>>4Q29:HELIX    1   1 ASP A    9  MSE A   13  5                                   5    
DWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQDNIIRKDWDSVHEYDLDGSRLLPWEGLNTPFGGAWCIVRPETKSFRHSHNEYELFIVIQGNAIIRINDEDFPVTKGDLIIIPLDSEHHVINNNQEDFHFYTIWWDKESTLNFLTRLEQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 1 1 ASP A 9 MSE A 13 5 5 ATOM 176 N ASP A 9 0.834 42.505 47.332 0.05 14.07 N ANISOU 176 N ASP A 9 1946 1148 2250 80 278 -42 N ATOM 177 CA ASP A 9 -0.214 41.532 46.959 0.05 14.56 C ANISOU 177 CA ASP A 9 1936 1233 2363 48 316 -52 C ATOM 178 C ASP A 9 -0.146 41.410 45.433 0.05 14.19 C ANISOU 178 C ASP A 9 1859 1178 2356 40 248 -44 C ATOM 179 O ASP A 9 -0.571 42.307 44.752 0.05 14.23 O ANISOU 179 O ASP A 9 1818 1191 2398 74 203 -59 O ATOM 180 CB ASP A 9 -1.586 42.068 47.438 0.05 15.23 C ANISOU 180 CB ASP A 9 1954 1346 2489 81 356 -96 C ATOM 181 CG ASP A 9 -2.757 41.384 46.742 0.05 15.86 C ANISOU 181 CG ASP A 9 1933 1457 2636 53 385 -115 C ATOM 182 OD1 ASP A 9 -3.951 41.640 47.015 0.05 16.61 O ANISOU 182 OD1 ASP A 9 1964 1582 2765 73 440 -153 O ATOM 183 OD2 ASP A 9 -2.446 40.551 45.894 0.05 15.70 O ANISOU 183 OD2 ASP A 9 1893 1435 2638 13 353 -99 O ATOM 184 H ASP A 9 0.644 43.300 47.099 0.05 13.86 H ANISOU 184 H ASP A 9 1911 1113 2241 102 239 -48 H ATOM 185 HA ASP A 9 -0.055 40.673 47.372 0.05 14.74 H ANISOU 185 HA ASP A 9 1978 1256 2368 14 356 -36 H ATOM 186 HB2 ASP A 9 -1.665 41.919 48.393 0.05 15.52 H ANISOU 186 HB2 ASP A 9 2016 1389 2490 79 407 -103 H ATOM 187 HB3 ASP A 9 -1.639 43.020 47.244 0.05 15.11 H ANISOU 187 HB3 ASP A 9 1931 1321 2488 121 319 -108 H ATOM 188 N TRP A 10 0.339 40.291 44.882 0.05 13.92 N ANISOU 188 N TRP A 10 1856 1125 2308 -1 238 -19 N ATOM 189 CA TRP A 10 0.452 40.226 43.416 0.05 13.68 C ANISOU 189 CA TRP A 10 1802 1091 2303 -13 178 -21 C ATOM 190 C TRP A 10 -0.885 40.274 42.663 0.05 14.25 C ANISOU 190 C TRP A 10 1784 1197 2432 -29 177 -48 C ATOM 191 O TRP A 10 -0.968 40.752 41.525 0.05 14.24 O ANISOU 191 O TRP A 10 1747 1212 2453 -10 115 -58 O ATOM 192 CB TRP A 10 1.185 38.932 43.023 0.05 13.53 C ANISOU 192 CB TRP A 10 1824 1045 2273 -58 184 -3 C ATOM 193 CG TRP A 10 2.441 38.720 43.777 0.05 13.19 C ANISOU 193 CG TRP A 10 1864 971 2178 -45 195 29 C ATOM 194 CD1 TRP A 10 2.614 37.899 44.826 0.05 13.49 C ANISOU 194 CD1 TRP A 10 1944 991 2191 -63 248 54 C ATOM 195 CD2 TRP A 10 3.701 39.353 43.550 0.05 12.65 C ANISOU 195 CD2 TRP A 10 1839 890 2077 -11 150 40 C ATOM 196 NE1 TRP A 10 3.909 37.925 45.235 0.05 13.18 N ANISOU 196 NE1 TRP A 10 1971 932 2106 -37 228 80 N ATOM 197 CE2 TRP A 10 4.606 38.827 44.478 0.05 12.65 C ANISOU 197 CE2 TRP A 10 1900 870 2038 -7 170 68 C ATOM 198 CE3 TRP A 10 4.156 40.302 42.637 0.05 12.27 C ANISOU 198 CE3 TRP A 10 1785 847 2029 13 96 32 C ATOM 199 CZ2 TRP A 10 5.942 39.231 44.529 0.05 12.29 C ANISOU 199 CZ2 TRP A 10 1893 816 1961 21 133 79 C ATOM 200 CZ3 TRP A 10 5.490 40.683 42.677 0.05 11.90 C ANISOU 200 CZ3 TRP A 10 1782 786 1951 33 71 44 C ATOM 201 CH2 TRP A 10 6.361 40.152 43.612 0.05 11.91 C ANISOU 201 CH2 TRP A 10 1829 774 1922 37 87 63 C ATOM 202 H TRP A 10 0.599 39.608 45.324 0.05 13.93 H ANISOU 202 H TRP A 10 1894 1114 2285 -20 264 -3 H ATOM 203 HA TRP A 10 0.982 40.969 43.100 0.05 13.36 H ANISOU 203 HA TRP A 10 1775 1047 2254 15 135 -18 H ATOM 204 HB2 TRP A 10 0.599 38.188 43.192 0.05 13.95 H ANISOU 204 HB2 TRP A 10 1855 1100 2344 -91 224 -8 H ATOM 205 HB3 TRP A 10 1.411 38.986 42.085 0.05 13.37 H ANISOU 205 HB3 TRP A 10 1796 1024 2261 -64 145 -9 H ATOM 206 HD1 TRP A 10 1.956 37.343 45.179 0.05 13.92 H ANISOU 206 HD1 TRP A 10 1985 1046 2258 -92 291 55 H ATOM 207 HE1 TRP A 10 4.226 37.474 45.896 0.05 13.36 H ANISOU 207 HE1 TRP A 10 2030 943 2104 -40 249 103 H ATOM 208 HE3 TRP A 10 3.583 40.641 41.996 0.05 12.33 H ANISOU 208 HE3 TRP A 10 1760 869 2058 14 76 20 H ATOM 209 HZ2 TRP A 10 6.524 38.871 45.158 0.05 12.38 H ANISOU 209 HZ2 TRP A 10 1939 817 1946 28 138 98 H ATOM 210 HZ3 TRP A 10 5.807 41.310 42.070 0.05 11.70 H ANISOU 210 HZ3 TRP A 10 1756 764 1927 42 41 40 H ATOM 211 HH2 TRP A 10 7.247 40.442 43.621 0.05 11.72 H ANISOU 211 HH2 TRP A 10 1825 746 1883 50 66 68 H ATOM 212 N ASP A 11 -1.945 39.831 43.317 0.05 14.86 N ANISOU 212 N ASP A 11 1821 1290 2536 -64 242 -62 N ATOM 213 CA ASP A 11 -3.233 39.792 42.641 0.05 15.46 C ANISOU 213 CA ASP A 11 1794 1406 2675 -74 225 -94 C ATOM 214 C ASP A 11 -3.774 41.178 42.346 0.05 15.77 C ANISOU 214 C ASP A 11 1770 1475 2748 -5 201 -115 C ATOM 215 O ASP A 11 -4.592 41.351 41.438 0.05 16.38 O ANISOU 215 O ASP A 11 1752 1590 2882 0 174 -141 O ATOM 216 CB ASP A 11 -4.246 38.967 43.460 0.05 16.17 C ANISOU 216 CB ASP A 11 1842 1506 2796 -138 301 -108 C ATOM 217 CG ASP A 11 -5.575 38.785 42.750 0.05 16.90 C ANISOU 217 CG ASP A 11 1819 1643 2959 -164 282 -147 C ATOM 218 OD1 ASP A 11 -5.561 38.257 41.628 0.05 16.87 O ANISOU 218 OD1 ASP A 11 1799 1642 2968 -192 220 -158 O ATOM 219 OD2 ASP A 11 -6.621 39.151 43.302 0.05 17.60 O ANISOU 219 OD2 ASP A 11 1829 1767 3089 -157 329 -173 O ATOM 220 H ASP A 11 -1.957 39.597 44.141 0.05 15.00 H ANISOU 220 H ASP A 11 1863 1300 2538 -80 291 -53 H ATOM 221 HA ASP A 11 -3.109 39.355 41.783 0.05 15.33 H ANISOU 221 HA ASP A 11 1773 1389 2664 -88 177 -96 H ATOM 222 HB2 ASP A 11 -3.853 38.094 43.577 0.05 16.00 H ANISOU 222 HB2 ASP A 11 1868 1455 2756 -175 311 -91 H ATOM 223 HB3 ASP A 11 -4.405 39.368 44.327 0.05 16.40 H ANISOU 223 HB3 ASP A 11 1873 1540 2816 -129 356 -108 H ATOM 224 N SER A 12 -3.260 42.158 43.086 0.05 15.48 N ANISOU 224 N SER A 12 1782 1418 2680 49 206 -107 N ATOM 225 CA SER A 12 -3.851 43.500 42.972 0.05 15.87 C ANISOU 225 CA SER A 12 1774 1481 2774 119 173 -127 C ATOM 226 C SER A 12 -3.202 44.311 41.877 0.05 15.39 C ANISOU 226 C SER A 12 1756 1395 2698 161 85 -102 C ATOM 227 O SER A 12 -3.624 45.458 41.589 0.05 15.70 O ANISOU 227 O SER A 12 1774 1425 2768 226 54 -107 O ATOM 228 CB SER A 12 -3.883 44.210 44.312 0.05 16.36 C ANISOU 228 CB SER A 12 1822 1548 2848 156 246 -156 C ATOM 