.00 53.95 C ANISOU15228 CB THR B 349 6598 5772 8129 -611 90 -510 C ATOM 15229 OG1 THR B 349 28.013 106.939 83.075 1.00 58.52 O ANISOU15229 OG1 THR B 349 7223 6356 8657 -559 58 -467 O ATOM 15230 CG2 THR B 349 29.855 108.431 83.362 1.00 52.48 C ANISOU15230 CG2 THR B 349 6408 5616 7915 -587 73 -442 C ATOM 15231 H THR B 349 29.557 109.119 86.182 1.00 55.22 H ATOM 15232 HA THR B 349 27.214 108.054 85.376 1.00 38.60 H ATOM 15233 HB THR B 349 27.864 108.899 83.335 1.00 64.74 H ATOM 15234 HG1 THR B 349 28.131 106.985 82.244 1.00 70.23 H ATOM 15235 HG21 THR B 349 29.969 108.492 82.400 1.00 62.98 H ATOM 15236 HG22 THR B 349 30.145 109.263 83.767 1.00 62.98 H ATOM 15237 HG23 THR B 349 30.405 107.706 83.699 1.00 62.98 H ATOM 15238 N THR B 350 28.330 105.668 84.981 1.00 35.15 N ANISOU15238 N THR B 350 4308 3488 5559 -654 68 -511 N ATOM 15239 CA THR B 350 28.777 104.308 85.272 1.00 39.22 C ANISOU15239 CA THR B 350 4877 4061 5964 -650 43 -474 C ATOM 15240 C THR B 350 29.929 103.997 84.371 1.00 44.19 C ANISOU15240 C THR B 350 5525 4714 6553 -586 6 -378 C ATOM 15241 O THR B 350 30.061 104.590 83.301 1.00 49.58 O ANISOU15241 O THR B 350 6188 5358 7294 -529 -5 -338 O ATOM 15242 CB THR B 350 27.698 103.246 84.975 1.00 42.55 C ANISOU15242 CB THR B 350 5334 4470 6362 -624 27 -478 C ATOM 15243 OG1 THR B 350 27.009 103.602 83.773 1.00 39.83 O ANISOU15243 OG1 THR B 350 4976 4064 6093 -561 18 -459 O ATOM 15244 CG2 THR B 350 26.704 103.119 86.133 1.00 31.33 C ANISOU15244 CG2 THR B 350 3912 3051 4942 -697 58 -568 C ATOM 15245 H THR B 350 27.790 105.715 84.313 1.00 42.18 H ATOM 15246 HA THR B 350 29.060 104.234 86.197 1.00 47.06 H ATOM 15247 HB THR B 350 28.127 102.384 84.851 1.00 51.06 H ATOM 15248 HG1 THR B 350 26.418 103.030 83.600 1.00 47.79 H ATOM 15249 HG21 THR B 350 26.036 102.447 85.925 1.00 37.60 H ATOM 15250 HG22 THR B 350 27.170 102.860 86.943 1.00 37.60 H ATOM 15251 HG23 THR B 350 26.259 103.968 86.282 1.00 37.60 H ATOM 15252 N LEU B 351 30.746 103.043 84.796 1.00 50.60 N ANISOU15252 N LEU B 351 6375 5586 7263 -593 -13 -342 N ATOM 15253 CA LEU B 351 31.962 102.699 84.075 1.00 48.07 C ANISOU15253 CA LEU B 351 6075 5297 6894 -539 -47 -252 C ATOM 15254 C LEU B 351 31.643 101.992 82.764 1.00 53.40 C ANISOU15254 C LEU B 351 6777 5947 7564 -452 -84 -188 C ATOM 15255 O LEU B 351 30.974 100.957 82.754 1.00 50.29 O ANISOU15255 O LEU B 351 6420 5561 7127 -441 -97 -189 O ATOM 15256 CB LEU B 351 32.829 101.817 84.954 1.00 30.63 C ANISOU15256 CB LEU B 351 3902 3161 4576 -574 -56 -237 C ATOM 15257 CG LEU B 351 33.958 101.091 84.255 1.00 45.15 C ANISOU15257 CG LEU B 351 5775 5038 6343 -516 -96 -143 C ATOM 15258 CD1 LEU B 351 34.850 102.090 83.553 1.00 64.70 C ANISOU15258 CD1 LEU B 351 8217 7498 8869 -483 -100 -99 C ATOM 15259 CD2 LEU B 351 34.728 100.289 85.281 1.00 45.62 C ANISOU15259 CD2 LEU B 351 5866 5168 6298 -562 -100 -141 C ATOM 15260 H LEU B 351 30.617 102.576 85.507 1.00 60.72 H ATOM 15261 HA LEU B 351 32.456 103.509 83.873 1.00 57.69 H ATOM 15262 HB2 LEU B 351 33.225 102.371 85.645 1.00 36.76 H ATOM 15263 HB3 LEU B 351 32.263 101.145 85.365 1.00 36.76 H ATOM 15264 HG LEU B 351 33.594 100.482 83.594 1.00 54.19 H ATOM 15265 HD11 LEU B 351 35.569 101.614 83.109 1.00 77.64 H ATOM 15266 HD12 LEU B 351 34.324 102.579 82.901 1.00 77.64 H ATOM 15267 HD13 LEU B 351 35.215 102.703 84.210 1.00 77.64 H ATOM 15268 HD21 LEU B 351 35.453 99.822 84.837 1.00 54.74 H ATOM 15269 HD22 LEU B 351 35.084 100.893 85.951 1.00 54.74 H ATOM 15270 HD23 LEU B 351 34.128 99.650 85.698 1.00 54.74 H ATOM 15271 N ASP B 352 32.125 102.559 81.662 1.00 54.90 N ANISOU15271 N ASP B 352 6950 6111 7800 -392 -100 -131 N ATOM 15272 CA ASP B 352 31.876 102.007 80.336 1.00 59.85 C ANISOU15272 CA ASP B 352 7599 6711 8430 -306 -135 -67 C ATOM 15273 C ASP B 352 32.965 100.999 79.981 1.00 61.21 C ANISOU15273 C ASP B 352 7814 6936 8505 -264 -174 17 C ATOM 15274 O ASP B 352 34.087 101.374 79.601 1.00 47.15 O ANISOU15274 O ASP B 352 6025 5172 6717 -241 -186 71 O ATOM 15275 CB ASP B 352 31.855 103.125 79.296 1.00 71.03 C ANISOU15275 CB ASP B 352 8975 8070 9944 -259 -133 -47 C ATOM 15276 CG ASP B 352 31.418 102.639 77.924 1.00 75.08 C ANISOU15276 CG ASP B 352 9507 8547 10473 -172 -165 11 C ATOM 15277 OD1 ASP B 352 30.686 101.616 77.848 1.00 76.99 O ANISOU15277 OD1 ASP B 352 9785 8792 10677 -157 -180 10 O ATOM 15278 OD2 ASP B 352 31.808 103.287 76.925 1.00 63.18 O ANISOU15278 OD2 ASP B 352 7978 7009 9017 -119 -177 57 O ATOM 15279 H ASP B 352 32.606 103.273 81.657 1.00 65.88 H ATOM 15280 HA ASP B 352 31.017 101.556 80.326 1.00 71.82 H ATOM 15281 HB2 ASP B 352 31.234 103.812 79.583 1.00 85.24 H ATOM 15282 HB3 ASP B 352 32.747 103.496 79.213 1.00 85.24 H ATOM 15283 N LEU B 353 32.637 99.717 80.104 1.00 53.49 N ANISOU15283 N LEU B 353 6884 5986 7453 -256 -194 30 N ATOM 15284 CA LEU B 353 33.640 98.683 79.949 1.00 29.02 C ANISOU15284 CA LEU B 353 3829 2944 4253 -226 -229 102 C ATOM 15285 C LEU B 353 34.054 98.476 78.511 1.00 50.58 C ANISOU15285 C LEU B 353 6572 5658 6989 -135 -267 190 C ATOM 15286 O LEU B 353 33.260 98.630 77.573 1.00 40.78 O ANISOU15286 O LEU B 353 5323 4362 5808 -85 -274 198 O ATOM 15287 CB LEU B 353 33.136 97.354 80.478 1.00 28.85 C ANISOU15287 CB LEU B 353 3855 2955 4150 -243 -240 89 C ATOM 15288 CG LEU B 353 32.928 97.182 81.971 1.00 50.23 C ANISOU15288 CG LEU B 353 6567 5698 6820 -331 -211 16 C ATOM 15289 CD1 LEU B 353 32.593 95.724 82.183 1.00 43.88 C ANISOU15289 CD1 LEU B 353 5817 4929 5927 -326 -233 28 C ATOM 15290 CD2 LEU B 353 34.151 97.592 82.792 1.00 45.57 C ANISOU15290 CD2 LEU B 353 5965 5156 6193 -379 -199 16 C ATOM 15291 H LEU B 353 31.846 99.426 80.276 1.00 64.18 H ATOM 15292 HA LEU B 353 34.429 98.929 80.456 1.00 34.82 H ATOM 15293 HB2 LEU B 353 32.281 97.175 80.056 1.00 34.62 H ATOM 15294 HB3 LEU B 353 33.768 96.671 80.205 1.00 34.62 H ATOM 15295 HG LEU B 353 32.171 97.716 82.256 1.00 60.27 H ATOM 15296 HD11 LEU B 353 32.451 95.568 83.130 1.00 52.66 H ATOM 15297 HD12 LEU B 353 31.787 95.511 81.688 1.00 52.66 H ATOM 15298 HD13 LEU B 353 33.331 95.181 81.865 1.00 52.66 H ATOM 15299 HD21 LEU B 353 33.957 97.460 83.734 1.00 54.68 H ATOM 15300 HD22 LEU B 353 34.906 97.044 82.529 1.00 54.68 H ATOM 15301 HD23 LEU B 353 34.345 98.527 82.622 1.00 54.68 H ATOM 15302 N ALA B 354 35.317 98.109 78.350 1.00 49.60 N ANISOU15302 N ALA B 354 6467 5580 6798 -113 -291 256 N ATOM 15303 CA ALA B 354 35.776 97.525 77.110 1.00 41.74 C ANISOU15303 CA ALA B 354 5497 4584 5777 -28 -334 346 C ATOM 15304 C ALA B 354 35.195 96.109 77.077 1.00 49.18 C ANISOU15304 C ALA B 354 6492 5546 6648 -9 -357 359 C ATOM 15305 O ALA B 354 34.779 95.590 78.117 1.00 64.43 O ANISOU15305 O ALA B 354 8440 7504 8536 -66 -343 307 O ATOM 15306 CB ALA B 354 37.279 97.496 77.091 1.00 32.86 C ANISOU15306 CB ALA B 354 4380 3509 4596 -18 -351 407 C ATOM 15307 H ALA B 354 35.928 98.189 78.950 1.00 59.52 H ATOM 15308 HA ALA B 354 35.448 98.032 76.350 1.00 50.09 H ATOM 15309 HB1 ALA B 354 37.577 97.103 76.256 1.00 39.43 H ATOM 15310 HB2 ALA B 354 37.613 98.404 77.168 1.00 39.43 H ATOM 15311 HB3 ALA B 354 37.594 96.964 77.839 1.00 39.43 H ATOM 15312 N PRO B 355 35.142 95.488 75.891 1.00 36.52 N ANISOU15312 N PRO B 355 4913 3928 5033 72 -394 428 N ATOM 15313 CA PRO B 355 34.745 94.087 75.697 1.00 38.26 C ANISOU15313 CA PRO B 355 5186 4169 5181 101 -423 455 C ATOM 15314 C PRO B 355 35.326 93.113 76.753 1.00 47.68 C ANISOU15314 C PRO B 355 6418 5435 6264 54 -429 452 C ATOM 15315 O PRO B 355 36.545 92.953 76.826 1.00 64.31 O ANISOU15315 O PRO B 355 8535 7587 8312 59 -444 501 O ATOM 15316 CB PRO B 355 35.329 93.775 74.327 1.00 36.17 C ANISOU15316 CB PRO B 355 4938 3899 4907 192 -464 550 C ATOM 15317 CG PRO B 355 35.291 95.074 73.609 1.00 36.28 C ANISOU15317 CG PRO B 355 4903 3857 5024 217 -451 550 C ATOM 15318 CD PRO B 355 35.422 96.158 74.613 1.00 27.43 C ANISOU15318 CD PRO B 355 3739 2735 3946 141 -409 482 C ATOM 15319 HA PRO B 355 33.779 94.003 75.669 1.00 45.91 H ATOM 15320 HB2 PRO B 355 36.241 93.458 74.422 1.00 43.41 H ATOM 15321 HB3 PRO B 355 34.778 93.115 73.877 1.00 43.41 H ATOM 15322 HG2 PRO B 355 36.029 95.111 72.980 1.00 43.53 H ATOM 15323 HG3 PRO B 355 34.447 95.154 73.139 1.00 43.53 H ATOM 15324 HD2 PRO B 355 36.325 96.514 74.610 1.00 32.91 H ATOM 15325 HD3 PRO B 355 34.766 96.853 74.446 1.00 32.91 H ATOM 15326 N PRO B 356 34.475 92.462 77.564 1.00 35.10 N ANISOU15326 N PRO B 356 4846 3853 4640 10 -416 397 N ATOM 15327 CA PRO B 356 35.029 91.687 78.681 1.00 42.35 C ANISOU15327 CA PRO B 356 5794 4837 5459 -44 -416 385 C ATOM 15328 C PRO B 356 35.363 90.226 78.379 1.00 47.81 C ANISOU15328 C PRO B 356 6545 5573 6049 -3 -457 447 C ATOM 15329 O PRO B 356 35.864 89.549 79.272 1.00 57.24 O ANISOU15329 O PRO B 356 7767 6825 7159 -45 -459 441 O ATOM 15330 CB PRO B 356 33.908 91.745 79.714 1.00 