229 OG SER A 12 -5.098 43.812 44.954 0.05 17.10 O ANISOU 229 OG SER A 12 1842 1680 2974 115 322 -183 O ATOM 230 H SER A 12 -2.605 42.088 43.638 0.05 15.15 H ANISOU 230 H SER A 12 1801 1356 2600 49 224 -93 H ATOM 231 HA SER A 12 -4.780 43.403 42.712 0.05 16.35 H ANISOU 231 HA SER A 12 1761 1571 2880 115 158 -143 H ATOM 232 HB2 SER A 12 -3.192 43.877 44.870 0.05 16.06 H ANISOU 232 HB2 SER A 12 1850 1490 2763 153 273 -149 H ATOM 233 HB3 SER A 12 -3.842 45.173 44.216 0.05 16.62 H ANISOU 233 HB3 SER A 12 1823 1578 2912 208 218 -168 H ATOM 234 HG SER A 12 -4.975 43.789 45.783 0.05 16.96 H ANISOU 234 HG SER A 12 1867 1655 2920 80 362 -172 H HETATM 235 N MSE A 13 -2.197 43.758 41.245 0.05 14.78 N ANISOU 235 N MSE A 13 1737 1303 2578 126 47 -75 N HETATM 236 CA MSE A 13 -1.513 44.411 40.132 0.05 14.46 C ANISOU 236 CA MSE A 13 1732 1246 2517 151 -31 -48 C HETATM 237 C MSE A 13 -2.535 44.823 39.085 0.05 15.12 C ANISOU 237 C MSE A 13 1738 1363 2646 178 -95 -53 C HETATM 238 O MSE A 13 -3.537 44.172 38.844 0.05 15.71 O ANISOU 238 O MSE A 13 1728 1480 2763 158 -90 -79 O HETATM 239 CB MSE A 13 -0.483 43.465 39.544 0.05 13.87 C ANISOU 239 CB MSE A 13 1718 1160 2392 101 -46 -30 C HETATM 240 CG MSE A 13 0.729 43.387 40.426 0.05 13.29 C ANISOU 240 CG MSE A 13 1723 1051 2275 97 -10 -17 C HETATM 241 SE MSE A 13 2.052 42.146 39.783 0.05 12.75 SE ANISOU 241 SE MSE A 13 1712 968 2163 44 -15 -3 SE HETATM 242 CE MSE A 13 3.613 43.150 40.404 0.05 12.19 C ANISOU 242 CE MSE A 13 1718 863 2050 75 -28 19 C HETATM 243 H MSE A 13 -1.850 43.007 41.453 0.05 14.59 H ANISOU 243 H MSE A 13 1735 1275 2533 87 70 -71 H HETATM 244 HA MSE A 13 -1.050 45.186 40.468 0.05 14.31 H ANISOU 244 HA MSE A 13 1749 1201 2487 182 -30 -41 H HETATM 245 HB2 MSE A 13 -0.896 42.587 39.523 0.05 14.02 H ANISOU 245 HB2 MSE A 13 1712 1194 2421 63 -26 -43 H HETATM 246 HB3 MSE A 13 -0.232 43.725 38.651 0.05 13.83 H ANISOU 246 HB3 MSE A 13 1721 1158 2376 106 -95 -18 H HETATM 247 HG2 MSE A 13 1.134 44.266 40.495 0.05 13.17 H ANISOU 247 HG2 MSE A 13 1732 1019 2252 127 -29 -8 H HETATM 248 HG3 MSE A 13 0.470 43.079 41.307 0.05 13.40 H ANISOU 248 HG3 MSE A 13 1733 1065 2292 92 36 -26 H HETATM 249 HE1 MSE A 13 4.279 43.148 39.706 0.05 11.98 H ANISOU 249 HE1 MSE A 13 1713 834 2007 62 -47 27 H HETATM 250 HE2 MSE A 13 3.319 44.057 40.585 0.05 12.32 H ANISOU 250 HE2 MSE A 13 1727 877 2077 102 -46 21 H HETATM 251 HE3 MSE A 13 3.969 42.767 41.216 0.05 12.10 H ANISOU 251 HE3 MSE A 13 1727 842 2027 76 1 19 H ATOM 252 N VAL A 14 -2.253 45.981 38.483 0.05 15.14 N ANISOU 252 N VAL A 14 1769 1343 2640 228 -156 -25 N ATOM 253 CA VAL A 14 -3.055 46.544 37.413 0.05 15.82 C ANISOU 253 CA VAL A 14 1802 1455 2755 267 -235 -12 C ATOM 254 C VAL A 14 -2.367 46.230 36.099 0.05 15.57 C ANISOU 254 C VAL A 14 1825 1430 2662 238 -299 21 C ATOM 255 O VAL A 14 -1.188 46.513 35.923 0.05 15.01 O ANISOU 255 O VAL A 14 1840 1321 2542 230 -296 49 O ATOM 256 CB VAL A 14 -3.192 48.100 37.523 0.05 16.32 C ANISOU 256 CB VAL A 14 1857 1481 2863 354 -251 -2 C ATOM 257 CG1 VAL A 14 -4.121 48.633 36.427 0.05 17.00 C ANISOU 257 CG1 VAL A 14 1925 1574 2961 405 -351 37 C ATOM 258 CG2 VAL A 14 -3.668 48.532 38.908 0.05 16.87 C ANISOU 258 CG2 VAL A 14 1842 1567 3000 380 -187 -51 C ATOM 259 H VAL A 14 -1.573 46.451 38.690 0.05 14.81 H ANISOU 259 H VAL A 14 1781 1270 2574 238 -153 -10 H ATOM 260 HA VAL A 14 -3.938 46.145 37.408 0.05 16.25 H ANISOU 260 HA VAL A 14 1787 1547 2841 254 -235 -36 H ATOM 261 HB VAL A 14 -2.318 48.494 37.384 0.05 15.91 H ANISOU 261 HB VAL A 14 1871 1388 2788 359 -232 11 H ATOM 262 HG11 VAL A 14 -4.469 49.501 36.693 0.05 17.57 H ANISOU 262 HG11 VAL A 14 1956 1635 3085 463 -357 31 H ATOM 263 HG12 VAL A 14 -3.629 48.707 35.594 0.05 16.72 H ANISOU 263 HG12 VAL A 14 1960 1506 2885 405 -372 71 H ATOM 264 HG13 VAL A 14 -4.855 48.008 36.317 0.05 17.23 H ANISOU 264 HG13 VAL A 14 1914 1649 2984 381 -386 33 H ATOM 265 HG21 VAL A 14 -3.898 49.474 38.892 0.05 17.41 H ANISOU 265 HG21 VAL A 14 1882 1621 3110 440 -207 -50 H ATOM 266 HG22 VAL A 14 -4.447 48.005 39.148 0.05 17.13 H ANISOU 266 HG22 VAL A 14 1814 1645 3051 351 -184 -70 H ATOM 267 HG23 VAL A 14 -2.962 48.376 39.556 0.05 16.49 H ANISOU 267 HG23 VAL A 14 1831 1500 2935 363 -127 -64 H ATOM 268 N HIS A 15 -3.108 45.623 35.188 0.05 16.07 N ANISOU 268 N HIS A 15 1834 1547 2727 214 -352 10 N ATOM 269 CA HIS A 15 -2.603 45.326 33.873 0.05 16.05 C ANISOU 269 CA HIS A 15 1877 1564 2658 184 -413 32 C ATOM 270 C HIS A 15 -2.605 46.584 33.025 0.05 16.54 C ANISOU 270 C HIS A 15 1966 1616 2703 246 -491 85 C ATOM 271 O HIS A 15 -3.652 47.188 32.857 0.05 17.41 O ANISOU 271 O HIS A 15 2008 1753 2855 297 -551 92 O ATOM 272 CB HIS A 15 -3.466 44.215 33.216 0.05 16.58 C ANISOU 272 CB HIS A 15 1875 1696 2730 132 -446 -8 C ATOM 273 CG HIS A 15 -2.840 43.655 31.990 0.05 16.52 C ANISOU 273 CG HIS A 15 1925 1709 2643 85 -488 -3 C ATOM 274 ND1 HIS A 15 -1.854 42.687 32.050 0.05 15.85 N ANISOU 274 ND1 HIS A 15 1902 1600 2518 25 -433 -22 N ATOM 275 CD2 HIS A 15 -3.052 43.901 30.675 0.05 17.15 C ANISOU 275 CD2 HIS A 15 2014 1832 2671 90 -578 15 C ATOM 276 CE1 HIS A 15 -1.450 42.418 30.826 0.05 16.04 C ANISOU 276 CE1 HIS A 15 1970 1651 2472 -4 -479 -21 C ATOM 277 NE2 HIS A 15 -2.171 43.123 29.971 0.05 16.83 N ANISOU 277 NE2 HIS A 15 2042 1796 2557 30 -567 2 N ATOM 278 H HIS A 15 -3.918 45.374 35.315 0.05 16.50 H ANISOU 278 H HIS A 15 1821 1630 2818 213 -352 -13 H ATOM 279 HA HIS A 15 -1.692 45.029 33.935 0.05 15.47 H ANISOU 279 HA HIS A 15 1865 1467 2547 156 -383 38 H ATOM 280 HB2 HIS A 15 -3.585 43.501 33.852 0.05 16.40 H ANISOU 280 HB2 HIS A 15 1830 1670 2730 98 -392 -38 H ATOM 281 HB3 HIS A 15 -4.325 44.579 32.965 0.05 17.26 H ANISOU 281 HB3 HIS A 15 1897 1812 2847 163 -492 -10 H ATOM 282 HD2 HIS A 15 -3.661 44.502 30.317 0.05 17.76 H ANISOU 282 HD2 HIS A 15 2057 1931 2758 130 -637 34 H ATOM 283 HE1 HIS A 15 -0.797 41.798 30.603 0.05 15.75 H ANISOU 283 HE1 HIS A 15 1975 1605 2403 -42 -453 -36 H ATOM 284 N