35.74 C ANISOU15330 CB PRO B 356 4949 3988 4643 -114 -381 291 C ATOM 15331 CG PRO B 356 32.684 91.759 78.896 1.00 44.54 C ANISOU15331 CG PRO B 356 6059 5043 5823 -71 -384 281 C ATOM 15332 CD PRO B 356 33.010 92.536 77.640 1.00 36.65 C ANISOU15332 CD PRO B 356 5033 4001 4892 -4 -397 333 C ATOM 15333 HA PRO B 356 35.815 92.128 79.038 1.00 50.82 H ATOM 15334 HB2 PRO B 356 33.939 90.958 80.280 1.00 42.89 H ATOM 15335 HB3 PRO B 356 33.985 92.556 80.240 1.00 42.89 H ATOM 15336 HG2 PRO B 356 32.433 90.849 78.676 1.00 53.45 H ATOM 15337 HG3 PRO B 356 31.973 92.197 79.389 1.00 53.45 H ATOM 15338 HD2 PRO B 356 32.609 92.110 76.866 1.00 43.98 H ATOM 15339 HD3 PRO B 356 32.722 93.458 77.728 1.00 43.98 H ATOM 15340 N THR B 357 35.085 89.751 77.169 1.00 45.33 N ANISOU15340 N THR B 357 6249 5233 5742 75 -489 505 N ATOM 15341 CA THR B 357 35.318 88.354 76.810 1.00 49.07 C ANISOU15341 CA THR B 357 6778 5744 6122 118 -530 565 C ATOM 15342 C THR B 357 35.942 88.335 75.432 1.00 52.22 C ANISOU15342 C THR B 357 7182 6130 6530 206 -566 655 C ATOM 15343 O THR B 357 35.804 89.298 74.688 1.00 46.30 O ANISOU15343 O THR B 357 6395 5331 5867 237 -558 661 O ATOM 15344 CB THR B 357 33.997 87.529 76.804 1.00 41.46 C ANISOU15344 CB THR B 357 5840 4760 5152 123 -533 533 C ATOM 15345 OG1 THR B 357 33.129 87.989 75.764 1.00 37.79 O ANISOU15345 OG1 THR B 357 5356 4229 4776 175 -534 537 O ATOM 15346 CG2 THR B 357 33.275 87.651 78.128 1.00 27.69 C ANISOU15346 CG2 THR B 357 4088 3022 3412 37 -495 440 C ATOM 15347 H THR B 357 34.758 90.224 76.529 1.00 54.40 H ATOM 15348 HA THR B 357 35.937 87.951 77.439 1.00 58.88 H ATOM 15349 HB THR B 357 34.205 86.594 76.657 1.00 49.75 H ATOM 15350 HG1 THR B 357 32.418 87.542 75.764 1.00 45.35 H ATOM 15351 HG21 THR B 357 32.455 87.132 78.107 1.00 33.23 H ATOM 15352 HG22 THR B 357 33.839 87.321 78.845 1.00 33.23 H ATOM 15353 HG23 THR B 357 33.055 88.580 78.302 1.00 33.23 H ATOM 15354 N LYS B 358 36.634 87.254 75.081 1.00 60.58 N ANISOU15354 N LYS B 358 8049 7194 7774 442 -769 -1356 N ATOM 15355 CA LYS B 358 37.304 87.207 73.785 1.00 49.24 C ANISOU15355 CA LYS B 358 6555 5837 6317 444 -771 -1352 C ATOM 15356 C LYS B 358 36.283 87.252 72.671 1.00 43.56 C ANISOU15356 C LYS B 358 5801 5174 5576 473 -753 -1314 C ATOM 15357 O LYS B 358 36.581 87.798 71.611 1.00 42.06 O ANISOU15357 O LYS B 358 5574 5035 5372 474 -734 -1284 O ATOM 15358 CB LYS B 358 38.178 85.966 73.639 1.00 30.82 C ANISOU15358 CB LYS B 358 4191 3545 3973 439 -817 -1413 C ATOM 15359 CG LYS B 358 39.405 85.984 74.498 1.00 47.87 C ANISOU15359 CG LYS B 358 6374 5663 6150 409 -835 -1449 C ATOM 15360 CD LYS B 358 39.840 84.574 74.864 1.00 47.22 C ANISOU15360 CD LYS B 358 6282 5592 6065 408 -883 -1516 C ATOM 15361 CE LYS B 358 40.990 84.600 75.844 1.00 37.88 C ANISOU15361 CE LYS B 358 5128 4361 4902 377 -901 -1551 C ATOM 15362 NZ LYS B 358 42.185 85.163 75.165 1.00 54.51 N ANISOU15362 NZ LYS B 358 7206 6502 7004 359 -893 -1543 N ATOM 15363 H LYS B 358 36.730 86.549 75.563 1.00 72.70 H ATOM 15364 HA LYS B 358 37.875 87.987 73.698 1.00 59.09 H ATOM 15365 HB2 LYS B 358 37.657 85.186 73.884 1.00 36.98 H ATOM 15366 HB3 LYS B 358 38.465 85.893 72.715 1.00 36.98 H ATOM 15367 HG2 LYS B 358 40.130 86.411 74.014 1.00 57.44 H ATOM 15368 HG3 LYS B 358 39.217 86.468 75.317 1.00 57.44 H ATOM 15369 HD2 LYS B 358 39.098 84.105 75.277 1.00 56.66 H ATOM 15370 HD3 LYS B 358 40.130 84.108 74.064 1.00 56.66 H ATOM 15371 HE2 LYS B 358 40.765 85.164 76.600 1.00 45.45 H ATOM 15372 HE3 LYS B 358 41.193 83.697 76.136 1.00 45.45 H ATOM 15373 HZ1 LYS B 358 42.873 85.186 75.730 1.00 65.41 H ATOM 15374 HZ2 LYS B 358 42.403 84.660 74.465 1.00 65.41 H ATOM 15375 HZ3 LYS B 358 42.014 85.990 74.885 1.00 65.41 H ATOM 15376 N LYS B 359 35.094 86.686 72.913 1.00 41.46 N ANISOU15376 N LYS B 359 5547 4898 5308 495 -758 -1314 N ATOM 15377 CA LYS B 359 34.003 86.698 71.920 1.00 46.78 C ANISOU15377 CA LYS B 359 6191 5621 5961 524 -740 -1277 C ATOM 15378 C LYS B 359 33.627 88.131 71.605 1.00 42.66 C ANISOU15378 C LYS B 359 5679 5084 5444 523 -692 -1212 C ATOM 15379 O LYS B 359 33.764 88.605 70.475 1.00 36.19 O ANISOU15379 O LYS B 359 4821 4321 4610 528 -673 -1180 O ATOM 15380 CB LYS B 359 32.749 85.979 72.436 1.00 42.18 C ANISOU15380 CB LYS B 359 5630 5016 5380 547 -751 -1286 C ATOM 15381 CG LYS B 359 32.727 84.476 72.252 1.00 36.09 C ANISOU15381 CG LYS B 359 4831 4287 4594 561 -795 -1339 C ATOM 15382 CD LYS B 359 32.191 84.079 70.890 1.00 36.86 C ANISOU15382 CD LYS B 359 4874 4468 4663 586 -794 -1323 C ATOM 15383 CE LYS B 359 32.673 82.678 70.429 1.00 79.52 C ANISOU15383 CE LYS B 359 10236 9931 10048 593 -839 -1379 C ATOM 15384 NZ LYS B 359 34.154 82.446 70.552 1.00 70.80 N ANISOU15384 NZ LYS B 359 9121 8834 8947 567 -862 -1420 N ATOM 15385 H LYS B 359 34.891 86.287 73.647 1.00 49.75 H ATOM 15386 HA LYS B 359 34.297 86.266 71.103 1.00 56.13 H ATOM 15387 HB2 LYS B 359 32.665 86.156 73.386 1.00 50.61 H ATOM 15388 HB3 LYS B 359 31.977 86.338 71.971 1.00 50.61 H ATOM 15389 HG2 LYS B 359 33.630 84.132 72.334 1.00 43.30 H ATOM 15390 HG3 LYS B 359 32.155 84.081 72.929 1.00 43.30 H ATOM 15391 HD2 LYS B 359 31.222 84.065 70.925 1.00 44.23 H ATOM 15392 HD3 LYS B 359 32.488 84.728 70.234 1.00 44.23 H ATOM 15393 HE2 LYS B 359 32.226 82.006 70.966 1.00 95.43 H ATOM 15394 HE3 LYS B 359 32.434 82.561 69.496 1.00 95.43 H ATOM 15395 HZ1 LYS B 359 34.358 81.627 70.271 1.00 84.96 H ATOM 15396 HZ2 LYS B 359 34.597 83.040 70.058 1.00 84.96 H ATOM 15397 HZ3 LYS B 359 34.406 82.532 71.401 1.00 84.96 H ATOM 15398 N LEU B 360 33.154 88.813 72.641 1.00 51.11 N ANISOU15398 N LEU B 360 6805 6078 6538 516 -671 -1192 N ATOM 15399 CA LEU B 360 32.707 90.191 72.540 1.00 43.15 C ANISOU15399 CA LEU B 360 5815 5042 5538 514 -624 -1129 C ATOM 15400 C LEU B 360 33.770 91.099 71.973 1.00 38.11 C ANISOU15400 C LEU B 360 5157 4424 4898 494 -606 -1109 C ATOM 15401 O LEU B 360 33.462 92.137 71.411 1.00 57.23 O ANISOU15401 O LEU B 360 7573 6853 7318 497 -568 -1055 O ATOM 15402 CB LEU B 360 32.290 90.692 73.909 1.00 36.74 C ANISOU15402 CB LEU B 360 5068 4138 4753 504 -611 -1122 C ATOM 15403 CG LEU B 360 30.896 90.206 74.299 1.00 30.95 C ANISOU15403 CG LEU B 360 4355 3384 4021 529 -612 -1118 C ATOM 15404 CD1 LEU B 360 30.638 90.382 75.784 1.00 41.62 C ANISOU15404 CD1 LEU B 360 5771 4644 5399 518 -612 -1128 C ATOM 15405 CD2 LEU B 360 29.850 90.932 73.503 1.00 31.11 C ANISOU15405 CD2 LEU B 360 4363 3427 4032 550 -574 -1057 C ATOM 15406 H LEU B 360 33.081 88.487 73.434 1.00 61.33 H ATOM 15407 HA LEU B 360 31.934 90.231 71.956 1.00 51.78 H ATOM 15408 HB2 LEU B 360 32.919 90.368 74.572 1.00 44.09 H ATOM 15409 HB3 LEU B 360 32.281 91.662 73.903 1.00 44.09 H ATOM 15410 HG LEU B 360 30.824 89.260 74.093 1.00 37.14 H ATOM 15411 HD11 LEU B 360 29.746 90.062 75.990 1.00 49.95 H ATOM 15412 HD12 LEU B 360 31.296 89.870 76.281 1.00 49.95 H ATOM 15413 HD13 LEU B 360 30.713 91.323 76.008 1.00 49.95 H ATOM 15414 HD21 LEU B 360 28.973 90.609 73.765 1.00 37.34 H ATOM 15415 HD22 LEU B 360 29.920 91.883 73.683 1.00 37.34 H ATOM 15416 HD23 LEU B 360 29.997 90.762 72.559 1.00 37.34 H ATOM 15417 N MET B 361 35.025 90.699 72.103 1.00 47.49 N ANISOU15417 N MET B 361 6334 5622 6088 474 -633 -1151 N ATOM 15418 CA MET B 361 36.113 91.497 71.586 1.00 31.89 C ANISOU15418 CA MET B 361 4340 3667 4112 454 -618 -1136 C ATOM 15419 C MET B 361 36.262 91.306 70.085 1.00 45.16 C ANISOU15419 C MET B 361 5956 5438 5765 467 -618 -1124 C ATOM 15420 O MET B 361 36.574 92.263 69.379 1.00 48.93 O ANISOU15420 O MET B 361 6415 5937 6237 461 -589 -1084 O ATOM 15421 CB MET B 361 37.403 91.160 72.310 1.00 31.83 C ANISOU15421 CB MET B 361 4344 3632 4116 427 -647 -1185 C ATOM 15422 CG MET B 361 38.517 92.119 71.982 1.00 32.11 C ANISOU15422 CG MET B 361 4371 3674 4155 403 -629 -1166 C ATOM 15423 SD MET B 361 40.144 91.577 72.528 1.00 40.52 S ANISOU15423 SD MET B 361 5437 4731 5229 373 -666 -1226 S ATOM 15424 CE MET B 361 41.157 92.636 71.492 1.00 81.11 C ANISOU15424 CE MET B 361 10542 9915 10362 358 -641 -1191 C ATOM 15425 H MET B 361 35.269 89.969 72.487 1.00 56.99 H ATOM 15426 HA MET B 361 35.918 92.431 71.759 1.00 38.27 H ATOM 15427 HB2 MET B 361 37.248 91.195 73.266 1.00 38.19 H ATOM 15428 HB3 MET B 361 37.688 90.270 72.051 1.00 38.19 H ATOM 15429 HG2 MET B 361 38.552 92.237 71.020 1.00 38.53 H ATOM 15430 HG3 MET B 361 38.330 92.969 72.410 1.00 38.53 H ATOM 15431 HE1 MET B 361 42.092 92.456 71.676 1.00 97.33 H ATOM 15432 HE2 MET B 361 40.961 92.447 70.561 1.00 97.33 H ATOM 15433 HE3 MET B 361 40.952 93.562 71.693 1.00 97.33 H ATOM 15434 N MET B 362 36.040 90.088 69.587 1.00 42.89 N ANISOU15434 N MET B 362 5635 5204 5459 485 -649 -1158 N ATOM 15435 CA MET B 362 36.089 89.858 68.140 1.00 39.06 C ANISOU15435 CA MET B 362 5088 4806 4946 500 -649 -1146 C ATOM 15436 C MET B 362 34.910 