GLU A 16 -1.432 46.959 32.545 0.05 16.06 N ANISOU 284 N GLU A 16 2003 1514 2585 239 -485 124 N ATOM 285 CA GLU A 16 -1.303 48.115 31.634 0.05 16.54 C ANISOU 285 CA GLU A 16 2116 1551 2617 285 -548 187 C ATOM 286 C GLU A 16 -0.034 48.000 30.775 0.05 16.08 C ANISOU 286 C GLU A 16 2153 1482 2473 233 -536 212 C ATOM 287 O GLU A 16 0.949 47.428 31.176 0.05 15.29 O ANISOU 287 O GLU A 16 2084 1369 2357 184 -469 184 O ATOM 288 CB GLU A 16 -1.404 49.477 32.388 0.05 16.68 C ANISOU 288 CB GLU A 16 2148 1498 2693 355 -532 212 C ATOM 289 CG GLU A 16 -0.407 49.611 33.462 0.05 15.94 C ANISOU 289 CG GLU A 16 2073 1358 2624 342 -444 179 C ATOM 290 CD GLU A 16 -0.485 50.954 34.259 0.05 16.02 C ANISOU 290 CD GLU A 16 2141 1287 2658 388 -429 206 C ATOM 291 OE1 GLU A 16 -0.038 51.998 33.739 0.05 16.47 O ANISOU 291 OE1 GLU A 16 2253 1309 2694 410 -478 264 O ATOM 292 OE2 GLU A 16 -0.973 50.939 35.411 0.05 15.71 O ANISOU 292 OE2 GLU A 16 2094 1219 2656 395 -366 167 O ATOM 293 H GLU A 16 -0.686 46.567 32.699 0.05 15.51 H ANISOU 293 H GLU A 16 1973 1429 2493 207 -444 117 H ATOM 294 HA GLU A 16 -2.051 48.082 31.019 0.05 17.18 H ANISOU 294 HA GLU A 16 2163 1670 2696 301 -609 196 H ATOM 295 HB2 GLU A 16 -1.253 50.187 31.745 0.05 16.85 H ANISOU 295 HB2 GLU A 16 2228 1492 2684 366 -559 256 H ATOM 296 HB3 GLU A 16 -2.280 49.575 32.791 0.05 17.25 H ANISOU 296 HB3 GLU A 16 2159 1581 2814 400 -559 205 H ATOM 297 HG2 GLU A 16 -0.517 48.886 34.097 0.05 16.03 H ANISOU 297 HG2 GLU A 16 2026 1385 2680 355 -421 144 H ATOM 298 HG3 GLU A 16 0.471 49.549 33.058 0.05 15.37 H ANISOU 298 HG3 GLU A 16 2034 1294 2513 292 -414 170 H ATOM 299 N TYR A 17 -0.091 48.524 29.546 0.05 16.71 N ANISOU 299 N TYR A 17 2280 1569 2498 248 -602 268 N ATOM 300 CA TYR A 17 0.985 48.376 28.570 0.05 16.51 C ANISOU 300 CA TYR A 17 2344 1546 2385 197 -591 294 C ATOM 301 C TYR A 17 1.328 46.921 28.348 0.05 16.16 C ANISOU 301 C TYR A 17 2288 1555 2295 126 -565 237 C ATOM 302 O TYR A 17 2.461 46.584 28.029 0.05 15.72 O ANISOU 302 O TYR A 17 2289 1495 2190 78 -518 230 O ATOM 303 CB TYR A 17 2.294 49.087 28.975 0.05 15.90 C ANISOU 303 CB TYR A 17 2330 1394 2319 191 -523 313 C ATOM 304 CG TYR A 17 2.245 50.596 29.073 0.05 16.50 C ANISOU 304 CG TYR A 17 2439 1405 2423 251 -554 375 C ATOM 305 CD1 TYR A 17 1.600 51.375 28.115 0.05 17.17 C ANISOU 305 CD1 TYR A 17 2601 1477 2446 250 -594 448 C ATOM 306 CD2 TYR A 17 2.872 51.241 30.131 0.05 16.52 C ANISOU 306 CD2 TYR A 17 2402 1360 2515 309 -542 361 C ATOM 307 CE1 TYR A 17 1.586 52.820 28.214 0.05 17.83 C ANISOU 307 CE1 TYR A 17 2724 1488 2562 305 -622 511 C ATOM 308 CE2 TYR A 17 2.882 52.665 30.250 0.05 17.17 C ANISOU 308 CE2 TYR A 17 2519 1371 2633 367 -568 413 C ATOM 309 CZ TYR A 17 2.215 53.402 29.300 0.05 17.83 C ANISOU 309 CZ TYR A 17 2681 1433 2659 365 -611 490 C ATOM 310 OH TYR A 17 2.223 54.756 29.362 0.05 18.60 O ANISOU 310 OH TYR A 17 2827 1447 2792 420 -638 551 O ATOM 311 H TYR A 17 -0.776 48.946 29.249 0.05 17.32 H ANISOU 311 H TYR A 17 2338 1655 2588 286 -654 291 H ATOM 312 HA TYR A 17 0.691 48.736 27.722 0.05 17.14 H ANISOU 312 HA TYR A 17 2450 1638 2424 211 -644 336 H ATOM 313 HB2 TYR A 17 2.604 48.775 29.838 0.05 15.40 H ANISOU 313 HB2 TYR A 17 2239 1315 2299 190 -479 277 H ATOM 314 HB3 TYR A 17 2.964 48.889 28.303 0.05 15.74 H ANISOU 314 HB3 TYR A 17 2355 1379 2245 150 -502 319 H ATOM 315 HD1 TYR A 17 1.178 50.963 27.395 0.05 17.23 H ANISOU 315 HD1 TYR A 17 2638 1521 2387 210 -598 455 H ATOM 316 HD2 TYR A 17 3.310 50.738 30.778 0.05 16.15 H ANISOU 316 HD2 TYR A 17 2307 1324 2503 307 -511 315 H ATOM 317 HE1 TYR A 17 1.158 53.335 27.574 0.05 18.35 H ANISOU 317 HE1 TYR A 17 2848 1541 2583 301 -647 566 H ATOM 318 HE2 TYR A 17 3.302 53.077 30.968 0.05 17.24 H ANISOU 318 HE2 TYR A 17 2502 1346 2703 407 -556 396 H ATOM 319 HH TYR A 17 1.652 55.050 28.822 0.05 19.06 H ANISOU 319 HH TYR A 17 2847 1507 2889 473 -676 555 H ATOM 320 N ASP A 18 0.337 46.071 28.557 0.05 16.48 N ANISOU 320 N ASP A 18 2251 1648 2364 122 -598 193 N ATOM 321 CA ASP A 18 0.513 44.652 28.358 0.05 16.39 C ANISOU 321 CA ASP A 18 2219 1683 2323 56 -584 130 C ATOM 322 C ASP A 18 1.435 43.986 29.364 0.05 15.44 C ANISOU 322 C ASP A 18 2114 1524 2229 18 -488 90 C ATOM 323 O ASP A 18 2.055 42.951 29.057 0.05 15.26 O ANISOU 323 O ASP A 18 2113 1515 2171 -36 -457 49 O ATOM 324 CB ASP A 18 1.028 44.401 26.942 0.05 16.92 C ANISOU 324 CB ASP A 18 2346 1798 2284 18 -627 140 C ATOM 325 CG ASP A 18 0.265 45.184 25.905 0.05 18.07 C ANISOU 325 CG ASP A 18 2468 2003 2396 49 -739 170 C ATOM 326 OD1 ASP A 18 0.945 45.741 25.036 0.05 18.61 O ANISOU 326 OD1 ASP A 18 2607 2098 2366 37 -778 209 O ATOM 327 OD2 ASP A 18 -0.978 45.250 25.963 0.05 18.54 O ANISOU 327 OD2 ASP A 18 2436 2087 2520 81 -788 154 O ATOM 328 H ASP A 18 -0.456 46.297 28.800 0.05 16.84 H ANISOU 328 H ASP A 18 2249 1701 2450 157 -629 196 H ATOM 329 HA ASP A 18 -0.353 44.231 28.437 0.05 16.72 H ANISOU 329 HA ASP A 18 2197 1754 2403 61 -610 105 H ATOM 330 HB2 ASP A 18 1.957 44.644 26.876 0.05 16.73 H ANISOU 330 HB2 ASP A 18 2383 1749 2225 18 -604 174 H ATOM 331 HB3 ASP A 18 0.939 43.460 26.733 0.05 16.80 H ANISOU 331 HB3 ASP A 18 2327 1803 2254 -27 -605 92 H ATOM 332 N LEU A 19 1.513 44.526 30.559 0.05 14.95 N ANISOU 332 N LEU A 19 2040 1412 2227 51 -443 100 N ATOM 333 CA LEU A 19 2.204 43.883 31.651 0.05 14.19 C ANISOU 333 CA LEU A 19 1953 1282 2158 28 -364 71 C ATOM 334 C LEU A 19 1.415 44.074 32.911 0.05 14.11 C ANISOU 334 C LEU A 19 1887 1252 2222 60 -337 61 C ATOM 335 O LEU A 19 0.451 44.821 32.934 0.05 14.62 O ANISOU 335 O LEU A 19 1906 1327 2322 104 -376 73 O ATOM 336 CB LEU A 19 3.643 44.405 31.764 0.05 13.70 C ANISOU 336 CB LEU A 19 1965 1183 2057 20 -327 96 C ATOM 337 CG LEU A 19 3.834 45.899 32.144 0.05 13.69 C ANISOU 337 CG LEU A 19 2006 1143 2054 56 -333 147 C ATOM 338 CD1 LEU A 19 3.777 46.195 33.686 0.05 13.57 C ANISOU 338 CD1 LEU A 19 1958 1093 2105 99 -318 145 C ATOM 339 CD2 LEU A 19 5.168 46.409 31.562 0.05 13.22 C ANISOU 