90.561 67.531 1.00 55.29 C ANISOU15436 C MET B 362 7139 6874 6995 521 -612 -1087 C ATOM 15437 O MET B 362 35.053 91.308 66.566 1.00 57.87 O ANISOU15437 O MET B 362 7436 7242 7311 522 -586 -1048 O ATOM 15438 CB MET B 362 36.028 88.375 67.779 1.00 43.64 C ANISOU15438 CB MET B 362 5635 5438 5508 516 -691 -1195 C ATOM 15439 CG MET B 362 37.381 87.693 67.759 1.00 86.90 C ANISOU15439 CG MET B 362 11093 10943 10984 498 -725 -1248 C ATOM 15440 SD MET B 362 37.277 85.945 67.303 1.00167.74 S ANISOU15440 SD MET B 362 21290 21243 21200 518 -774 -1305 S ATOM 15441 CE MET B 362 37.463 86.011 65.518 1.00117.31 C ANISOU15441 CE MET B 362 14832 14957 14782 531 -764 -1280 C ATOM 15442 H MET B 362 35.861 89.389 70.055 1.00 51.47 H ATOM 15443 HA MET B 362 36.910 90.229 67.781 1.00 46.87 H ATOM 15444 HB2 MET B 362 35.475 87.917 68.431 1.00 52.37 H ATOM 15445 HB3 MET B 362 35.638 88.285 66.895 1.00 52.37 H ATOM 15446 HG2 MET B 362 37.950 88.139 67.112 1.00104.28 H ATOM 15447 HG3 MET B 362 37.776 87.750 68.643 1.00104.28 H ATOM 15448 HE1 MET B 362 37.421 85.110 65.163 1.00140.77 H ATOM 15449 HE2 MET B 362 36.745 86.547 65.147 1.00140.77 H ATOM 15450 HE3 MET B 362 38.320 86.412 65.305 1.00140.77 H ATOM 15451 N TRP B 363 33.740 90.318 68.114 1.00 64.80 N ANISOU15451 N TRP B 363 8374 8042 8205 538 -609 -1081 N ATOM 15452 CA TRP B 363 32.514 90.947 67.655 1.00 59.80 C ANISOU15452 CA TRP B 363 7741 7414 7567 558 -574 -1025 C ATOM 15453 C TRP B 363 32.678 92.474 67.512 1.00 52.24 C ANISOU15453 C TRP B 363 6797 6434 6620 545 -530 -969 C ATOM 15454 O TRP B 363 32.206 93.044 66.536 1.00 63.00 O ANISOU15454 O TRP B 363 8132 7837 7969 558 -502 -924 O ATOM 15455 CB TRP B 363 31.343 90.636 68.589 1.00 59.81 C ANISOU15455 CB TRP B 363 7785 7360 7580 572 -575 -1026 C ATOM 15456 CG TRP B 363 30.751 89.228 68.557 1.00 62.07 C ANISOU15456 CG TRP B 363 8056 7674 7853 593 -611 -1066 C ATOM 15457 CD1 TRP B 363 30.827 88.296 69.550 1.00 71.16 C ANISOU15457 CD1 TRP B 363 9234 8790 9015 590 -645 -1117 C ATOM 15458 CD2 TRP B 363 29.936 88.639 67.525 1.00 80.14 C ANISOU15458 CD2 TRP B 363 10304 10029 10118 622 -615 -1056 C ATOM 15459 NE1 TRP B 363 30.132 87.163 69.203 1.00 67.38 N ANISOU15459 NE1 TRP B 363 8732 8349 8519 614 -670 -1140 N ATOM 15460 CE2 TRP B 363 29.581 87.344 67.966 1.00 83.31 C ANISOU15460 CE2 TRP B 363 10708 10430 10515 634 -652 -1104 C ATOM 15461 CE3 TRP B 363 29.482 89.074 66.271 1.00 75.88 C ANISOU15461 CE3 TRP B 363 9724 9549 9559 637 -590 -1012 C ATOM 15462 CZ2 TRP B 363 28.800 86.480 67.197 1.00 98.50 C ANISOU15462 CZ2 TRP B 363 12597 12411 12417 661 -666 -1108 C ATOM 15463 CZ3 TRP B 363 28.703 88.208 65.506 1.00 73.11 C ANISOU15463 CZ3 TRP B 363 9338 9255 9186 664 -604 -1016 C ATOM 15464 CH2 TRP B 363 28.369 86.928 65.976 1.00 89.45 C ANISOU15464 CH2 TRP B 363 11413 11323 11253 676 -641 -1064 C ATOM 15465 H TRP B 363 33.632 89.787 68.783 1.00 77.76 H ATOM 15466 HA TRP B 363 32.293 90.592 66.780 1.00 71.76 H ATOM 15467 HB2 TRP B 363 31.637 90.797 69.500 1.00 71.77 H ATOM 15468 HB3 TRP B 363 30.622 91.250 68.378 1.00 71.77 H ATOM 15469 HD1 TRP B 363 31.281 88.414 70.353 1.00 85.40 H ATOM 15470 HE1 TRP B 363 30.065 86.451 69.681 1.00 80.85 H ATOM 15471 HE3 TRP B 363 29.697 89.922 65.956 1.00 91.06 H ATOM 15472 HZ2 TRP B 363 28.581 85.629 67.502 1.00118.20 H ATOM 15473 HZ3 TRP B 363 28.396 88.484 64.672 1.00 87.73 H ATOM 15474 HH2 TRP B 363 27.852 86.369 65.443 1.00107.35 H ATOM 15475 N LYS B 364 33.349 93.140 68.454 1.00 52.09 N ANISOU15475 N LYS B 364 6818 6350 6624 519 -522 -972 N ATOM 15476 CA LYS B 364 33.587 94.587 68.316 1.00 49.97 C ANISOU15476 CA LYS B 364 6562 6061 6365 506 -481 -921 C ATOM 15477 C LYS B 364 34.503 94.931 67.145 1.00 55.08 C ANISOU15477 C LYS B 364 7158 6774 6996 498 -475 -909 C ATOM 15478 O LYS B 364 34.351 95.959 66.499 1.00 65.12 O ANISOU15478 O LYS B 364 8418 8059 8264 499 -439 -858 O ATOM 15479 CB LYS B 364 34.169 95.203 69.589 1.00 47.07 C ANISOU15479 CB LYS B 364 6248 5610 6025 479 -475 -928 C ATOM 15480 CG LYS B 364 34.337 96.735 69.487 1.00 57.40 C ANISOU15480 CG LYS B 364 7572 6893 7345 465 -431 -873 C ATOM 15481 CD LYS B 364 33.907 97.464 70.764 1.00 74.81 C ANISOU15481 CD LYS B 364 9842 9006 9577 455 -410 -855 C ATOM 15482 CE LYS B 364 34.306 98.942 70.742 1.00 89.34 C ANISOU15482 CE LYS B 364 11698 10819 11430 436 -370 -808 C ATOM 15483 NZ LYS B 364 33.952 99.681 72.001 1.00 85.57 N ANISOU15483 NZ LYS B 364 11284 10249 10978 425 -350 -792 N ATOM 15484 H LYS B 364 33.671 92.790 69.170 1.00 62.51 H ATOM 15485 HA LYS B 364 32.735 95.019 68.151 1.00 59.97 H ATOM 15486 HB2 LYS B 364 33.574 95.015 70.332 1.00 56.48 H ATOM 15487 HB3 LYS B 364 35.042 94.816 69.757 1.00 56.48 H ATOM 15488 HG2 LYS B 364 35.270 96.940 69.323 1.00 68.88 H ATOM 15489 HG3 LYS B 364 33.791 97.064 68.755 1.00 68.88 H ATOM 15490 HD2 LYS B 364 32.943 97.412 70.851 1.00 89.78 H ATOM 15491 HD3 LYS B 364 34.335 97.047 71.528 1.00 89.78 H ATOM 15492 HE2 LYS B 364 35.266 99.006 70.620 1.00107.21 H ATOM 15493 HE3 LYS B 364 33.851 99.378 70.004 1.00107.21 H ATOM 15494 HZ1 LYS B 364 34.205 100.532 71.935 1.00102.68 H ATOM 15495 HZ2 LYS B 364 33.073 99.650 72.135 1.00102.68 H ATOM 15496 HZ3 LYS B 364 34.364 99.311 72.697 1.00102.68 H ATOM 15497 N GLU B 365 35.474 94.075 66.889 1.00 62.96 N ANISOU15497 N GLU B 365 8127 7811 7984 490 -510 -957 N ATOM 15498 CA GLU B 365 36.398 94.290 65.791 1.00 61.71 C ANISOU15498 CA GLU B 365 7919 7718 7809 483 -509 -952 C ATOM 15499 C GLU B 365 35.665 94.086 64.479 1.00 67.72 C ANISOU15499 C GLU B 365 8631 8554 8544 510 -500 -925 C ATOM 15500 O GLU B 365 35.842 94.855 63.529 1.00 81.67 O ANISOU15500 O GLU B 365 10369 10361 10302 509 -474 -886 O ATOM 15501 CB GLU B 365 37.572 93.316 65.923 1.00 63.97 C ANISOU15501 CB GLU B 365 8188 8025 8092 469 -551 -1014 C ATOM 15502 CG GLU B 365 38.638 93.392 64.832 1.00 82.03 C ANISOU15502 CG GLU B 365 10424 10382 10363 461 -555 -1017 C ATOM 15503 CD GLU B 365 39.755 92.361 65.038 1.00 96.08 C ANISOU15503 CD GLU B 365 12189 12178 12140 448 -599 -1081 C ATOM 15504 OE1 GLU B 365 39.884 91.831 66.173 1.00 83.87 O ANISOU15504 OE1 GLU B 365 10679 10578 10609 439 -622 -1119 O ATOM 15505 OE2 GLU B 365 40.502 92.090 64.066 1.00103.30 O ANISOU15505 OE2 GLU B 365 13055 13159 13037 446 -610 -1091 O ATOM 15506 H GLU B 365 35.621 93.357 67.338 1.00 75.55 H ATOM 15507 HA GLU B 365 36.739 95.198 65.822 1.00 74.05 H ATOM 15508 HB2 GLU B 365 38.015 93.485 66.770 1.00 76.76 H ATOM 15509 HB3 GLU B 365 37.220 92.412 65.920 1.00 76.76 H ATOM 15510 HG2 GLU B 365 38.224 93.221 63.971 1.00 98.44 H ATOM 15511 HG3 GLU B 365 39.038 94.276 64.839 1.00 98.44 H ATOM 15512 N THR B 366 34.793 93.082 64.463 1.00 58.85 N ANISOU15512 N THR B 366 7502 7447 7411 532 -520 -945 N ATOM 15513 CA THR B 366 34.246 92.539 63.228 1.00 49.97 C ANISOU15513 CA THR B 366 6326 6401 6260 557 -524 -936 C ATOM 15514 C THR B 366 32.778 92.974 62.989 1.00 65.45 C ANISOU15514 C THR B 366 8294 8356 8217 581 -493 -886 C ATOM 15515 O THR B 366 32.116 92.549 62.035 1.00 70.50 O ANISOU15515 O THR B 366 8896 9054 8835 604 -494 -874 O ATOM 15516 CB THR B 366 34.425 90.995 63.244 1.00 47.14 C ANISOU15516 CB THR B 366 5947 6076 5889 566 -572 -998 C ATOM 15517 OG1 THR B 366 34.919 90.555 61.974 1.00 76.95 O ANISOU15517 OG1 THR B 366 9661 9936 9639 572 -583 -1006 O ATOM 15518 CG2 THR B 366 33.132 90.248 63.635 1.00 36.95 C ANISOU15518 CG2 THR B 366 4672 4769 4597 590 -582 -1005 C ATOM 15519 H THR B 366 34.499 92.692 65.170 1.00 70.62 H ATOM 15520 HA THR B 366 34.770 92.882 62.487 1.00 59.96 H ATOM 15521 HB THR B 366 35.090 90.779 63.916 1.00 56.57 H ATOM 15522 HG1 THR B 366 35.017 89.721 61.978 1.00 92.33 H ATOM 15523 HG21 THR B 366 33.289 89.290 63.633 1.00 44.33 H ATOM 15524 HG22 THR B 366 32.848 90.518 64.523 1.00 44.33 H ATOM 15525 HG23 THR B 366 32.426 90.453 63.002 1.00 44.33 H ATOM 15526 N GLY B 367 32.282 93.850 63.851 1.00 62.32 N ANISOU15526 N GLY B 367 9108 7897 6675 1426 -1617 304 N ATOM 15527 CA GLY B 367 30.916 94.318 63.756 1.00 56.54 C ANISOU15527 CA GLY B 367 8419 7201 5864 1431 -1537 276 C ATOM 15528 C GLY B 367 30.882 95.702 63.142 1.00 76.13 C ANISOU15528 C GLY B 367 10916 9673 8339 1359 -1598 323 C ATOM 15529 O GLY B 367 31.917 96.235 62.713 1.00 80.43 O ANISOU15529 O GLY B 367 11435 10190 8935 1304 -1697 377 O ATOM 15530 H GLY B 367 32.725 94.189 64.506 1.00 74.79 H ATOM 15531 HA2 GLY B 367 30.398 93.714 63.202 1.00 67.85 H ATOM 15532 HA3 GLY B 367 30.517 94.356 64.639 1.00 67.85 H ATOM 15533 N GLY B 368 29.692 96.295 63.126 1.00 59.62 N ANISOU15533 N GLY B 368 8862 7598 6192 1360 -1541 302 N ATOM 15534 CA GLY B 368 29.483 97.545 62.427 1.00 59.83 C ANISOU15534 CA GLY B 368 8898 7634 6202 1295 -1578 345 C ATOM 15535 C GLY B 368 28.908 97.237 61.060 1.00 65.07 C ANISOU15535 C GLY B 368 9512 