339 CD2 LEU A 19 2003 1057 1963 25 -282 150 C ATOM 340 H LEU A 19 1.142 45.266 30.783 0.05 15.11 H ANISOU 340 H LEU A 19 2048 1419 2274 90 -459 123 H ATOM 341 HA LEU A 19 2.244 42.933 31.459 0.05 14.20 H ANISOU 341 HA LEU A 19 1943 1300 2150 -9 -353 38 H ATOM 342 HB2 LEU A 19 4.109 43.889 32.439 0.05 13.27 H ANISOU 342 HB2 LEU A 19 1911 1109 2021 9 -282 76 H ATOM 343 HB3 LEU A 19 4.077 44.264 30.912 0.05 13.86 H ANISOU 343 HB3 LEU A 19 2011 1224 2031 -6 -338 93 H ATOM 344 HG LEU A 19 3.120 46.394 31.725 0.05 14.16 H ANISOU 344 HG LEU A 19 2078 1216 2088 67 -377 175 H ATOM 345 HD11 LEU A 19 4.267 47.015 33.866 0.05 13.65 H ANISOU 345 HD11 LEU A 19 1997 1072 2117 120 -324 174 H ATOM 346 HD12 LEU A 19 2.857 46.309 33.965 0.05 13.90 H ANISOU 346 HD12 LEU A 19 1957 1154 2173 118 -343 138 H ATOM 347 HD13 LEU A 19 4.197 45.462 34.157 0.05 13.15 H ANISOU 347 HD13 LEU A 19 1901 1029 2067 87 -276 122 H ATOM 348 HD21 LEU A 19 5.053 46.619 30.622 0.05 13.45 H ANISOU 348 HD21 LEU A 19 2061 1105 1945 3 -292 161 H ATOM 349 HD22 LEU A 19 5.440 47.200 32.049 0.05 13.15 H ANISOU 349 HD22 LEU A 19 2010 1015 1971 43 -275 171 H ATOM 350 HD23 LEU A 19 5.842 45.714 31.663 0.05 12.86 H ANISOU 350 HD23 LEU A 19 1946 1010 1931 10 -248 120 H ATOM 351 N ASP A 20 1.816 43.394 33.968 0.05 13.59 N ANISOU 351 N ASP A 20 1823 1161 2180 42 -271 37 N ATOM 352 CA ASP A 20 1.195 43.530 35.264 0.05 13.58 C ANISOU 352 CA ASP A 20 1779 1145 2234 65 -232 25 C ATOM 353 C ASP A 20 2.072 44.395 36.133 0.05 13.15 C ANISOU 353 C ASP A 20 1771 1046 2178 96 -201 45 C ATOM 354 O ASP A 20 3.274 44.179 36.226 0.05 12.67 O ANISOU 354 O ASP A 20 1764 963 2085 77 -178 52 O ATOM 355 CB ASP A 20 0.964 42.164 35.895 0.05 13.49 C ANISOU 355 CB ASP A 20 1745 1137 2243 19 -180 -9 C ATOM 356 CG ASP A 20 -0.136 41.457 35.198 0.05 14.10 C ANISOU 356 CG ASP A 20 1760 1257 2340 -13 -210 -39 C ATOM 357 OD1 ASP A 20 -1.054 42.064 34.644 0.05 14.68 O ANISOU 357 OD1 ASP A 20 1780 1367 2431 12 -265 -38 O ATOM 358 OD2 ASP A 20 -0.130 40.169 35.137 0.05 14.13 O ANISOU 358 OD2 ASP A 20 1764 1259 2346 -69 -182 -69 O ATOM 359 H ASP A 20 2.496 42.882 33.966 0.05 13.29 H ANISOU 359 H ASP A 20 1814 1112 2122 18 -246 30 H ATOM 360 HA ASP A 20 0.326 43.933 35.176 0.05 14.02 H ANISOU 360 HA ASP A 20 1790 1219 2317 88 -258 25 H ATOM 361 HB2 ASP A 20 1.770 41.641 35.833 0.05 13.16 H ANISOU 361 HB2 ASP A 20 1744 1079 2176 -3 -162 -10 H ATOM 362 HB3 ASP A 20 0.705 42.275 36.814 0.05 13.47 H ANISOU 362 HB3 ASP A 20 1727 1125 2267 31 -145 -13 H ATOM 363 N GLY A 21 1.483 45.471 36.681 0.05 13.44 N ANISOU 363 N GLY A 21 1785 1069 2252 146 -205 52 N ATOM 364 CA GLY A 21 2.258 46.440 37.464 0.05 13.19 C ANISOU 364 CA GLY A 21 1800 991 2219 173 -182 62 C ATOM 365 C GLY A 21 1.665 46.715 38.825 0.05 13.34 C ANISOU 365 C GLY A 21 1791 1002 2277 200 -135 35 C ATOM 366 O GLY A 21 0.475 46.654 39.047 0.05 13.83 O ANISOU 366 O GLY A 21 1787 1087 2380 219 -128 15 O ATOM 367 H GLY A 21 0.656 45.650 36.620 0.05 13.83 H ANISOU 367 H GLY A 21 1791 1135 2330 164 -220 45 H ATOM 368 HA2 GLY A 21 3.167 46.148 37.539 0.05 12.79 H ANISOU 368 HA2 GLY A 21 1789 931 2141 149 -166 66 H ATOM 369 HA3 GLY A 21 2.256 47.279 36.974 0.05 13.43 H ANISOU 369 HA3 GLY A 21 1842 1007 2253 199 -215 84 H ATOM 370 N SER A 22 2.567 47.121 39.706 0.05 13.03 N ANISOU 370 N SER A 22 1801 929 2220 203 -103 31 N ATOM 371 CA SER A 22 2.221 47.659 41.032 0.05 13.27 C ANISOU 371 CA SER A 22 1824 945 2272 232 -59 1 C ATOM 372 C SER A 22 2.947 48.998 41.187 0.05 13.32 C ANISOU 372 C SER A 22 1881 900 2280 259 -72 5 C ATOM 373 O SER A 22 4.138 49.076 41.413 0.05 12.95 O ANISOU 373 O SER A 22 1887 834 2198 233 -69 8 O ATOM 374 CB SER A 22 2.570 46.673 42.140 0.05 13.00 C ANISOU 374 CB SER A 22 1806 927 2206 198 -3 -16 C ATOM 375 OG SER A 22 2.717 47.287 43.422 0.05 13.30 O ANISOU 375 OG SER A 22 1851 957 2244 221 42 -47 O ATOM 376 H SER A 22 3.400 47.134 39.556 0.05 12.74 H ANISOU 376 H SER A 22 1802 880 2159 187 -108 41 H ATOM 377 HA SER A 22 1.268 47.825 41.055 0.05 13.69 H ANISOU 377 HA SER A 22 1831 1010 2360 255 -57 -10 H ATOM 378 HB2 SER A 22 1.855 46.021 42.204 0.05 13.08 H ANISOU 378 HB2 SER A 22 1784 963 2225 180 9 -18 H ATOM 379 HB3 SER A 22 3.391 46.207 41.911 0.05 12.63 H ANISOU 379 HB3 SER A 22 1797 872 2129 177 -11 -4 H ATOM 380 HG SER A 22 2.104 47.843 43.550 0.05 13.66 H ANISOU 380 HG SER A 22 1866 1003 2322 247 46 -59 H ATOM 381 N ARG A 23 2.170 50.056 40.987 0.05 13.91 N ANISOU 381 N ARG A 23 1934 949 2403 311 -91 3 N ATOM 382 CA ARG A 23 2.742 51.433 41.050 0.05 14.14 C ANISOU 382 CA ARG A 23 2016 912 2447 337 -105 8 C ATOM 383 C ARG A 23 3.071 51.846 42.461 0.05 14.22 C ANISOU 383 C ARG A 23 2051 899 2452 341 -54 -43 C ATOM 384 O ARG A 23 2.324 51.588 43.360 0.05 14.46 O ANISOU 384 O ARG A 23 2048 956 2491 357 -10 -81 O ATOM 385 CB ARG A 23 1.776 52.463 40.506 0.05 14.91 C ANISOU 385 CB ARG A 23 2088 974 2602 402 -145 26 C ATOM 386 CG ARG A 23 1.765 52.510 39.050 0.05 14.95 C ANISOU 386 CG ARG A 23 2098 991 2592 394 -211 86 C ATOM 387 CD ARG A 23 0.396 52.361 38.539 0.05 15.76 C ANISOU 387 CD ARG A 23 2211 1040 2738 456 -262 124 C ATOM 388 NE ARG A 23 0.110 53.224 37.403 0.05 15.97 N ANISOU 388 NE ARG A 23 2237 1094 2735 451 -329 183 N ATOM 389 CZ ARG A 23 0.936 53.498 36.406 0.05 16.48 C ANISOU 389 CZ ARG A 23 2357 1110 2795 471 -378 244 C ATOM 390 NH1 ARG A 23 2.173 53.047 36.339 0.05 16.83 N ANISOU 390 NH1 ARG A 23 2457 1064 2873 495 -364 252 N ATOM 391 NH2 ARG A 23 0.499 54.326 35.452 0.05 16.76 N ANISOU 391 NH2 ARG A 23 2396 1184 2789 464 -440 296 N ATOM 392 H ARG A 23 1.337 50.020 40.797 0.05 14.24 H ANISOU 392 H ARG A 23 1932 1006 2473 332 -98 0 H ATOM 393 HA ARG A 23 3.556 51.472 40.523 0.05 13.85 H ANISOU 393 HA ARG A 23 2016 864 2383 309 -124 32 H ATOM 394 HB2 ARG A 23 0.896 52.223 40.821 0.05 15.23 H ANISOU 394 HB2 ARG A 23 2075 1038 2673 429 -132 5 H ATOM 395 HB3 ARG A 23 2.032 53.324 40.853 0.05 15.15 H ANISOU 395 HB3 ARG A 23 2153 953 