8424 6787 1256 -1492 365 C ATOM 15536 O GLY B 368 29.020 96.112 60.573 1.00 60.81 O ANISOU15536 O GLY B 368 8925 7963 6218 1269 -1425 357 O ATOM 15537 H GLY B 368 28.990 95.988 63.516 1.00 71.54 H ATOM 15538 HA2 GLY B 368 28.861 98.105 62.918 1.00 71.80 H ATOM 15539 HA3 GLY B 368 30.324 98.017 62.322 1.00 71.80 H ATOM 15540 N VAL B 369 28.279 98.222 60.433 1.00 66.25 N ANISOU15540 N VAL B 369 9671 8600 6901 1207 -1486 389 N ATOM 15541 CA VAL B 369 27.586 97.948 59.193 1.00 60.38 C ANISOU15541 CA VAL B 369 8884 7979 6079 1166 -1391 402 C ATOM 15542 C VAL B 369 28.603 97.717 58.087 1.00 66.11 C ANISOU15542 C VAL B 369 9551 8771 6796 1106 -1427 456 C ATOM 15543 O VAL B 369 28.423 96.812 57.273 1.00 70.49 O ANISOU15543 O VAL B 369 10056 9437 7290 1097 -1333 450 O ATOM 15544 CB VAL B 369 26.571 99.057 58.826 1.00 61.04 C ANISOU15544 CB VAL B 369 8990 8073 6129 1130 -1371 412 C ATOM 15545 CG1 VAL B 369 25.673 99.330 59.990 1.00 66.25 C ANISOU15545 CG1 VAL B 369 9708 8658 6806 1192 -1351 358 C ATOM 15546 CG2 VAL B 369 27.264 100.344 58.397 1.00 55.41 C ANISOU15546 CG2 VAL B 369 8282 7328 5444 1065 -1482 473 C ATOM 15547 H VAL B 369 28.241 99.039 60.700 1.00 79.50 H ATOM 15548 HA VAL B 369 27.085 97.125 59.301 1.00 72.46 H ATOM 15549 HB VAL B 369 26.022 98.752 58.088 1.00 73.25 H ATOM 15550 HG11 VAL B 369 25.043 100.026 59.746 1.00 79.50 H ATOM 15551 HG12 VAL B 369 25.196 98.516 60.217 1.00 79.50 H ATOM 15552 HG13 VAL B 369 26.212 99.619 60.743 1.00 79.50 H ATOM 15553 HG21 VAL B 369 26.591 101.007 58.178 1.00 66.49 H ATOM 15554 HG22 VAL B 369 27.817 100.663 59.127 1.00 66.49 H ATOM 15555 HG23 VAL B 369 27.815 100.162 57.620 1.00 66.49 H ATOM 15556 N GLU B 370 29.683 98.500 58.071 1.00 54.63 N ANISOU15556 N GLU B 370 8100 7252 5406 1064 -1556 504 N ATOM 15557 CA GLU B 370 30.669 98.364 56.999 1.00 57.12 C ANISOU15557 CA GLU B 370 8359 7621 5723 997 -1605 556 C ATOM 15558 C GLU B 370 31.290 96.987 57.040 1.00 60.15 C ANISOU15558 C GLU B 370 8698 8041 6115 1036 -1577 537 C ATOM 15559 O GLU B 370 31.349 96.295 56.029 1.00 63.67 O ANISOU15559 O GLU B 370 9062 8601 6529 988 -1482 539 O ATOM 15560 CB GLU B 370 31.776 99.415 57.080 1.00 78.12 C ANISOU15560 CB GLU B 370 11028 10183 8469 945 -1755 606 C ATOM 15561 CG GLU B 370 31.307 100.851 56.858 1.00100.11 C ANISOU15561 CG GLU B 370 13847 12946 11243 903 -1785 631 C ATOM 15562 CD GLU B 370 32.454 101.803 56.547 1.00103.65 C ANISOU15562 CD GLU B 370 14289 13330 11764 833 -1917 686 C ATOM 15563 OE1 GLU B 370 33.573 101.316 56.262 1.00 98.92 O ANISOU15563 OE1 GLU B 370 13645 12716 11222 794 -1984 712 O ATOM 15564 OE2 GLU B 370 32.230 103.035 56.566 1.00107.55 O ANISOU15564 OE2 GLU B 370 14816 13785 12262 812 -1955 701 O ATOM 15565 H GLU B 370 29.865 99.104 58.655 1.00 65.56 H ATOM 15566 HA GLU B 370 30.222 98.466 56.144 1.00 68.54 H ATOM 15567 HB2 GLU B 370 32.181 99.371 57.960 1.00 93.74 H ATOM 15568 HB3 GLU B 370 32.442 99.216 56.404 1.00 93.74 H ATOM 15569 HG2 GLU B 370 30.690 100.871 56.110 1.00120.13 H ATOM 15570 HG3 GLU B 370 30.865 101.167 57.661 1.00120.13 H ATOM 15571 N LYS B 371 31.738 96.584 58.220 1.00 56.65 N ANISOU15571 N LYS B 371 8276 7505 5745 1100 -1619 509 N ATOM 15572 CA LYS B 371 32.422 95.311 58.360 1.00 49.17 C ANISOU15572 CA LYS B 371 7281 6580 4822 1144 -1606 492 C ATOM 15573 C LYS B 371 31.485 94.152 58.067 1.00 52.32 C ANISOU15573 C LYS B 371 7637 7102 5141 1180 -1419 440 C ATOM 15574 O LYS B 371 31.915 93.117 57.572 1.00 62.82 O ANISOU15574 O LYS B 371 8831 8496 6543 1114 -1282 417 O ATOM 15575 CB LYS B 371 33.004 95.171 59.759 1.00 51.05 C ANISOU15575 CB LYS B 371 7550 6687 5158 1199 -1677 468 C ATOM 15576 CG LYS B 371 34.451 95.587 59.847 1.00 58.07 C ANISOU15576 CG LYS B 371 8416 7485 6165 1150 -1826 514 C ATOM 15577 CD LYS B 371 35.336 94.579 59.153 1.00 70.24 C ANISOU15577 CD LYS B 371 9797 9080 7810 1059 -1724 509 C ATOM 15578 CE LYS B 371 36.800 94.720 59.535 1.00 69.75 C ANISOU15578 CE LYS B 371 9690 8911 7901 1010 -1835 535 C ATOM 15579 NZ LYS B 371 37.557 93.499 59.102 1.00 64.31 N ANISOU15579 NZ LYS B 371 8836 8272 7325 933 -1697 512 N ATOM 15580 H LYS B 371 31.659 97.029 58.953 1.00 67.99 H ATOM 15581 HA LYS B 371 33.154 95.273 57.725 1.00 59.00 H ATOM 15582 HB2 LYS B 371 32.496 95.730 60.368 1.00 61.25 H ATOM 15583 HB3 LYS B 371 32.943 94.243 60.034 1.00 61.25 H ATOM 15584 HG2 LYS B 371 34.567 96.447 59.414 1.00 69.69 H ATOM 15585 HG3 LYS B 371 34.717 95.639 60.779 1.00 69.69 H ATOM 15586 HD2 LYS B 371 35.048 93.685 59.396 1.00 84.28 H ATOM 15587 HD3 LYS B 371 35.263 94.702 58.193 1.00 84.28 H ATOM 15588 HE2 LYS B 371 37.180 95.494 59.089 1.00 83.70 H ATOM 15589 HE3 LYS B 371 36.879 94.808 60.498 1.00 83.70 H ATOM 15590 HZ1 LYS B 371 38.415 93.578 59.324 1.00 77.17 H ATOM 15591 HZ2 LYS B 371 37.221 92.776 59.499 1.00 77.17 H ATOM 15592 HZ3 LYS B 371 37.495 93.399 58.220 1.00 77.17 H ATOM 15593 N LEU B 372 30.202 94.337 58.356 1.00 65.30 N ANISOU15593 N LEU B 372 9339 8760 6712 1220 -1348 407 N ATOM 15594 CA LEU B 372 29.219 93.274 58.182 1.00 49.25 C ANISOU15594 CA LEU B 372 7280 6832 4599 1265 -1181 355 C ATOM 15595 C LEU B 372 28.841 93.034 56.729 1.00 49.20 C ANISOU15595 C LEU B 372 7207 6990 4497 1206 -1067 372 C ATOM 15596 O LEU B 372 28.603 91.891 56.339 1.00 52.47 O ANISOU15596 O LEU B 372 7529 7501 4906 1191 -902 333 O ATOM 15597 CB LEU B 372 27.957 93.584 58.967 1.00 52.56 C ANISOU15597 CB LEU B 372 7763 7195 5013 1300 -1131 307 C ATOM 15598 CG LEU B 372 27.902 93.087 60.408 1.00 47.70 C ANISOU15598 CG LEU B 372 7190 6484 4450 1386 -1142 255 C ATOM 15599 CD1 LEU B 372 26.570 93.471 61.022 1.00 44.55 C ANISOU15599 CD1 LEU B 372 6844 6045 4037 1414 -1086 209 C ATOM 15600 CD2 LEU B 372 28.089 91.588 60.498 1.00 46.87 C ANISOU15600 CD2 LEU B 372 7038 6444 4328 1447 -1053 220 C ATOM 15601 H LEU B 372 29.873 95.073 58.656 1.00 78.36 H ATOM 15602 HA LEU B 372 29.589 92.448 58.531 1.00 59.09 H ATOM 15603 HB2 LEU B 372 27.847 94.548 58.992 1.00 63.07 H ATOM 15604 HB3 LEU B 372 27.205 93.189 58.499 1.00 63.07 H ATOM 15605 HG LEU B 372 28.606 93.513 60.920 1.00 57.24 H ATOM 15606 HD11 LEU B 372 26.542 93.151 61.938 1.00 53.46 H ATOM 15607 HD12 LEU B 372 26.481 94.436 61.005 1.00 53.46 H ATOM 15608 HD13 LEU B 372 25.857 93.063 60.507 1.00 53.46 H ATOM 15609 HD21 LEU B 372 28.047 91.321 61.430 1.00 56.25 H ATOM 15610 HD22 LEU B 372 27.384 91.151 59.995 1.00 56.25 H ATOM 15611 HD23 LEU B 372 28.954 91.356 60.126 1.00 56.25 H ATOM 15612 N PHE B 373 28.768 94.104 55.937 1.00 58.44 N ANISOU15612 N PHE B 373 8383 8171 5649 1125 -1113 418 N ATOM 15613 CA PHE B 373 28.384 93.995 54.527 1.00 55.88 C ANISOU15613 CA PHE B 373 7968 7985 5279 1024 -976 428 C ATOM 15614 C PHE B 373 29.571 93.629 53.629 1.00 58.37 C ANISOU15614 C PHE B 373 8118 8327 5733 872 -912 445 C ATOM 15615 O PHE B 373 29.429 93.505 52.412 1.00 64.27 O ANISOU15615 O PHE B 373 8767 9181 6473 764 -791 454 O ATOM 15616 CB PHE B 373 27.762 95.305 54.045 1.00 61.93 C ANISOU15616 CB PHE B 373 8799 8742 5989 984 -1038 467 C ATOM 15617 CG PHE B 373 26.317 95.456 54.399 1.00 63.40 C ANISOU15617 CG PHE B 373 9024 8903 6162 1002 -954 422 C ATOM 15618 CD1 PHE B 373 25.941 95.987 55.622 1.00 65.90 C ANISOU15618 CD1 PHE B 373 9413 9089 6538 1057 -1022 399 C ATOM 15619 CD2 PHE B 373 25.333 95.075 53.505 1.00 69.53 C ANISOU15619 CD2 PHE B 373 9754 9790 6876 961 -802 401 C ATOM 15620 CE1 PHE B 373 24.613 96.131 55.952 1.00 75.07 C ANISOU15620 CE1 PHE B 373 10600 10233 7691 1078 -949 358 C ATOM 15621 CE2 PHE B 373 23.996 95.212 53.825 1.00 71.87 C ANISOU15621 CE2 PHE B 373 10078 10052 7177 977 -737 360 C ATOM 15622 CZ PHE B 373 23.635 95.739 55.053 1.00 81.24 C ANISOU15622 CZ PHE B 373 11336 11114 8417 1039 -813 340 C ATOM 15623 H PHE B 373 28.936 94.908 56.192 1.00 70.12 H ATOM 15624 HA PHE B 373 27.717 93.297 54.436 1.00 67.06 H ATOM 15625 HB2 PHE B 373 28.244 96.045 54.447 1.00 74.31 H ATOM 15626 HB3 PHE B 373 27.836 95.350 53.079 1.00 74.31 H ATOM 15627 HD1 PHE B 373 26.596 96.248 56.229 1.00 79.08 H ATOM 15628 HD2 PHE B 373 25.574 94.718 52.681 1.00 83.44 H ATOM 15629 HE1 PHE B 373 24.373 96.486 56.777 1.00 90.09 H ATOM 15630 HE2 PHE B 373 23.342 94.950 53.218 1.00 86.24 H ATOM 15631 HZ PHE B 373 22.736 95.836 55.271 1.00 97.49 H ATOM 15632 N SER B 374 30.739 93.456 54.239 1.00 59.71 N ANISOU15632 N SER B 374 8258 8399 6030 865 -993 450 N ATOM 15633 CA SER B 374 31.953 93.158 53.503 1.00 49.14 C ANISOU15633 CA SER B 374 6769 7070 4832 726 -950 468 C ATOM 15634 C SER B 374 32.532 91.794 53.879 1.00 49.95 C ANISOU15634 C SER B 374 6776 7176 5027 735 -853 423 C ATOM 15635 O SER B 374 33.628 91.456 53.441 1.00 53.17 O ANISOU15635 O SER B 374 7061 7577 5563 633 -825 433 O ATOM 15636 CB SER B 374 32.987 94.263 53.726 1.00 67.52 C ANISOU15636 CB SER B 374 9130 9277 7246 684 -1136 521 C ATOM 15637 OG SER B 374 33.013 94.680 55.081 1.00 80.67 O ANISOU15637 OG SER B 374 10932 10820 8900 810 -1296 521 O ATOM 15638 H SER B 374 30.852 93.507 55.090 1.00 71.66 H ATOM 15639 HA SER B 374 31.744 93.138 52.556 1.00 58.97 H ATOM 15640 HB2 SER B 374 33.864 93.926 53.484 1.00 81.02 H ATOM 15641 HB3 SER B 374 32.761 95.023 53.168 1.00 81.02 H ATOM 15642 HG SER B 374 32.260 94.977 55.304 1.00 96.81 H ATOM 15643 N LEU B 375 31.804 91.009 54.670 1.00 36.35 N ANISOU15643 N LEU B 375 5107 5466 3240 855 -801 374 N ATOM 15644 CA LEU B 375 32.285 89.674 55.049 1.00 45.86 C ANISOU15644 CA LEU B 375 6223 6677 4526 869 -704 330 C ATOM 15645 C LEU B 375 31.199 88.587 55.041 1.00 45.48 C ANISOU15645 C LEU B 375 6164 6733 4383 934 -535 273 C ATOM 15646 O LEU B 375 30.028 88.868 55.284 1.00 48.63 O ANISOU15646 O LEU B 375 6670 7160 4646 1022 -537 261 O ATOM 15647 CB LEU B 375 32.928 89.718 56.433 1.00 40.82 C ANISOU15647 CB LEU B 375 5662 5899 3950 964 -853 327 C ATOM 15648 CG LEU B 375 34.090 90.691 56.564 1.00 39.49 C ANISOU15648 CG LEU B 375 5500 5618 3885 907 -1022 380 C ATOM 15649 CD1 LEU B 375 34.489 90.812 58.011 1.00 31.81 C ANISOU15649 CD1 LEU B 375 4630 4511 2946 1019 -1175 376 C ATOM 15650 CD2 LEU B 375 35.265 90.237 55.714 1.00 50.49 C ANISOU15650 CD2 LEU B 375 6725 7037 5422 762 -950 393 C ATOM 15651 H LEU B 375 31.037 91.219 54.999 1.00 43.63 H ATOM 15652 HA LEU B 375 32.970 89.405 54.417 1.00 55.04 H ATOM 15653 HB2 LEU B 375 32.254 89.978 57.080 1.00 48.99 H ATOM 15654 HB3 LEU B 375 33.261 88.833 56.648 1.00 48.99 H ATOM 15655 HG LEU B 375 33.811 91.566 56.252 1.00 47.38 H ATOM 15656 HD11 LEU B 375 35.229 91.434 58.083 1.00 38.17 H ATOM 15657 HD12 LEU B 375 33.731 91.138 58.521 1.00 38.17 H ATOM 15658 HD13 LEU B 375 34.756 89.939 58.338 1.00 38.17 H ATOM 15659 HD21 LEU B 375 35.991 90.872 55.814 1.00 60.59 H ATOM 15660 HD22 LEU B 375 35.549 89.359 56.013 1.00 60.59 H ATOM 15661 HD23 LEU B 375 34.986 90.196 54.786 1.00 60.59 H ATOM 15662 N PRO B 376 31.600 87.328 54.803 1.00 42.01 N ANISOU15662 N PRO B 376 5597 6347 4018 894 -391 237 N ATOM 15663 CA PRO B 376 30.662 86.196 54.790 1.00 45.85 C ANISOU15663 CA PRO B 376 6061 6933 4428 950 -223 180 C ATOM 15664 C PRO B 376 29.945 86.033 56.114 1.00 44.57 C ANISOU15664 C PRO B 376 6037 6714 4185 1117 -287 149 C ATOM 15665 O PRO B 376 30.437 86.505 57.132 1.00 45.78 O ANISOU15665 O PRO B 376 6276 6744 4376 1184 -447 163 O ATOM 15666 CB PRO B 376 31.569 84.975 54.561 1.00 52.83 C ANISOU15666 CB PRO B 376 6790 7841 5443 882 -104 154 C ATOM 15667 CG PRO B 376 32.851 85.509 54.052 1.00 58.04 C ANISOU15667 CG PRO B 376 7368 8450 6234 760 -175 199 C ATOM 15668 CD PRO B 376 32.994 86.888 54.609 1.00 62.03 C ANISOU15668 CD PRO B 376 8004 8846 6719 799 -384 246 C ATOM 15669 HA PRO B 376 30.021 86.278 54.066 1.00 55.02 H ATOM 15670 HB2 PRO B 376 31.704 84.510 55.402 1.00 63.40 H ATOM 15671 HB3 PRO B 376 31.161 84.386 53.907 1.00 63.40 H ATOM 15672 HG2 PRO B 376 33.579 84.945 54.355 1.00 69.64 H ATOM 15673 HG3 PRO B 376 32.826 85.537 53.082 1.00 69.64 H ATOM 15674 HD2 PRO B 376 33.462 86.863 55.458 1.00 74.44 H ATOM 15675 HD3 PRO B 376 33.444 87.465 53.972 1.00 74.44 H ATOM 15676 N ALA B 377 28.803 85.363 56.111 1.00 41.28 N ANISOU15676 N ALA B 377 5642 6386 3657 1183 -162 105 N ATOM 15677 CA ALA B 377 28.101 85.107 57.353 1.00 34.34 C ANISOU15677 CA ALA B 377 4888 5460 2700 1341 -209 71 C ATOM 15678 C ALA B 377 28.817 83.978 58.081 1.00 40.81 C ANISOU15678 C ALA B 377 5647 6236 3621 1374 -175 36 C ATOM 15679 O ALA B 377 28.967 84.017 59.298 1.00 41.55 O ANISOU15679 O ALA B 377 5833 6228 3724 1479 -290 28 O ATOM 15680 CB ALA B 377 26.641 84.755 57.081 1.00 40.97 C ANISOU15680 CB ALA B 377 5767 6411 3387 1397 -84 36 C ATOM 15681 H ALA B 377 28.418 85.048 55.409 1.00 49.54 H ATOM 15682 HA ALA B 377 28.128 85.900 57.911 1.00 41.21 H ATOM 15683 HB1 ALA B 377 26.195 84.589 57.926 1.00 49.16 H ATOM 15684 HB2 ALA B 377 26.218 85.497 56.623 1.00 49.16 H ATOM 15685 HB3 ALA B 377 26.607 83.960 56.527 1.00 49.16 H ATOM 15686 N GLN B 378 29.254 82.978 57.318 1.00 47.22 N ANISOU15686 N GLN B 378 6305 7128 4510 1281 -17 16 N ATOM 15687 CA GLN B 378 30.030 81.863 57.847 1.00 43.35 C ANISOU15687 CA GLN B 378 5736 6605 4131 1293 29 -15 C ATOM 15688 C GLN B 378 31.511 82.159 57.648 1.00 42.07 C ANISOU15688 C GLN B 378 5488 6369 4129 1191 -50 24 C ATOM 15689 O GLN B 378 31.987 82.129 56.516 1.00 46.62 O ANISOU15689 O GLN B 378 5943 7007 4765 1057 31 41 O ATOM 15690 CB GLN B 378 29.667 80.564 57.123 1.00 53.52 C ANISOU15690 CB GLN B 378 6899 8023 5414 1249 254 -61 C ATOM 15691 CG GLN B 378 30.294 79.329 57.761 1.00 49.09 C ANISOU15691 CG GLN B 378 6268 7433 4952 1280 311 -99 C ATOM 15692 CD GLN B 378 29.807 79.106 59.187 1.00 60.05 C ANISOU15692 CD GLN B 378 7785 8748 6283 1442 233 -127 C ATOM 15693 OE1 GLN B 378 28.603 79.152 59.466 1.00 65.01 O ANISOU15693 OE1 GLN B 378 8512 9417 6772 1534 255 -150 O ATOM 15694 NE2 GLN B 378 30.740 78.869 60.099 1.00 57.06 N ANISOU15694 NE2 GLN B 378 7407 8262 6010 1477 140 -126 N ATOM 15695 H GLN B 378 29.110 82.924 56.472 1.00 56.67 H ATOM 15696 HA GLN B 378 29.854 81.757 58.795 1.00 52.02 H ATOM 15697 HB2 GLN B 378 28.704 80.452 57.139 1.00 64.23 H ATOM 15698 HB3 GLN B 378 29.979 80.617 56.206 1.00 64.23 H ATOM 15699 HG2 GLN B 378 30.060 78.547 57.237 1.00 58.91 H ATOM 15700 HG3 GLN B 378 31.257 79.439 57.785 1.00 58.91 H ATOM 15701 HE21 GLN B 378 31.569 78.848 59.870 1.00 68.47 H ATOM 15702 HE22 GLN B 378 30.517 78.737 60.919 1.00 68.47 H ATOM 15703 N PRO B 379 32.245 82.449 58.739 1.00 44.94 N ANISOU15703 N PRO B 379 5915 6600 4561 1251 -208 38 N ATOM 15704 CA PRO B 379 33.638 82.945 58.658 1.00 46.90 C ANISOU15704 CA PRO B 379 6106 6761 4953 1164 -317 81 C ATOM 15705 C PRO B 379 34.641 82.065 57.901 1.00 44.12 C ANISOU15705 C PRO B 379 5572 6451 4741 1042 -196 75 C ATOM 15706 O PRO B 379 34.722 80.849 58.108 1.00 41.92 O ANISOU15706 O PRO B 379 5221 6204 4503 1062 -80 33 O ATOM 15707 CB PRO B 379 34.050 83.064 60.126 1.00 30.96 C ANISOU15707 CB PRO B 379 4188 4605 2969 1278 -475 80 C ATOM 15708 CG PRO B 379 32.760 83.282 60.841 1.00 31.64 C ANISOU15708 CG PRO B 379 4426 4696 2901 1415 -505 58 C ATOM 15709 CD PRO B 379 31.766 82.427 60.132 1.00 27.72 C ANISOU15709 CD PRO B 379 3873 4339 2319 1408 -305 16 C ATOM 15710 HA PRO B 379 33.644 83.830 58.262 1.00 56.28 H ATOM 15711 HB2 PRO B 379 34.474 82.242 60.418 1.00 37.15 H ATOM 15712 HB3 PRO B 379 34.643 83.822 60.242 1.00 37.15 H ATOM 15713 HG2 PRO B 379 32.850 83.007 61.767 1.00 37.97 H ATOM 15714 HG3 PRO B 379 32.510 84.217 60.784 1.00 37.97 H ATOM 15715 HD2 PRO B 379 31.784 81.523 60.483 1.00 33.26 H ATOM 15716 HD3 PRO B 379 30.879 82.816 60.193 1.00 33.26 H ATOM 15717 N LEU B 380 35.422 82.715 57.043 1.00 52.58 N ANISOU15717 N LEU B 380 6571 7519 5887 914 -228 119 N ATOM 15718 CA LEU B 380 36.431 82.044 56.222 1.00 47.11 C ANISOU15718 CA LEU B 380 5705 6865 5331 784 -124 119 C ATOM 15719 C LEU B 380 37.856 82.390 56.667 1.00 39.75 C ANISOU15719 C LEU B 380 4744 5811 4548 745 -262 154 C ATOM 15720 O LEU B 380 38.266 83.542 56.653 1.00 49.59 O ANISOU15720 O LEU B 380 6044 6989 5810 716 -408 202 O ATOM 15721 CB LEU B 380 36.208 82.391 54.748 1.00 54.95 C ANISOU15721 CB LEU B 380 6617 7965 6296 654 -25 139 C ATOM 15722 CG LEU B 380 34.861 81.900 54.197 1.00 52.74 C ANISOU15722 CG LEU B 380 6341 7818 5879 678 136 102 C ATOM 15723 CD1 LEU B 380 34.617 82.436 52.794 1.00 36.70 C ANISOU15723 CD1 LEU B 380 4249 5884 3812 553 207 129 C ATOM 15724 CD2 LEU B 380 34.754 80.364 54.221 1.00 28.23 C ANISOU15724 CD2 LEU B 380 3140 4782 2804 693 312 45 C ATOM 15725 H LEU B 380 35.388 83.565 56.915 1.00 63.09 H ATOM 15726 HA LEU B 380 36.319 81.085 56.318 1.00 56.53 H ATOM 15727 HB2 LEU B 380 36.237 83.355 54.646 1.00 65.94 H ATOM 15728 HB3 LEU B 380 36.912 81.982 54.221 1.00 65.94 H ATOM 15729 HG LEU B 380 34.155 82.247 54.764 1.00 63.28 H ATOM 15730 HD11 LEU B 380 33.761 82.109 52.476 1.00 44.04 H ATOM 15731 HD12 LEU B 380 34.611 83.405 52.824 1.00 44.04 H ATOM 15732 HD13 LEU B 380 35.328 82.127 52.211 1.00 44.04 H ATOM 15733 HD21 LEU B 380 33.890 80.102 53.865 1.00 33.87 H ATOM 15734 HD22 LEU B 380 35.464 79.990 53.676 1.00 33.87 H ATOM 15735 HD23 LEU B 380 34.842 80.056 55.137 1.00 33.87 H ATOM 15736 N TRP B 381 38.605 81.360 57.043 1.00 50.69 N ANISOU15736 N TRP B 381 6042 7172 6045 745 -211 129 N ATOM 15737 CA TRP B 381 39.876 81.516 57.747 1.00 49.94 C ANISOU15737 CA TRP B 381 5936 6953 6086 740 -345 153 C ATOM 15738 C TRP B 381 41.071 81.701 56.802 1.00 62.66 C ANISOU15738 C TRP B 381 7409 8565 7833 584 -334 188 C ATOM 15739 O TRP B 381 42.078 82.305 57.165 1.00 81.78 O ANISOU15739 O TRP B 381 9840 10884 10350 559 -477 225 O ATOM 15740 CB TRP B 381 40.110 80.293 58.645 1.00 50.54 C ANISOU15740 