2650 420 -142 20 H ATOM 396 HG2 ARG A 23 2.115 53.368 38.765 0.05 14.56 H ANISOU 396 HG2 ARG A 23 2093 936 2503 355 -213 104 H ATOM 397 HG3 ARG A 23 2.312 51.793 38.694 0.05 14.93 H ANISOU 397 HG3 ARG A 23 2051 1037 2587 388 -220 85 H ATOM 398 HD2 ARG A 23 0.276 51.443 38.241 0.05 16.23 H ANISOU 398 HD2 ARG A 23 2227 1095 2845 503 -256 102 H ATOM 399 HD3 ARG A 23 -0.234 52.581 39.233 0.05 15.76 H ANISOU 399 HD3 ARG A 23 2265 988 2735 449 -254 132 H ATOM 400 HE ARG A 23 -0.703 53.484 37.311 0.05 15.69 H ANISOU 400 HE ARG A 23 2180 1108 2672 421 -332 179 H ATOM 401 HH11 ARG A 23 2.493 52.519 36.922 0.05 16.71 H ANISOU 401 HH11 ARG A 23 2441 1027 2880 498 -326 213 H ATOM 402 HH12 ARG A 23 2.662 53.272 35.665 0.05 17.23 H ANISOU 402 HH12 ARG A 23 2548 1077 2922 506 -393 296 H ATOM 403 HH21 ARG A 23 -0.297 54.637 35.482 0.05 16.58 H ANISOU 403 HH21 ARG A 23 2338 1218 2746 445 -448 284 H ATOM 404 HH22 ARG A 23 1.015 54.527 34.795 0.05 17.16 H ANISOU 404 HH22 ARG A 23 2487 1203 2829 476 -470 341 H ATOM 405 N LEU A 24 4.188 52.539 42.611 0.05 14.10 N ANISOU 405 N LEU A 24 2098 840 2419 321 -61 -43 N ATOM 406 CA LEU A 24 4.574 53.097 43.916 0.05 14.31 C ANISOU 406 CA LEU A 24 2159 841 2437 321 -25 -97 C ATOM 407 C LEU A 24 3.571 54.114 44.444 0.05 15.12 C ANISOU 407 C LEU A 24 2246 904 2595 383 -1 -140 C ATOM 408 O LEU A 24 3.179 54.087 45.599 0.05 15.40 O ANISOU 408 O LEU A 24 2275 958 2620 394 49 -195 O ATOM 409 CB LEU A 24 5.955 53.715 43.795 0.05 14.21 C ANISOU 409 CB LEU A 24 2206 781 2413 285 -49 -87 C ATOM 410 CG LEU A 24 6.400 54.763 44.826 0.05 14.68 C ANISOU 410 CG LEU A 24 2310 788 2480 284 -32 -143 C ATOM 411 CD1 LEU A 24 6.027 54.490 46.250 0.05 14.47 C ANISOU 411 CD1 LEU A 24 2295 809 2393 251 -9 -185 C ATOM 412 CD2 LEU A 24 7.883 55.015 44.732 0.05 14.85 C ANISOU 412 CD2 LEU A 24 2380 740 2524 254 -61 -120 C ATOM 413 H LEU A 24 4.740 52.693 41.977 0.05 13.95 H ANISOU 413 H LEU A 24 2101 807 2392 304 -86 -16 H ATOM 414 HA LEU A 24 4.621 52.383 44.574 0.05 14.08 H ANISOU 414 HA LEU A 24 2128 851 2373 301 -1 -114 H ATOM 415 HB2 LEU A 24 6.617 53.005 43.825 0.05 13.77 H ANISOU 415 HB2 LEU A 24 2155 756 2319 248 -53 -77 H ATOM 416 HB3 LEU A 24 6.008 54.131 42.923 0.05 14.33 H ANISOU 416 HB3 LEU A 24 2226 767 2452 294 -76 -52 H ATOM 417 HG LEU A 24 5.963 55.593 44.575 0.05 15.15 H ANISOU 417 HG LEU A 24 2362 823 2574 325 -16 -168 H ATOM 418 HD11 LEU A 24 6.787 54.717 46.811 0.05 14.16 H ANISOU 418 HD11 LEU A 24 2269 779 2331 213 -28 -170 H ATOM 419 HD12 LEU A 24 5.262 55.029 46.501 0.05 14.89 H ANISOU 419 HD12 LEU A 24 2369 840 2450 259 8 -232 H ATOM 420 HD13 LEU A 24 5.831 53.542 46.346 0.05 14.28 H ANISOU 420 HD13 LEU A 24 2244 833 2349 257 8 -181 H ATOM 421 HD21 LEU A 24 8.149 55.063 43.800 0.05 15.07 H ANISOU 421 HD21 LEU A 24 2406 735 2584 278 -78 -85 H ATOM 422 HD22 LEU A 24 8.085 55.847 45.182 0.05 15.23 H ANISOU 422 HD22 LEU A 24 2455 750 2582 250 -50 -162 H ATOM 423 HD23 LEU A 24 8.356 54.283 45.163 0.05 14.44 H ANISOU 423 HD23 LEU A 24 2329 716 2440 213 -72 -101 H ATOM 424 N LEU A 25 3.168 54.996 43.548 0.05 15.58 N ANISOU 424 N LEU A 25 2300 909 2712 426 -36 -111 N ATOM 425 CA LEU A 25 2.323 56.125 43.937 0.05 16.50 C ANISOU 425 CA LEU A 25 2404 969 2897 497 -19 -149 C ATOM 426 C LEU A 25 0.948 55.777 43.489 0.05 16.88 C ANISOU 426 C LEU A 25 2366 1057 2990 551 -24 -140 C ATOM 427 O LEU A 25 0.809 54.934 42.612 0.05 16.46 O ANISOU 427 O LEU A 25 2278 1060 2917 528 -55 -95 O ATOM 428 CB LEU A 25 2.770 57.415 43.236 0.05 16.99 C ANISOU 428 CB LEU A 25 2522 930 3004 518 -60 -118 C ATOM 429 CG LEU A 25 4.219 57.772 43.478 0.05 16.75 C ANISOU 429 CG LEU A 25 2568 856 2939 454 -57 -128 C ATOM 430 CD1 LEU A 25 4.605 59.029 42.704 0.05 17.31 C ANISOU 430 CD1 LEU A 25 2697 823 3057 462 -93 -83 C ATOM 431 CD2 LEU A 25 4.478 57.937 44.964 0.05 17.01 C ANISOU 431 CD2 LEU A 25 2623 882 2960 447 -5 -218 C ATOM 432 H LEU A 25 3.358 54.968 42.714 0.05 15.45 H ANISOU 432 H LEU A 25 2289 886 2696 419 -70 -69 H ATOM 433 HA LEU A 25 2.351 56.241 44.895 0.05 16.64 H ANISOU 433 HA LEU A 25 2433 987 2902 494 21 -201 H ATOM 434 HB2 LEU A 25 2.652 57.322 42.280 0.05 16.91 H ANISOU 434 HB2 LEU A 25 2506 923 2998 520 -100 -62 H ATOM 435 HB3 LEU A 25 2.218 58.141 43.568 0.05 17.66 H ANISOU 435 HB3 LEU A 25 2600 971 3141 570 -48 -146 H ATOM 436 HG LEU A 25 4.779 57.044 43.159 0.05 16.12 H ANISOU 436 HG LEU A 25 2490 824 2812 406 -66 -106 H ATOM 437 HD11 LEU A 25 4.422 58.889 41.763 0.05 17.23 H ANISOU 437 HD11 LEU A 25 2677 824 3046 469 -127 -24 H ATOM 438 HD12 LEU A 25 4.076 59.769 43.037 0.05 17.99 H ANISOU 438 HD12 LEU A 25 2788 852 3195 511 -84 -108 H ATOM 439 HD13 LEU A 25 5.549 59.207 42.837 0.05 17.14 H ANISOU 439 HD13 LEU A 25 2717 783 3014 411 -90 -89 H ATOM 440 HD21 LEU A 25 5.309 58.420 45.089 0.05 16.57 H ANISOU 440 HD21 LEU A 25 2586 855 2854 394 -3 -226 H ATOM 441 HD22 LEU A 25 3.740 58.425 45.362 0.05 17.59 H ANISOU 441 HD22 LEU A 25 2730 881 3074 465 -4 -239 H ATOM 442 HD23 LEU A 25 4.548 57.058 45.370 0.05 17.15 H ANISOU 442 HD23 LEU A 25 2602 935 2980 476 24 -248 H ATOM 443 N PRO A 26 -0.086 56.335 44.111 0.05 17.72 N ANISOU 443 N PRO A 26 2432 1145 3156 616 13 -193 N ATOM 444 CA PRO A 26 -0.061 57.131 45.347 0.05 18.23 C ANISOU 444 CA PRO A 26 2538 1159 3229 632 67 -268 C ATOM 445 C PRO A 26 0.365 56.349 46.615 0.05 17.80 C ANISOU 445 C PRO A 26 2496 1173 3095 575 130 -318 C ATOM 446 O PRO A 26 0.154 55.149 46.718 0.05 17.38 O ANISOU 446 O PRO A 26 2399 1201 3005 545 148 -303 O ATOM 447 CB PRO A 26 -1.516 57.662 45.477 0.05 19.33 C ANISOU 447 CB PRO A 26 2608 1278 3460 726 93 -310 C ATOM 448 CG PRO A 26 -2.310 56.980 44.383 0.05 19.18 C ANISOU 448 CG PRO A 26 2491 1350 3447 729 85 -281 C ATOM 449 CD PRO A 26 -1.351 56.472 43.363 0.05 18.36 C ANISOU 449 CD PRO A 26 2414 1260 3302 680 8 -194 C ATOM 450 HA PRO A 26 0.543 57.882 45.246 0.05 18.28 H ANISOU 450 HA PRO A 26 2602 1104 3241 625 47 -261 H ATOM 451 HB2 PRO A 26 -1.870 57.427 