CB TRP B 381 5984 7000 6219 818 -296 110 C ATOM 15741 CG TRP B 381 39.090 80.133 59.761 1.00 53.44 C ANISOU15741 CG TRP B 381 6493 7343 6467 980 -333 79 C ATOM 15742 CD1 TRP B 381 38.198 81.069 60.198 1.00 46.89 C ANISOU15742 CD1 TRP B 381 5820 6489 5508 1065 -438 90 C ATOM 15743 CD2 TRP B 381 38.875 78.966 60.577 1.00 54.46 C ANISOU15743 CD2 TRP B 381 6620 7471 6601 1074 -265 30 C ATOM 15744 NE1 TRP B 381 37.451 80.566 61.232 1.00 42.99 N ANISOU15744 NE1 TRP B 381 5420 5978 4936 1204 -440 52 N ATOM 15745 CE2 TRP B 381 37.841 79.275 61.481 1.00 48.08 C ANISOU15745 CE2 TRP B 381 5972 6638 5660 1213 -334 15 C ATOM 15746 CE3 TRP B 381 39.457 77.689 60.629 1.00 62.20 C ANISOU15746 CE3 TRP B 381 7480 8469 7685 1054 -151 -2 C ATOM 15747 CZ2 TRP B 381 37.367 78.354 62.420 1.00 46.34 C ANISOU15747 CZ2 TRP B 381 5792 6410 5405 1330 -293 -31 C ATOM 15748 CZ3 TRP B 381 38.987 76.775 61.572 1.00 50.22 C ANISOU15748 CZ3 TRP B 381 6004 6944 6134 1172 -112 -47 C ATOM 15749 CH2 TRP B 381 37.950 77.114 62.447 1.00 44.40 C ANISOU15749 CH2 TRP B 381 5426 6183 5262 1308 -182 -61 C ATOM 15750 H TRP B 381 38.394 80.539 56.899 1.00 60.83 H ATOM 15751 HA TRP B 381 39.824 82.298 58.318 1.00 59.93 H ATOM 15752 HB2 TRP B 381 40.076 79.494 58.096 1.00 60.65 H ATOM 15753 HB3 TRP B 381 40.986 80.372 59.054 1.00 60.65 H ATOM 15754 HD1 TRP B 381 38.118 81.929 59.853 1.00 56.27 H ATOM 15755 HE1 TRP B 381 36.827 80.987 61.648 1.00 51.59 H ATOM 15756 HE3 TRP B 381 40.142 77.457 60.044 1.00 74.64 H ATOM 15757 HZ2 TRP B 381 36.683 78.577 63.010 1.00 55.61 H ATOM 15758 HZ3 TRP B 381 39.362 75.925 61.614 1.00 60.27 H ATOM 15759 HH2 TRP B 381 37.658 76.488 63.069 1.00 53.28 H ATOM 15760 N ASN B 382 40.954 81.177 55.591 1.00 73.36 N ANISOU15760 N ASN B 382 8638 10038 9196 478 -162 174 N ATOM 15761 CA ASN B 382 42.014 81.283 54.595 1.00 68.28 C ANISOU15761 CA ASN B 382 7856 9411 8675 324 -131 203 C ATOM 15762 C ASN B 382 41.650 82.376 53.587 1.00 64.77 C ANISOU15762 C ASN B 382 7430 9016 8162 241 -151 241 C ATOM 15763 O ASN B 382 40.517 82.435 53.121 1.00 68.38 O ANISOU15763 O ASN B 382 7925 9565 8491 259 -69 227 O ATOM 15764 CB ASN B 382 42.190 79.931 53.895 1.00 46.97 C ANISOU15764 CB ASN B 382 4997 6810 6040 255 77 162 C ATOM 15765 CG ASN B 382 43.480 79.838 53.127 1.00 51.60 C ANISOU15765 CG ASN B 382 5434 7391 6780 110 102 186 C ATOM 15766 OD1 ASN B 382 43.837 80.745 52.385 1.00 60.01 O ANISOU15766 OD1 ASN B 382 6481 8458 7863 14 49 228 O ATOM 15767 ND2 ASN B 382 44.192 78.733 53.302 1.00 64.88 N ANISOU15767 ND2 ASN B 382 7007 9066 8577 94 183 158 N ATOM 15768 H ASN B 382 40.261 80.748 55.317 1.00 88.03 H ATOM 15769 HA ASN B 382 42.848 81.522 55.028 1.00 81.93 H ATOM 15770 HB2 ASN B 382 42.186 79.227 54.562 1.00 56.37 H ATOM 15771 HB3 ASN B 382 41.459 79.801 53.271 1.00 56.37 H ATOM 15772 HD21 ASN B 382 44.938 78.632 52.885 1.00 77.85 H ATOM 15773 HD22 ASN B 382 43.909 78.118 53.832 1.00 77.85 H ATOM 15774 N ASN B 383 42.592 83.247 53.247 1.00 52.30 N ANISOU15774 N ASN B 383 5827 7379 6667 152 -260 291 N ATOM 15775 CA ASN B 383 42.280 84.335 52.326 1.00 52.16 C ANISOU15775 CA ASN B 383 5830 7401 6586 74 -290 330 C ATOM 15776 C ASN B 383 41.974 83.822 50.928 1.00 60.28 C ANISOU15776 C ASN B 383 6730 8573 7599 -42 -96 315 C ATOM 15777 O ASN B 383 41.426 84.552 50.101 1.00 64.73 O ANISOU15777 O ASN B 383 7312 9198 8083 -96 -84 338 O ATOM 15778 CB ASN B 383 43.420 85.350 52.255 1.00 50.25 C ANISOU15778 CB ASN B 383 5583 7066 6445 -1 -447 386 C ATOM 15779 CG ASN B 383 43.361 86.379 53.358 1.00 52.61 C ANISOU15779 CG ASN B 383 6046 7241 6704 102 -658 414 C ATOM 15780 OD1 ASN B 383 42.396 86.454 54.097 1.00 56.42 O ANISOU15780 OD1 ASN B 383 6652 7713 7072 227 -690 395 O ATOM 15781 ND2 ASN B 383 44.398 87.195 53.459 1.00 74.99 N ANISOU15781 ND2 ASN B 383 8881 9981 9631 50 -803 460 N ATOM 15782 H ASN B 383 43.405 83.234 53.528 1.00 62.77 H ATOM 15783 HA ASN B 383 41.492 84.799 52.649 1.00 62.59 H ATOM 15784 HB2 ASN B 383 44.265 84.880 52.328 1.00 60.30 H ATOM 15785 HB3 ASN B 383 43.373 85.818 51.407 1.00 60.30 H ATOM 15786 HD21 ASN B 383 44.412 87.799 54.072 1.00 89.99 H ATOM 15787 HD22 ASN B 383 45.057 87.122 52.912 1.00 89.99 H ATOM 15788 N ARG B 384 42.328 82.567 50.662 1.00 57.43 N ANISOU15788 N ARG B 384 6239 8266 7316 -81 56 277 N ATOM 15789 CA ARG B 384 42.071 81.968 49.354 1.00 68.39 C ANISOU15789 CA ARG B 384 7497 9791 8696 -192 251 259 C ATOM 15790 C ARG B 384 40.564 81.767 49.178 1.00 71.12 C ANISOU15790 C ARG B 384 7909 10237 8876 -126 352 228 C ATOM 15791 O ARG B 384 39.997 82.084 48.124 1.00 64.83 O ANISOU15791 O ARG B 384 7085 9538 8008 -200 431 237 O ATOM 15792 CB ARG B 384 42.833 80.640 49.185 1.00 63.41 C ANISOU15792 CB ARG B 384 6713 9188 8193 -244 387 224 C ATOM 15793 CG ARG B 384 44.355 80.808 49.019 1.00 68.40 C ANISOU15793 CG ARG B 384 7248 9746 8995 -345 320 256 C ATOM 15794 CD ARG B 384 45.052 79.486 48.686 1.00 78.18 C ANISOU15794 CD ARG B 384 8324 11027 10355 -409 474 220 C ATOM 15795 NE ARG B 384 44.567 78.923 47.424 1.00 97.53 N ANISOU15795 NE ARG B 384 10665 13620 12770 -505 672 197 N ATOM 15796 CZ ARG B 384 44.730 77.657 47.043 1.00 83.91 C ANISOU15796 CZ ARG B 384 8812 11966 11104 -545 847 154 C ATOM 15797 NH1 ARG B 384 45.362 76.794 47.830 1.00 75.87 N ANISOU15797 NH1 ARG B 384 7755 10887 10184 -496 850 130 N ATOM 15798 NH2 ARG B 384 44.236 77.248 45.875 1.00 64.90 N ANISOU15798 NH2 ARG B 384 6315 9690 8654 -634 1019 135 N ATOM 15799 H ARG B 384 42.718 82.042 51.220 1.00 68.92 H ATOM 15800 HA ARG B 384 42.374 82.577 48.663 1.00 82.07 H ATOM 15801 HB2 ARG B 384 42.680 80.091 49.970 1.00 76.09 H ATOM 15802 HB3 ARG B 384 42.498 80.187 48.396 1.00 76.09 H ATOM 15803 HG2 ARG B 384 44.529 81.431 48.297 1.00 82.08 H ATOM 15804 HG3 ARG B 384 44.730 81.145 49.848 1.00 82.08 H ATOM 15805 HD2 ARG B 384 46.006 79.640 48.603 1.00 93.82 H ATOM 15806 HD3 ARG B 384 44.875 78.845 49.392 1.00 93.82 H ATOM 15807 HE ARG B 384 44.146 79.449 46.890 1.00117.03 H ATOM 15808 HH11 ARG B 384 45.678 77.054 48.587 1.00 91.04 H ATOM 15809 HH12 ARG B 384 45.463 75.978 47.580 1.00 91.04 H ATOM 15810 HH21 ARG B 384 43.825 77.803 45.363 1.00 77.88 H ATOM 15811 HH22 ARG B 384 44.340 76.431 45.626 1.00 77.88 H ATOM 15812 N LEU B 385 39.913 81.258 50.219 1.00 53.40 N ANISOU15812 N LEU B 385 5753 7969 6570 15 346 192 N ATOM 15813 CA LEU B 385 38.465 81.163 50.215 1.00 40.73 C ANISOU15813 CA LEU B 385 4230 6443 4802 95 417 165 C ATOM 15814 C LEU B 385 37.818 82.552 50.328 1.00 56.52 C ANISOU15814 C LEU B 385 6374 8411 6689 135 274 205 C ATOM 15815 O LEU B 385 36.840 82.827 49.645 1.00 58.26 O ANISOU15815 O LEU B 385 6619 8724 6794 121 343 204 O ATOM 15816 CB LEU B 385 37.978 80.243 51.336 1.00 52.23 C ANISOU15816 CB LEU B 385 5743 7878 6225 236 444 116 C ATOM 15817 CG LEU B 385 38.346 78.760 51.186 1.00 65.22 C ANISOU15817 CG LEU B 385 7252 9575 7955 208 612 69 C ATOM 15818 CD1 LEU B 385 37.619 77.886 52.206 1.00 61.64 C ANISOU15818 CD1 LEU B 385 6864 9117 7439 352 652 19 C ATOM 15819 CD2 LEU B 385 38.088 78.237 49.773 1.00 51.89 C ANISOU15819 CD2 LEU B 385 5430 8029 6256 86 808 54 C ATOM 15820 H LEU B 385 40.287 80.963 50.935 1.00 64.09 H ATOM 15821 HA LEU B 385 38.183 80.775 49.372 1.00 48.88 H ATOM 15822 HB2 LEU B 385 38.357 80.553 52.173 1.00 62.68 H ATOM 15823 HB3 LEU B 385 37.010 80.299 51.379 1.00 62.68 H ATOM 15824 HG LEU B 385 39.297 78.667 51.356 1.00 78.27 H ATOM 15825 HD11 LEU B 385 37.882 76.962 52.073 1.00 73.97 H ATOM 15826 HD12 LEU B 385 37.862 78.175 53.099 1.00 73.97 H ATOM 15827 HD13 LEU B 385 36.662 77.980 52.076 1.00 73.97 H ATOM 15828 HD21 LEU B 385 38.336 77.301 49.733 1.00 62.27 H ATOM 15829 HD22 LEU B 385 37.146 78.339 49.567 1.00 62.27 H ATOM 15830 HD23 LEU B 385 38.622 78.749 49.146 1.00 62.27 H ATOM 15831 N LEU B 386 38.353 83.440 51.162 1.00 58.12 N ANISOU15831 N LEU B 386 6672 8485 6926 183 78 240 N ATOM 15832 CA LEU B 386 37.670 84.709 51.408 1.00 53.88 C ANISOU15832 CA LEU B 386 6284 7911 6277 239 -60 273 C ATOM 15833 C LEU B 386 37.509 85.593 50.155 1.00 61.50 C ANISOU15833 C LEU B 386 7219 8943 7205 122 -45 313 C ATOM 15834 O LEU B 386 36.470 86.232 49.995 1.00 61.39 O ANISOU15834 O LEU B 386 7299 8968 7059 161 -61 321 O ATOM 15835 CB LEU B 386 38.347 85.487 52.536 1.00 52.19 C ANISOU15835 CB LEU B 386 6172 7543 6114 307 -274 304 C ATOM 15836 CG LEU B 386 37.802 86.890 52.808 1.00 45.28 C ANISOU15836 CG LEU B 386 5449 6616 5140 357 -433 343 C ATOM 15837 CD1 LEU B 386 36.437 86.834 53.466 1.00 46.72 C ANISOU15837 CD1 LEU B 386 5763 6820 5169 497 -426 312 C ATOM 15838 CD2 LEU B 386 38.772 87.661 53.657 1.00 47.54 C ANISOU15838 CD2 LEU B 386 5798 6755 5511 381 -635 380 C ATOM 15839 H LEU B 386 39.092 83.336 51.589 1.00 69.75 H ATOM 15840 HA LEU B 386 36.773 84.502 51.715 1.00 64.66 H ATOM 15841 HB2 LEU B 386 38.254 84.977 53.356 1.00 62.63 H ATOM 15842 HB3 LEU B 386 39.288 85.580 52.320 1.00 62.63 H ATOM 15843 HG LEU B 386 37.707 87.359 51.964 1.00 54.34 H ATOM 15844 HD11 LEU B 386 36.124 87.739 53.622 1.00 56.07 H ATOM 15845 HD12 LEU B 386 35.822 86.368 52.877 1.00 56.07 H ATOM 15846 HD13 LEU B 386 36.512 86.359 54.308 1.00 56.07 H ATOM 15847 HD21 LEU B 386 38.413 88.547 53.820 1.00 57.05 H ATOM 15848 HD22 LEU B 386 38.896 87.194 54.498 1.00 57.05 H ATOM 15849 HD23 LEU B 386 39.618 87.728 53.187 1.00 57.05 H ATOM 15850 N LYS B 387 38.507 85.647 49.273 1.00 63.90 N ANISOU15850 N LYS B 387 7396 9261 7622 -21 -16 338 N ATOM 15851 CA LYS B 387 38.375 86.466 48.055 1.00 66.12 C ANISOU15851 CA LYS B 387 7644 9608 7870 -138 1 376 C ATOM 15852 C LYS B 387 37.166 86.037 47.230 1.00 56.53 C ANISOU15852 C LYS B 387 6408 8539 6534 -150 171 348 C ATOM 15853 O LYS B 387 36.508 86.867 46.626 1.00 70.79 O ANISOU15853 O LYS B 387 8261 10390 8246 -178 154 375 O ATOM 15854 CB LYS B 387 39.631 86.398 47.177 1.00 66.39 C ANISOU15854 CB LYS B 387 7528 9649 8050 -294 33 400 C ATOM 15855 CG LYS B 387 40.816 87.198 47.703 1.00 82.65 C ANISOU15855 CG LYS B 387 9612 11573 10220 -312 -153 444 C ATOM 15856 CD LYS B 387 42.041 87.084 46.777 1.00 89.02 C ANISOU15856 CD LYS B 387 10262 12393 11169 -472 -110 465 C ATOM 15857 CE LYS B 387 43.367 87.044 47.557 1.00 77.70 C ANISOU15857 CE LYS B 387 8806 10832 9883 -468 -228 479 C ATOM 15858 NZ LYS B 387 43.843 85.643 47.816 1.00 62.92 N ANISOU15858 NZ LYS B 387 6828 8974 8104 -461 -109 432 N ATOM 15859 H LYS B 387 39.255 85.230 49.348 1.00 76.68 H ATOM 15860 HA LYS B 387 38.245 87.392 48.314 1.00 79.34 H ATOM 15861 HB2 LYS B 387 39.910 85.471 47.106 1.00 79.67 H ATOM 15862 HB3 LYS B 387 39.413 86.741 46.296 1.00 79.67 H ATOM 15863 HG2 LYS B 387 40.568 88.134 47.763 1.00 99.18 H ATOM 15864 HG3 LYS B 387 41.065 86.861 48.578 1.00 99.18 H ATOM 15865 HD2 LYS B 387 41.971 86.267 46.260 1.00106.82 H ATOM 15866 HD3 LYS B 387 42.063 87.852 46.185 1.00106.82 H ATOM 15867 HE2 LYS B 387 44.050 87.503 47.043 1.00 93.24 H ATOM 15868 HE3 LYS B 387 43.244 87.483 48.413 1.00 93.24 H ATOM 15869 HZ1 LYS B 387 44.610 85.662 48.267 1.00 75.50 H ATOM 15870 HZ2 LYS B 387 43.237 85.200 48.293 1.00 75.50 H ATOM 15871 HZ3 LYS B 387 43.971 85.218 47.045 1.00 75.50 H ATOM 15872 N LEU B 388 36.881 84.737 47.212 1.00 50.69 N ANISOU15872 N LEU B 388 5594 7870 5795 -131 333 295 N ATOM 15873 CA LEU B 388 35.733 84.197 46.488 1.00 49.06 C ANISOU15873 CA LEU B 388 5362 7803 5475 -138 505 263 C ATOM 15874 C LEU B 388 34.417 84.885 46.855 1.00 57.45 C ANISOU15874 C LEU B 388 6580 8876 6371 -31 448 267 C ATOM 15875 O LEU B 388 33.486 84.925 46.053 1.00 64.22 O ANISOU15875 O LEU B 388 7432 9844 7125 -60 550 262 O ATOM 15876 CB LEU B 388 35.591 82.696 46.750 1.00 53.38 C ANISOU15876 CB LEU B 388 5837 8400 6045 -98 661 202 C ATOM 15877 CG LEU B 388 36.730 81.773 46.318 1.00 62.76 C ANISOU15877 CG LEU B 388 6858 9601 7388 -200 759 187 C ATOM 15878 CD1 LEU B 388 36.464 80.350 46.800 1.00 56.66 C ANISOU15878 CD1 LEU B 388 6043 8864 6623 -131 892 126 C ATOM 15879 CD2 LEU B 388 36.913 81.801 44.803 1.00 65.12 C ANISOU15879 CD2 LEU B 388 7027 10007 7709 -363 881 202 C ATOM 15880 H LEU B 388 37.346 84.138 47.618 1.00 60.83 H ATOM 15881 HA LEU B 388 35.877 84.320 45.537 1.00 58.87 H ATOM 15882 HB2 LEU B 388 35.475 82.571 47.705 1.00 64.06 H ATOM 15883 HB3 LEU B 388 34.792 82.389 46.293 1.00 64.06 H ATOM 15884 HG LEU B 388 37.555 82.078 46.725 1.00 75.32 H ATOM 15885 HD11 LEU B 388 37.195 79.779 46.517 1.00 68.00 H ATOM 15886 HD12 LEU B 388 36.400 80.352 47.768 1.00 68.00 H ATOM 15887 HD13 LEU B 388 35.631 80.037 46.413 1.00 68.00 H ATOM 15888 HD21 LEU B 388 37.641 81.207 44.563 1.00 78.15 H ATOM 15889 HD22 LEU B 388 36.091 81.506 44.381 1.00 78.15 H ATOM 15890 HD23 LEU B 388 37.120 82.708 44.527 1.00 78.15 H ATOM 15891 N PHE B 389 34.337 85.393 48.079 1.00 60.15 N ANISOU15891 N PHE B 389 7059 9106 6689 94 288 274 N ATOM 15892 CA PHE B 389 33.170 86.119 48.542 1.00 50.37 C ANISOU15892 CA PHE B 389 5976 7860 5301 202 213 279 C ATOM 15893 C PHE B 389 33.400 87.588 48.220 1.00 59.53 C ANISOU15893 C PHE B 389 7197 8969 6452 152 63 341 C ATOM 15894 O PHE B 389 32.615 88.222 47.513 1.00 60.41 O ANISOU15894 O PHE B 389 7341 9148 6463 123 83 361 O ATOM 15895 CB PHE B 389 32.996 85.914 50.051 1.00 33.70 C ANISOU15895 CB PHE B 389 3983 5649 3171 361 115 254 C ATOM 15896 CG PHE B 389 31.781 86.587 50.630 1.00 41.48 C ANISOU15896 CG PHE B 389 5132 6623 4003 483 39 255 C ATOM 15897 CD1 PHE B 389 31.841 87.905 51.067 1.00 48.20 C ANISOU15897 CD1 PHE B 389 6105 7380 4829 518 -150 300 C ATOM 15898 CD2 PHE B 389 30.582 85.899 50.753 1.00 45.26 C ANISOU15898 CD2 PHE B 389 5646 7186 4366 564 157 209 C ATOM 15899 CE1 PHE B 389 30.721 88.531 51.603 1.00 41.54 C ANISOU15899 CE1 PHE B 389 5412 6525 3846 630 -219 300 C ATOM 15900 CE2 PHE B 389 29.461 86.519 51.274 1.00 46.63 C ANISOU15900 CE2 PHE B 389 5968 7349 4398 676 89 209 C ATOM 15901 CZ PHE B 389 29.535 87.842 51.703 1.00 49.11 C ANISOU15901 CZ PHE B 389 6403 7568 4690 709 -100 255 C ATOM 15902 H PHE B 389 34.960 85.326 48.669 1.00 72.18 H ATOM 15903 HA PHE B 389 32.375 85.809 48.081 1.00 60.44 H ATOM 15904 HB2 PHE B 389 32.919 84.964 50.229 1.00 40.44 H ATOM 15905 HB3 PHE B 389 33.775 86.270 50.506 1.00 40.44 H ATOM 15906 HD1 PHE B 389 32.639 88.376 50.995 1.00 57.84 H ATOM 15907 HD2 PHE B 389 30.526 85.018 50.461 1.00 54.32 H ATOM 15908 HE1 PHE B 389 30.772 89.415 51.886 1.00 49.85 H ATOM 15909 HE2 PHE B 389 28.662 86.050 51.349 1.00 55.95 H ATOM 15910 HZ PHE B 389 28.784 88.257 52.064 1.00 58.94 H ATOM 15911 N THR B 390 34.508 88.114 48.726 1.00 61.17 N ANISOU15911 N THR B 390 7415 9057 6768 138 -85 373 N ATOM 15912 CA THR B 390 34.837 89.524 48.576 1.00 64.49 C ANISOU15912 CA THR B 390 7901 9411 7192 99 -247 432 C ATOM 15913 C THR B 390 34.824 89.988 47.122 1.00 55.96 C ANISOU15913 C THR B 390 6736 8424 6102 -46 -176 464 C ATOM 15914 O THR B 390 34.507 91.135 46.836 1.00 63.85 O ANISOU15914 O THR B 390 7809 9411 7040 -61 -270 506 O ATOM 15915 CB THR B 390 36.218 89.824 49.197 1.00 69.71 C ANISOU15915 CB THR B 390 8550 9940 7997 81 -391 458 C ATOM 15916 OG1 THR B 390 36.245 89.329 50.542 1.00 67.31 O ANISOU15916 OG1 THR B 390 8319 9553 7704 214 -450 427 O ATOM 15917 CG2 THR B 390 36.508 91.333 49.204 1.00 69.33 C ANISOU15917 CG2 THR B 390 8588 9809 7943 59 -575 519 C ATOM 15918 H THR B 390 35.095 87.666 49.167 1.00 73.40 H ATOM 15919 HA THR B 390 34.178 90.048 49.057 1.00 77.39 H ATOM 15920 HB THR B 390 36.908 89.382 48.678 1.00 83.66 H ATOM 15921 HG1 THR B 390 36.992 89.487 50.892 1.00 80.78 H ATOM 15922 HG21 THR B 390 37.378 91.501 49.597 1.00 83.19 H ATOM 15923 HG22 THR B 390 36.500 91.676 48.296 1.00 83.19 H ATOM 15924 HG23 THR B 390 35.832 91.798 49.722 1.00 83.19 H ATOM 15925 N ARG B 391 35.172 89.090 46.211 1.00 66.27 N ANISOU15925 N ARG B 391 7887 9822 7470 -153 -10 444 N ATOM 15926 CA ARG B 391 35.219 89.395 44.787 1.00 62.86 C ANISOU15926 CA ARG B 391 7360 9487 7039 -300 74 470 C ATOM 15927 C ARG B 391 33.845 89.770 44.206 1.00 67.92 C ANISOU15927 C ARG B 391 8059 10227 7519 -283 136 472 C ATOM 15928 O ARG B 391 33.756 90.508 43.220 1.00 81.87 O ANISOU15928 O ARG B 391 9803 12044 9260 -381 138 510 O ATOM 15929 CB ARG B 391 35.768 88.185 44.043 1.00 43.72 C ANISOU15929 CB ARG B 391 4760 7145 4705 -401 254 439 C ATOM 15930 CG ARG B 391 35.998 88.419 42.572 1.00 96.93 C ANISOU15930 CG ARG B 391 11384 13978 11466 -565 343 465 C ATOM 15931 CD ARG B 391 36.500 87.156 41.901 1.00115.83 C ANISOU15931 CD ARG B 391 13610 16454 13948 -657 527 428 C ATOM 15932 NE ARG B 391 35.750 85.975 42.333 1.00110.77 N ANISOU15932 NE ARG B 391 12967 15869 13253 -566 657 368 N ATOM 15933 CZ ARG B 391 35.952 84.743 41.873 1.00 99.77 C ANISOU15933 CZ ARG B 391 11441 14554 11914 -620 832 326 C ATOM 15934 NH1 ARG B 391 36.859 84.520 40.929 1.00110.97 N ANISOU15934 NH1 ARG B 391 12715 16009 13441 -767 903 337 N ATOM 15935 NH2 ARG B 391 35.215 83.738 42.330 1.00 75.27 N ANISOU15935 NH2 ARG B 391 8351 11496 8753 -529 939 272 N ATOM 15936 H ARG B 391 35.391 88.279 46.396 1.00 79.52 H ATOM 15937 HA ARG B 391 35.823 90.140 44.641 1.00 75.44 H ATOM 15938 HB2 ARG B 391 36.618 87.935 44.439 1.00 52.46 H ATOM 15939 HB3 ARG B 391 35.138 87.453 44.131 1.00 52.46 H ATOM 15940 HG2 ARG B 391 35.163 88.677 42.152 1.00116.31 H ATOM 15941 HG3 ARG B 391 36.664 89.114 42.456 1.00116.31 H ATOM 15942 HD2 ARG B 391 36.401 87.244 40.940 1.00139.00 H ATOM 15943 HD3 ARG B 391 37.434 87.023 42.130 1.00139.00 H ATOM 15944 HE ARG B 391 35.136 86.086 42.925 1.00132.93 H ATOM 15945 HH11 ARG B 391 37.335 85.170 40.629 1.00133.17 H ATOM 15946 HH12 ARG B 391 36.981 83.723 40.630 1.00133.17 H ATOM 15947 HH21 ARG B 391 34.622 83.880 42.936 