46.346 0.05 19.69 H ANISOU 451 HB2 PRO A 26 2658 1320 3502 734 149 -373 H ATOM 452 HB3 PRO A 26 -1.519 58.620 45.358 0.05 19.78 H ANISOU 452 HB3 PRO A 26 2678 1268 3568 769 56 -287 H ATOM 453 HG2 PRO A 26 -2.797 56.235 44.774 0.05 18.97 H ANISOU 453 HG2 PRO A 26 2446 1379 3382 695 135 -312 H ATOM 454 HG3 PRO A 26 -2.924 57.618 43.989 0.05 19.89 H ANISOU 454 HG3 PRO A 26 2525 1428 3603 791 78 -289 H ATOM 455 HD2 PRO A 26 -1.646 55.597 43.054 0.05 18.00 H ANISOU 455 HD2 PRO A 26 2328 1279 3231 649 10 -182 H ATOM 456 HD3 PRO A 26 -1.250 57.088 42.625 0.05 18.72 H ANISOU 456 HD3 PRO A 26 2457 1268 3389 719 -42 -157 H ATOM 457 N TRP A 27 0.932 57.080 47.579 0.05 18.03 N ANISOU 457 N TRP A 27 2591 1164 3097 559 159 -375 N ATOM 458 CA TRP A 27 1.362 56.532 48.857 0.05 17.95 C ANISOU 458 CA TRP A 27 2604 1212 3006 517 216 -430 C ATOM 459 C TRP A 27 1.324 57.710 49.816 0.05 18.96 C ANISOU 459 C TRP A 27 2764 1278 3161 556 261 -520 C ATOM 460 O TRP A 27 2.192 58.568 49.764 0.05 19.15 O ANISOU 460 O TRP A 27 2852 1227 3197 546 234 -539 O ATOM 461 CB TRP A 27 2.779 55.954 48.715 0.05 17.14 C ANISOU 461 CB TRP A 27 2562 1126 2825 441 179 -400 C ATOM 462 CG TRP A 27 3.337 55.236 49.902 0.05 17.08 C ANISOU 462 CG TRP A 27 2587 1182 2721 397 218 -439 C ATOM 463 CD1 TRP A 27 3.313 55.613 51.202 0.05 17.82 C ANISOU 463 CD1 TRP A 27 2710 1283 2777 403 273 -521 C ATOM 464 CD2 TRP A 27 4.015 53.992 49.857 0.05 16.34 C ANISOU 464 CD2 TRP A 27 2504 1154 2552 342 201 -394 C ATOM 465 NE1 TRP A 27 3.936 54.683 51.996 0.05 17.60 N ANISOU 465 NE1 TRP A 27 2716 1328 2645 354 286 -524 N ATOM 466 CE2 TRP A 27 4.377 53.666 51.181 0.05 16.70 C ANISOU 466 CE2 TRP A 27 2588 1245 2512 319 241 -443 C ATOM 467 CE3 TRP A 27 4.352 53.117 48.821 0.05 15.52 C ANISOU 467 CE3 TRP A 27 2383 1072 2443 312 156 -320 C ATOM 468 CZ2 TRP A 27 5.060 52.481 51.480 0.05 16.28 C ANISOU 468 CZ2 TRP A 27 2558 1255 2373 275 231 -409 C ATOM 469 CZ3 TRP A 27 5.014 51.942 49.140 0.05 15.08 C ANISOU 469 CZ3 TRP A 27 2346 1075 2310 268 153 -295 C ATOM 470 CH2 TRP A 27 5.371 51.667 50.442 0.05 15.48 C ANISOU 470 CH2 TRP A 27 2435 1164 2282 253 186 -335 C ATOM 471 H TRP A 27 1.072 57.926 47.511 0.05 18.34 H ANISOU 471 H TRP A 27 2664 1140 3163 572 145 -385 H ATOM 472 HA TRP A 27 0.744 55.845 49.155 0.05 17.94 H ANISOU 472 HA TRP A 27 2558 1267 2990 518 248 -430 H ATOM 473 HB2 TRP A 27 2.765 55.341 47.969 0.05 16.60 H ANISOU 473 HB2 TRP A 27 2472 1082 2753 424 150 -344 H ATOM 474 HB3 TRP A 27 3.397 56.665 48.502 0.05 17.26 H ANISOU 474 HB3 TRP A 27 2615 1085 2856 436 153 -405 H ATOM 475 HD1 TRP A 27 2.930 56.404 51.517 0.05 18.45 H ANISOU 475 HD1 TRP A 27 2792 1324 2896 439 298 -570 H ATOM 476 HE1 TRP A 27 4.031 54.733 52.850 0.05 18.03 H ANISOU 476 HE1 TRP A 27 2796 1402 2651 348 317 -568 H ATOM 477 HE3 TRP A 27 4.114 53.311 47.945 0.05 15.34 H ANISOU 477 HE3 TRP A 27 2338 1025 2464 324 130 -287 H ATOM 478 HZ2 TRP A 27 5.303 52.266 52.350 0.05 16.61 H ANISOU 478 HZ2 TRP A 27 2630 1328 2352 262 252 -436 H ATOM 479 HZ3 TRP A 27 5.253 51.355 48.461 0.05 14.59 H ANISOU 479 HZ3 TRP A 27 2273 1024 2249 251 127 -251 H ATOM 480 HH2 TRP A 27 5.823 50.867 50.619 0.05 15.25 H ANISOU 480 HH2 TRP A 27 2420 1170 2203 229 178 -311 H ATOM 481 N GLU A 28 0.331 57.742 50.693 0.05 19.70 N ANISOU 481 N GLU A 28 2813 1403 3270 599 333 -581 N ATOM 482 CA GLU A 28 0.063 58.978 51.399 0.05 20.82 C ANISOU 482 CA GLU A 28 2978 1476 3455 650 378 -673 C ATOM 483 C GLU A 28 1.209 59.304 52.372 0.05 20.86 C ANISOU 483 C GLU A 28 3079 1470 3375 590 385 -731 C ATOM 484 O GLU A 28 1.648 58.482 53.148 0.05 20.42 O ANISOU 484 O GLU A 28 3050 1495 3213 529 398 -732 O ATOM 485 CB GLU A 28 -1.337 59.021 52.078 0.05 21.75 C ANISOU 485 CB GLU A 28 3024 1637 3604 706 467 -739 C ATOM 486 CG GLU A 28 -2.196 60.324 51.747 0.05 23.01 C ANISOU 486 CG GLU A 28 3150 1702 3891 810 486 -796 C ATOM 487 CD GLU A 28 -3.701 60.150 51.995 0.05 23.72 C ANISOU 487 CD GLU A 28 3121 1845 4048 876 542 -816 C ATOM 488 OE1 GLU A 28 -4.433 59.493 51.209 0.05 23.21 O ANISOU 488 OE1 GLU A 28 2979 1836 4005 873 506 -741 O ATOM 489 OE2 GLU A 28 -4.160 60.699 53.007 0.05 24.86 O ANISOU 489 OE2 GLU A 28 3244 1983 4220 924 628 -915 O ATOM 490 H GLU A 28 -0.180 57.081 50.891 0.05 19.64 H ANISOU 490 H GLU A 28 2762 1451 3249 597 360 -574 H ATOM 491 HA GLU A 28 0.061 59.685 50.735 0.05 21.04 H ANISOU 491 HA GLU A 28 3009 1433 3554 686 342 -656 H ATOM 492 HB2 GLU A 28 -1.837 58.233 51.807 0.05 21.44 H ANISOU 492 HB2 GLU A 28 2925 1652 3568 703 467 -697 H ATOM 493 HB3 GLU A 28 -1.213 59.021 53.040 0.05 21.99 H ANISOU 493 HB3 GLU A 28 3085 1702 3568 680 518 -792 H ATOM 494 HG2 GLU A 28 -1.899 61.043 52.327 0.05 23.59 H ANISOU 494 HG2 GLU A 28 3269 1743 3950 814 524 -869 H ATOM 495 HG3 GLU A 28 -2.070 60.579 50.820 0.05 22.89 H ANISOU 495 HG3 GLU A 28 3144 1623 3930 832 425 -750 H ATOM 496 N GLY A 29 1.724 60.526 52.284 0.05 21.44 N ANISOU 496 N GLY A 29 3208 1438 3501 607 366 -774 N ATOM 497 CA GLY A 29 2.848 60.946 53.105 0.05 21.68 C ANISOU 497 CA GLY A 29 3323 1446 3466 550 363 -840 C ATOM 498 C GLY A 29 4.208 60.632 52.487 0.05 20.79 C ANISOU 498 C GLY A 29 3254 1331 3313 472 286 -779 C ATOM 499 O GLY A 29 5.247 61.004 53.030 0.05 21.04 O ANISOU 499 O GLY A 29 3348 1347 3299 419 273 -834 O ATOM 500 H GLY A 29 1.444 61.128 51.740 0.05 21.77 H ANISOU 500 H GLY A 29 3238 1416 3617 650 351 -764 H ATOM 501 HA2 GLY A 29 2.795 61.905 53.250 0.05 22.42 H ANISOU 501 HA2 GLY A 29 3443 1462 3615 580 375 -893 H ATOM 502 HA3 GLY A 29 2.800 60.508 53.968 0.05 21.83 H ANISOU 502 HA3 GLY A 29 3350 1530 3414 532 404 -883 H ATOM 503 N LEU A 30 4.211 59.990 51.326 0.05 19.87 N ANISOU 503 N LEU A 30 3101 1232 3216 463 236 -673 N ATOM 504 CA LEU A 30 5.459 59.732 50.605 0.05 19.10 C ANISOU 504 CA LEU A 30 3033 1133 3091 393 170 -613 C ATOM 505 C LEU A 30 5.647 60.815 49.560 0.05 19.37 C ANISOU 505 C LEU A 30 3090 1051 3220 407 132 -577 C ATOM 506 O LEU A 30 4.806 60.981 48.713 0.05 19.47 O ANISOU 506 O LEU A 30 3068 1029 3299 465 124 -525 O ATOM 507 CB LEU A 30 5.472 58.339 49.953 0.05 18.01 C ANISOU 507 CB LEU A 30 2850 1086 2908 369 145 -524 C ATOM 508 CG LEU A 30 6.699 58.147 49.079 0.05 17.27 C ANISOU 508 CG LEU A 30 2772 993 2799 308 85 -459 C ATOM 509 CD1 LEU A 30 7.937 57.928 49.909 0.05 17.37 C ANISOU 509 CD1 LEU A 30 2829 1019 2750 244 69 -507 C ATOM 510 CD2 LEU A 30 6.499 57.046 48.062 0.05 16.34 C ANISOU 510 CD2 LEU A 30 2608 956 2645 295 68 -380 C ATOM 511 H LEU A 30 3.503 59.728 50.921 0.05 19.75 H ANISOU 511 H LEU A 30 3042 1229 3232 497 240 -638 H ATOM 512 HA LEU A 30 6.215 59.781 51.209 0.05 19.21 H ANISOU 512 HA LEU A 30 3084 1159 3057 351 168 -655 H ATOM 513 HB2 LEU A 30 5.467 57.667 50.648 0.05 17.92 H ANISOU 513 HB2 LEU A 30 2835 1140 2834 355 169 -544 H ATOM 514 HB3 LEU A 30 4.692 58.238 49.391 0.05 17.96 H ANISOU 514 HB3 LEU A 30 2804 1077 2944 408 148 -490 H ATOM 515 HG LEU A 30 6.850 58.951 48.563 0.05 17.43 H ANISOU 515 HG LEU A 30 2800 948 2873 317 65 -435 H ATOM 516 HD11 LEU A 30 8.298 58.782 50.190 0.05 17.89 H ANISOU 516 HD11 LEU A 30 2927 1020 2851 238 66 -544 H ATOM 517 HD12 LEU A 30 7.711 57.395 50.687 0.05 17.51 H ANISOU 517 HD12 LEU A 30 2851 1087 2714 244 92 -545 H ATOM 518 HD13 LEU A 30 8.596 57.464 49.370 0.05 16.84 H ANISOU 518 HD13 LEU A 30 2755 978 2664 208 37 -464 H ATOM 519 HD21 LEU A 30 7.345 56.860 47.624 0.05 15.95 H ANISOU 519 HD21 LEU A 30 2568 908 2584 257 36 -348 H ATOM 520 HD22 LEU A 30 6.188 56.247 48.519 0.05 16.25 H ANISOU 520 HD22 LEU A 30 2589 1002 2584 290 91 -397 H ATOM 521 HD23 LEU A 30 5.839 57.324 47.407 0.05 16.32 H ANISOU 521 HD23 LEU A 30 2575 942 2685 330 68 -348 H ATOM 522 N ASN A 31 6.747 61.537 49.696 0.05 19.65 N ANISOU 522 N ASN A 31 3183 1027 3254 351 111 -607 N ATOM 523 CA ASN A 31 7.116 62.589 48.746 0.05 20.04 C ANISOU 523 CA ASN A 31 3271 957 3388 346 80 -571 C ATOM 524 C ASN A 31 8.402 62.219 48.029 0.05 19.35 C ANISOU 524 C ASN A 31 3195 890 3269 261 34 -509 C ATOM 525 O ASN A 31 9.451 62.168 48.629 0.05 19.33 O ANISOU 525 O ASN A 31 3212 914 3218 191 25 -554 O ATOM 526 CB ASN A 31 7.268 63.932 49.455 0.05 21.25 C ANISOU 526 CB ASN A 31 3485 998 3590 347 105 -669 C ATOM 527 CG ASN A 31 7.464 65.100 48.484 0.05 21.90 C ANISOU 527 CG ASN A 31 3614 933 3775 354 83 -625 C ATOM 528 OD1 ASN A 31 7.166 65.011 47.303 0.05 21.61 O ANISOU 528 OD1 ASN A 31 3562 875 3773 379 54 -522 O ATOM 529 ND2 ASN A 31 7.969 66.218 49.011 0.05 22.95 N ANISOU 529 ND2 ASN A 31 3811 957 3950 328 99 -708 N ATOM 530 H ASN A 31 7.305 61.445 50.339 0.05 19.68 H ANISOU 530 H ASN A 31 3208 1059 3212 313 113 -650 H ATOM 531 HA ASN A 31 6.421 62.677 48.079 0.05 20.09 H ANISOU 531 HA ASN A 31 3256 936 3441 396 75 -523 H ATOM 532 HB2 ASN A 31 6.465 64.114 49.971 0.05 21.72 H ANISOU 532 HB2 ASN A 31 3534 1053 3664 402 140 -717 H ATOM 533 HB3 ASN A 31 8.041 63.908 50.043 0.05 21.27 H ANISOU 533 HB3 ASN A 31 3511 1023 3547 290 101 -715 H ATOM 534 HD21 ASN A 31 7.919 66.360 49.858 0.05 23.30 H ANISOU 534 HD21 ASN A 31 3865 1015 3974 326 123 -788 H ATOM 535 HD22 ASN A 31 8.348 66.791 48.497 0.05 23.30 H ANISOU 535 HD22 ASN A 31 3888 920 4043 311 86 -681 H ATOM 536 N THR A 32 8.282 61.990 46.739 0.05 18.92 N ANISOU 536 N THR A 32 3122 825 3240 271 6 -408 N ATOM 537 CA THR A 32 9.385 61.534 45.891 0.05 18.28 C ANISOU 537 CA THR A 32 3042 772 3130 199 -27 -341 C ATOM 538 C THR A 32 9.502 62.478 44.682 0.05 18.78 C ANISOU 538 C THR A 32 3147 727 3262 196 -45 -271 C ATOM 539 O THR A 32 8.486 62.989 44.244 0.05 19.27 O ANISOU 539 O THR A 32 3214 728 3380 271 -47 -241 O ATOM 540 CB THR A 32 9.155 60.054 45.342 0.05 17.21 C ANISOU 540 CB THR A 32 2848 754 2939 205 -41 -274 C ATOM 541 OG1 THR A 32 7.935 60.037 44.626 0.05 17.29 O ANISOU 541 OG1 THR A 32 2833 750 2986 278 -45 -224 O ATOM 542 CG2 THR A 32 9.048 58.992 46.464 0.05 16.75 C ANISOU 542 CG2 THR A 32 2756 801 2808 203 -23 -323 C ATOM 543 H THR A 32 7.539 62.055 46.320 0.05 19.02 H ANISOU 543 H THR A 32 3120 821 3285 322 6 -378 H ATOM 544 HA THR A 32 10.210 61.557 46.397 0.05 18.30 H ANISOU 544 HA THR A 32 3057 789 3106 146 -29 -381 H ATOM 545 HB THR A 32 9.878 59.814 44.750 0.05 16.90 H ANISOU 545 HB THR A 32 2810 726 2884 161 -59 -234 H ATOM 546 HG1 THR A 32 8.092 60.043 43.807 0.05 17.18 H ANISOU 546 HG1 THR A 32 2823 724 2979 269 -65 -171 H ATOM 547 HG21 THR A 32 8.859 58.142 46.046 0.05 16.17 H ANISOU 547 HG21 THR A 32 2652 784 2709 204 -32 -279 H ATOM 548 HG22 THR A 32 9.878 58.930 46.947 0.05 16.77 H ANISOU 548 HG22 THR A 32 2773 819 2780 159 -28 -357 H ATOM 549 HG23 THR A 32 8.333 59.200 47.072 0.05 17.08 H ANISOU 549 HG23 THR A 32 2792 839 2857 245 1 -360 H ATOM 550 N PRO A 33 10.697 62.584 44.117 0.05 18.69 N ANISOU 550 N PRO A 33 3157 703 3240 114 -58 -240 N ATOM 551 CA PRO A 33 10.887 63.326 42.868 0.05 19.16 C ANISOU 551 CA PRO A 33 3261 672 3348 99 -70 -157 C ATOM 552 C PRO A 33 10.777 62.408 41.647 0.05 18.44 C ANISOU 552 C PRO A 33 3139 653 3213 102 -92 -58 C ATOM 553 O PRO A 33 11.081 62.810 40.539 0.05 18.75 O ANISOU 553 O PRO A 33 3215 645 3263 75 -101 20 O ATOM 554 CB PRO A 33 12.306 63.863 43.006 0.05 19.53 C ANISOU 554 CB PRO A 33 3340 679 3401 -6 -62 -187 C ATOM 555 CG PRO A 33 13.020 62.711 43.777 0.05 18.69 C ANISOU 555 CG PRO A 33 3174 707 3220 -49 -66 -241 C ATOM 556 CD PRO A 33 11.976 62.284 44.766 0.05 18.49 C ANISOU 556 CD PRO A 33 3125 727 3172 28 -59 -295 C ATOM 557 HA PRO A 33 10.246 64.052 42.803 0.05 19.80 H ANISOU 557 HA PRO A 33 3369 673 3479 148 -68 -154 H ATOM 558 HB2 PRO A 33 12.696 63.992 42.131 0.05 19.60 H ANISOU 558 HB2 PRO A 33 3365 667 3415 -39 -65 -125 H ATOM 559 HB3 PRO A 33 12.312 64.683 43.523 0.05 20.23 H ANISOU 559 HB3 PRO A 33 3464 692 3532 -9 -50 -238 H ATOM 560 HG2 PRO A 33 13.219 62.012 43.144 0.05 18.13 H ANISOU 560 HG2 PRO A 33 3076 694 3117 -61 -74 -189 H ATOM 561 HG3 PRO A 33 13.819 63.014 44.220 0.05 18.99 H ANISOU 561 HG3 PRO A 33 3221 735 3262 -106 -64 -288 H ATOM 562 