1.00 90.33 H ATOM 15948 HH22 ARG B 391 35.338 82.942 42.028 1.00 90.33 H ATOM 15949 N CYS B 392 32.781 89.244 44.803 1.00 56.56 N ANISOU15949 N CYS B 392 6695 8820 5974 -162 189 430 N ATOM 15950 CA CYS B 392 31.424 89.523 44.339 1.00 60.63 C ANISOU15950 CA CYS B 392 7273 9430 6335 -133 251 428 C ATOM 15951 C CYS B 392 30.827 90.783 44.985 1.00 57.33 C ANISOU15951 C CYS B 392 7026 8936 5822 -39 77 461 C ATOM 15952 O CYS B 392 29.664 91.104 44.759 1.00 42.79 O ANISOU15952 O CYS B 392 5254 7157 3846 3 106 461 O ATOM 15953 CB CYS B 392 30.522 88.321 44.627 1.00 60.03 C ANISOU15953 CB CYS B 392 7191 9432 6186 -50 402 365 C ATOM 15954 SG CYS B 392 31.207 86.742 44.105 1.00 63.58 S ANISOU15954 SG CYS B 392 7453 9957 6749 -136 600 318 S ATOM 15955 H CYS B 392 32.818 88.718 45.482 1.00 67.87 H ATOM 15956 HA CYS B 392 31.442 89.659 43.379 1.00 72.76 H ATOM 15957 HB2 CYS B 392 30.364 88.273 45.583 1.00 72.04 H ATOM 15958 HB3 CYS B 392 29.680 88.446 44.162 1.00 72.04 H ATOM 15959 HG CYS B 392 32.243 86.556 44.681 1.00 76.30 H ATOM 15960 N LEU B 393 31.637 91.519 45.744 1.00 76.74 N ANISOU15960 N LEU B 393 9547 11259 8352 -10 -104 492 N ATOM 15961 CA LEU B 393 31.110 92.504 46.702 1.00 82.49 C ANISOU15961 CA LEU B 393 10449 11894 8999 112 -274 511 C ATOM 15962 C LEU B 393 31.232 93.968 46.324 1.00 85.35 C ANISOU15962 C LEU B 393 10873 12213 9344 63 -414 574 C ATOM 15963 O LEU B 393 30.293 94.725 46.503 1.00 90.38 O ANISOU15963 O LEU B 393 11629 12848 9863 131 -476 588 O ATOM 15964 CB LEU B 393 31.801 92.374 48.048 1.00 74.43 C ANISOU15964 CB LEU B 393 9489 10739 8054 207 -400 500 C ATOM 15965 CG LEU B 393 31.356 91.284 48.999 1.00 63.31 C ANISOU15965 CG LEU B 393 8108 9328 6618 330 -338 442 C ATOM 15966 CD1 LEU B 393 32.195 91.412 50.246 1.00 74.99 C ANISOU15966 CD1 LEU B 393 9648 10661 8183 404 -492 445 C ATOM 15967 CD2 LEU B 393 29.891 91.399 49.341 1.00 53.54 C ANISOU15967 CD2 LEU B 393 6991 8133 5218 446 -319 420 C ATOM 15968 H LEU B 393 32.495 91.470 45.727 1.00 92.09 H ATOM 15969 HA LEU B 393 30.168 92.319 46.839 1.00 98.99 H ATOM 15970 HB2 LEU B 393 32.745 92.230 47.882 1.00 89.32 H ATOM 15971 HB3 LEU B 393 31.690 93.216 48.518 1.00 89.32 H ATOM 15972 HG LEU B 393 31.518 90.414 48.601 1.00 75.97 H ATOM 15973 HD11 LEU B 393 31.931 90.723 50.875 1.00 89.99 H ATOM 15974 HD12 LEU B 393 33.129 91.304 50.009 1.00 89.99 H ATOM 15975 HD13 LEU B 393 32.050 92.289 50.634 1.00 89.99 H ATOM 15976 HD21 LEU B 393 29.652 90.683 49.950 1.00 64.25 H ATOM 15977 HD22 LEU B 393 29.732 92.259 49.762 1.00 64.25 H ATOM 15978 HD23 LEU B 393 29.370 91.329 48.525 1.00 64.25 H ATOM 15979 N THR B 394 32.375 94.400 45.816 1.00 90.51 N ANISOU15979 N THR B 394 11448 12828 10112 -55 -468 613 N ATOM 15980 CA THR B 394 32.543 95.832 45.601 1.00100.27 C ANISOU15980 CA THR B 394 12755 14007 11337 -90 -620 673 C ATOM 15981 C THR B 394 31.839 96.316 44.311 1.00102.50 C ANISOU15981 C THR B 394 13003 14402 11538 -185 -541 700 C ATOM 15982 O THR B 394 31.728 97.535 44.101 1.00100.61 O ANISOU15982 O THR B 394 12826 14127 11274 -214 -659 750 O ATOM 15983 CB THR B 394 34.051 96.251 45.657 1.00106.02 C ANISOU15983 CB THR B 394 13430 14636 12219 -172 -734 709 C ATOM 15984 OG1 THR B 394 34.706 95.567 46.736 1.00 93.53 O ANISOU15984 OG1 THR B 394 11850 12968 10721 -100 -773 679 O ATOM 15985 CG2 THR B 394 34.199 97.768 45.859 1.00 97.19 C ANISOU15985 CG2 THR B 394 12421 13423 11083 -166 -929 766 C ATOM 15986 H THR B 394 33.046 93.910 45.594 1.00108.61 H ATOM 15987 HA THR B 394 32.099 96.292 46.331 1.00120.33 H ATOM 15988 HB THR B 394 34.480 96.013 44.820 1.00127.23 H ATOM 15989 HG1 THR B 394 35.515 95.790 46.769 1.00112.24 H ATOM 15990 HG21 THR B 394 35.138 98.008 45.891 1.00116.62 H ATOM 15991 HG22 THR B 394 33.777 98.243 45.126 1.00116.62 H ATOM 15992 HG23 THR B 394 33.777 98.034 46.691 1.00116.62 H ATOM 15993 N PRO B 395 31.324 95.387 43.462 1.00102.92 N ANISOU15993 N PRO B 395 12964 14594 11548 -231 -346 667 N ATOM 15994 CA PRO B 395 31.079 95.908 42.121 1.00108.28 C ANISOU15994 CA PRO B 395 13579 15368 12196 -359 -282 701 C ATOM 15995 C PRO B 395 29.985 96.972 42.004 1.00111.24 C ANISOU15995 C PRO B 395 14077 15758 12431 -311 -350 731 C ATOM 15996 O PRO B 395 30.203 97.958 41.297 1.00101.62 O ANISOU15996 O PRO B 395 12856 14539 11217 -399 -413 783 O ATOM 15997 CB PRO B 395 30.647 94.640 41.388 1.00106.16 C ANISOU15997 CB PRO B 395 13191 15240 11907 -405 -59 654 C ATOM 15998 CG PRO B 395 29.865 93.933 42.366 1.00 93.78 C ANISOU15998 CG PRO B 395 11699 13666 10269 -259 -27 604 C ATOM 15999 CD PRO B 395 30.561 94.134 43.653 1.00 99.37 C ANISOU15999 CD PRO B 395 12483 14226 11047 -168 -185 605 C ATOM 16000 HA PRO B 395 31.909 96.241 41.744 1.00129.94 H ATOM 16001 HB2 PRO B 395 30.109 94.872 40.614 1.00127.40 H ATOM 16002 HB3 PRO B 395 31.427 94.125 41.128 1.00127.40 H ATOM 16003 HG2 PRO B 395 28.971 94.307 42.400 1.00112.54 H ATOM 16004 HG3 PRO B 395 29.834 92.990 42.138 1.00112.54 H ATOM 16005 HD2 PRO B 395 29.918 94.206 44.375 1.00119.24 H ATOM 16006 HD3 PRO B 395 31.191 93.413 43.810 1.00119.24 H ATOM 16007 N LEU B 396 28.874 96.762 42.719 1.00109.92 N ANISOU16007 N LEU B 396 14016 15601 12149 -175 -339 699 N ATOM 16008 CA LEU B 396 27.618 97.523 42.610 1.00100.46 C ANISOU16008 CA LEU B 396 12930 14438 10801 -116 -366 715 C ATOM 16009 C LEU B 396 26.469 96.549 42.851 1.00 89.41 C ANISOU16009 C LEU B 396 11549 13125 9297 -24 -228 659 C ATOM 16010 O LEU B 396 26.296 95.591 42.090 1.00 88.68 O ANISOU16010 O LEU B 396 11341 13147 9204 -89 -50 629 O ATOM 16011 CB LEU B 396 27.416 98.186 41.237 1.00110.70 C ANISOU16011 CB LEU B 396 14171 15824 12064 -246 -322 759 C ATOM 16012 CG LEU B 396 27.535 99.721 41.102 1.00115.97 C ANISOU16012 CG LEU B 396 14924 16423 12716 -270 -491 825 C ATOM 16013 CD1 LEU B 396 26.172 100.383 41.333 1.00102.01 C ANISOU16013 CD1 LEU B 396 13293 14673 10792 -170 -530 832 C ATOM 16014 CD2 LEU B 396 28.586 100.372 42.029 1.00109.33 C ANISOU16014 CD2 LEU B 396 14142 15423 11974 -238 -683 849 C ATOM 16015 H LEU B 396 28.822 96.142 43.313 1.00131.91 H ATOM 16016 HA LEU B 396 27.591 98.210 43.294 1.00120.55 H ATOM 16017 HB2 LEU B 396 28.069 97.804 40.630 1.00132.84 H ATOM 16018 HB3 LEU B 396 26.527 97.950 40.927 1.00132.84 H ATOM 16019 HG LEU B 396 27.798 99.922 40.191 1.00139.16 H ATOM 16020 HD11 LEU B 396 26.269 101.344 41.244 1.00122.41 H ATOM 16021 HD12 LEU B 396 25.544 100.051 40.672 1.00122.41 H ATOM 16022 HD13 LEU B 396 25.861 100.163 42.225 1.00122.41 H ATOM 16023 HD21 LEU B 396 28.591 101.330 41.877 1.00131.19 H ATOM 16024 HD22 LEU B 396 28.352 100.185 42.952 1.00131.19 H ATOM 16025 HD23 LEU B 396 29.459 100.000 41.827 1.00131.19 H TER 16026 LEU B 396 HETATM16027 O1 MES A1101 27.388 127.786 99.237 1.00 71.87 O HETATM16028 C2 MES A1101 28.650 128.172 98.676 1.00 72.95 C HETATM16029 C3 MES A1101 28.530 129.392 97.730 1.00 67.89 C HETATM16030 N4 MES A1101 27.926 130.534 98.415 1.00 59.65 N HETATM16031 C5 MES A1101 27.289 130.201 99.684 1.00 69.20 C HETATM16032 C6 MES A1101 26.511 128.912 99.392 1.00 66.97 C HETATM16033 C7 MES A1101 28.745 131.751 98.432 1.00 64.66 C HETATM16034 C8 MES A1101 28.464 132.606 97.177 1.00 57.78 C HETATM16035 S MES A1101 29.837 133.517 96.787 1.00127.24 S HETATM16036 O1S MES A1101 29.571 134.496 95.697 1.00 94.27 O HETATM16037 O2S MES A1101 30.917 132.624 96.284 1.00118.07 O HETATM16038 O3S MES A1101 30.320 134.284 97.977 1.00124.59 O HETATM16039 H21 MES A1101 29.331 128.422 99.492 1.00 87.54 H HETATM16040 H22 MES A1101 29.079 127.329 98.130 1.00 87.54 H HETATM16041 H31 MES A1101 27.937 129.131 96.850 1.00 81.47 H HETATM16042 H32 MES A1101 29.530 129.669 97.390 1.00 81.47 H HETATM16043 HN4 MES A1101 27.150 130.782 97.821 1.00 71.58 H HETATM16044 H51 MES A1101 28.037 130.036 100.462 1.00 83.05 H HETATM16045 H52 MES A1101 26.612 130.999 99.998 1.00 83.05 H HETATM16046 H61 MES A1101 25.808 128.722 100.206 1.00 80.37 H HETATM16047 H62 MES A1101 25.923 129.045 98.482 1.00 80.37 H HETATM16048 H71 MES A1101 28.520 132.332 99.329 1.00 77.59 H HETATM16049 H72 MES A1101 29.803 131.481 98.462 1.00 77.59 H HETATM16050 H81 MES A1101 28.203 131.955 96.339 1.00 69.34 H HETATM16051 H82 MES A1101 27.620 133.272 97.366 1.00 69.34 H CONECT160271602816032 CONECT1602816027160291603916040 CONECT1602916028160301604116042 CONECT1603016029160311603316043 CONECT1603116030160321604416045 CONECT1603216027160311604616047 CONECT1603316030160341604816049 CONECT1603416033160351605016051 CONECT1603516034160361603716038 CONECT1603616035 CONECT1603716035 CONECT1603816035 CONECT1603916028 CONECT1604016028 CONECT1604116029 CONECT1604216029 CONECT1604316030 CONECT1604416031 CONECT1604516031 CONECT1604616032 CONECT1604716032 CONECT1604816033 CONECT1604916033 CONECT1605016034 CONECT1605116034 MASTER 526 0 1 60 0 0 2 6 7986 2 25 89 END