HD2 PRO A 33 12.052 61.329 44.945 0.05 17.83 H ANISOU 562 HD2 PRO A 33 3003 736 3037 26 -65 -293 H ATOM 563 HD3 PRO A 33 12.054 62.802 45.579 0.05 19.00 H ANISOU 563 HD3 PRO A 33 3211 758 3250 22 -49 -364 H ATOM 564 N PHE A 34 10.329 61.156 41.867 0.05 17.57 N ANISOU 564 N PHE A 34 2967 658 3049 132 -97 -62 N ATOM 565 CA PHE A 34 10.228 60.132 40.809 0.05 16.88 C ANISOU 565 CA PHE A 34 2847 651 2915 131 -116 14 C ATOM 566 C PHE A 34 8.946 59.355 41.026 0.05 16.51 C ANISOU 566 C PHE A 34 2747 668 2858 206 -123 10 C ATOM 567 O PHE A 34 8.338 59.390 42.067 0.05 16.65 O ANISOU 567 O PHE A 34 2747 688 2892 248 -105 -52 O ATOM 568 CB PHE A 34 11.446 59.164 40.835 0.05 16.16 C ANISOU 568 CB PHE A 34 2729 646 2766 53 -110 4 C ATOM 569 CG PHE A 34 11.679 58.518 42.178 0.05 15.75 C ANISOU 569 CG PHE A 34 2641 660 2683 48 -100 -74 C ATOM 570 CD1 PHE A 34 10.987 57.371 42.536 0.05 15.13 C ANISOU 570 CD1 PHE A 34 2517 665 2566 88 -100 -78 C ATOM 571 CD2 PHE A 34 12.572 59.049 43.070 0.05 16.09 C ANISOU 571 CD2 PHE A 34 2699 684 2731 0 -93 -141 C ATOM 572 CE1 PHE A 34 11.204 56.808 43.789 0.05 14.89 C ANISOU 572 CE1 PHE A 34 2466 692 2499 84 -90 -139 C ATOM 573 CE2 PHE A 34 12.789 58.490 44.306 0.05 15.85 C ANISOU 573 CE2 PHE A 34 2644 720 2659 -3 -92 -207 C ATOM 574 CZ PHE A 34 12.098 57.381 44.661 0.05 15.26 C ANISOU 574 CZ PHE A 34 2534 723 2542 42 -89 -200 C ATOM 575 H PHE A 34 10.059 60.891 42.630 0.05 17.43 H ANISOU 575 H PHE A 34 2929 671 3022 152 -88 -110 H ATOM 576 HA PHE A 34 10.186 60.551 39.938 0.05 17.21 H ANISOU 576 HA PHE A 34 2918 650 2972 131 -128 71 H ATOM 577 HB2 PHE A 34 11.266 58.467 40.193 0.05 15.76 H ANISOU 577 HB2 PHE A 34 2658 644 2687 59 -119 46 H ATOM 578 HB3 PHE A 34 12.253 59.626 40.581 0.05 16.45 H ANISOU 578 HB3 PHE A 34 2790 648 2812 2 -104 10 H ATOM 579 HD1 PHE A 34 10.371 57.003 41.950 0.05 14.95 H ANISOU 579 HD1 PHE A 34 2480 659 2543 117 -107 -40 H ATOM 580 HD2 PHE A 34 13.038 59.814 42.830 0.05 16.57 H ANISOU 580 HD2 PHE A 34 2789 684 2821 -34 -90 -141 H ATOM 581 HE1 PHE A 34 10.736 56.049 44.036 0.05 14.55 H ANISOU 581 HE1 PHE A 34 2397 698 2431 107 -85 -137 H ATOM 582 HE2 PHE A 34 13.392 58.873 44.897 0.05 16.16 H ANISOU 582 HE2 PHE A 34 2694 750 2698 -36 -94 -254 H ATOM 583 HZ PHE A 34 12.249 56.998 45.491 0.05 15.17 H ANISOU 583 HZ PHE A 34 2512 754 2497 40 -88 -237 H ATOM 584 N GLY A 35 8.556 58.633 39.988 0.05 16.14 N ANISOU 584 N GLY A 35 2677 674 2783 216 -147 76 N ATOM 585 CA GLY A 35 7.535 57.596 40.085 0.05 15.70 C ANISOU 585 CA GLY A 35 2559 699 2709 263 -154 74 C ATOM 586 C GLY A 35 8.187 56.249 39.840 0.05 14.83 C ANISOU 586 C GLY A 35 2418 683 2532 210 -149 77 C ATOM 587 O GLY A 35 9.345 56.145 39.523 0.05 14.63 O ANISOU 587 O GLY A 35 2415 662 2481 149 -145 91 O ATOM 588 H GLY A 35 8.885 58.724 39.203 0.05 16.19 H ANISOU 588 H GLY A 35 2703 672 2778 192 -158 121 H ATOM 589 HA2 GLY A 35 7.127 57.589 40.957 0.05 15.79 H ANISOU 589 HA2 GLY A 35 2551 712 2735 292 -137 27 H ATOM 590 HA3 GLY A 35 6.853 57.725 39.417 0.05 15.95 H ANISOU 590 HA3 GLY A 35 2586 723 2753 297 -179 117 H ATOM 591 N GLY A 36 7.384 55.213 39.999 0.05 14.42 N ANISOU 591 N GLY A 36 2314 701 2463 235 -143 60 N ATOM 592 CA GLY A 36 7.885 53.914 39.627 0.05 13.69 C ANISOU 592 CA GLY A 36 2197 687 2318 193 -135 58 C ATOM 593 C GLY A 36 6.845 52.851 39.778 0.05 13.47 C ANISOU 593 C GLY A 36 2118 719 2283 220 -141 67 C ATOM 594 O GLY A 36 5.724 53.035 40.176 0.05 13.82 O ANISOU 594 O GLY A 36 2131 760 2361 269 -141 57 O ATOM 595 H GLY A 36 6.590 55.220 40.311 0.05 14.60 H ANISOU 595 H GLY A 36 2315 727 2507 275 -142 49 H ATOM 596 HA2 GLY A 36 8.168 53.942 38.703 0.05 13.60 H ANISOU 596 HA2 GLY A 36 2202 675 2290 160 -144 86 H ATOM 597 HA3 GLY A 36 8.651 53.714 40.183 0.05 13.53 H ANISOU 597 HA3 GLY A 36 2177 678 2287 179 -117 22 H ATOM 598 N ALA A 37 7.294 51.631 39.456 0.05 12.95 N ANISOU 598 N ALA A 37 2037 708 2175 183 -141 80 N ATOM 599 CA ALA A 37 6.402 50.470 39.434 0.05 12.75 C ANISOU 599 CA ALA A 37 1963 738 2142 192 -138 77 C ATOM 600 C ALA A 37 7.205 49.191 39.390 0.05 12.20 C ANISOU 600 C ALA A 37 1892 712 2033 148 -124 73 C ATOM 601 O ALA A 37 8.203 49.077 38.721 0.05 12.04 O ANISOU 601 O ALA A 37 1893 692 1989 116 -131 89 O ATOM 602 CB ALA A 37 5.472 50.503 38.256 0.05 13.08 C ANISOU 602 CB ALA A 37 1983 791 2194 213 -177 111 C ATOM 603 H ALA A 37 8.107 51.456 39.261 0.05 12.76 H ANISOU 603 H ALA A 37 2029 688 2132 152 -140 87 H ATOM 604 HA ALA A 37 5.861 50.471 40.232 0.05 12.85 H ANISOU 604 HA ALA A 37 1957 755 2171 213 -120 51 H ATOM 605 HB1 ALA A 37 4.883 49.740 38.269 0.05 13.03 H ANISOU 605 HB1 ALA A 37 1941 820 2190 216 -175 101 H ATOM 606 HB2 ALA A 37 4.939 51.311 38.323 0.05 13.50 H ANISOU 606 HB2 ALA A 37 2039 811 2277 247 -190 117 H ATOM 607 HB3 ALA A 37 5.992 50.522 37.442 0.05 13.02 H ANISOU 607 HB3 ALA A 37 1998 786 2161 189 -193 137 H ATOM 608 N TRP A 38 6.648 48.235 40.121 0.05 12.06 N ANISOU 608 N TRP A 38 1844 725 2013 151 -100 51 N ATOM 609 CA TRP A 38 7.095 46.817 39.967 0.05 11.69 C ANISOU 609 CA TRP A 38 1790 712 1939 119 -89 53 C ATOM 610 C TRP A 38 6.295 46.216 38.826 0.05 11.79 C ANISOU 610 C TRP A 38 1775 750 1955 111 -109 65 C ATOM 611 O TRP A 38 5.095 46.219 38.856 0.05 12.09 O ANISOU 611 O TRP A 38 1775 800 2018 130 -112 59 O ATOM 612 CB TRP A 38 6.829 46.024 41.259 0.05 11.64 C ANISOU 612 CB TRP A 38 1775 720 1926 120 -52 32 C ATOM 613 CG TRP A 38 7.431 44.607 41.272 0.05 11.37 C ANISOU 613 CG TRP A 38 1746 703 1871 93 -40 38 C ATOM 614 CD1 TRP A 38 7.152 43.575 40.397 0.05 11.32 C ANISOU 614 CD1 TRP A 38 1724 709 1869 72 -42 44 C ATOM 615 CD2 TRP A 38 8.406 44.141 42.177 0.05 11.26 C ANISOU 615 CD2 TRP A 38 1757 687 1832 89 -29 37 C ATOM 616 NE1 TRP A 38 7.897 42.490 40.766 0.05 11.18 N ANISOU 616 NE1 TRP A 38 1722 688 1838 59 -26 46 N ATOM 617 CE2 TRP A 38 8.661 42.788 41.850 0.05 11.15 C ANISOU 617 CE2 TRP A 38 1742 679 1816 72 -21 46 C ATOM 618 CE3 TRP A 38 9.060 44.691 43.284 0.05 11.34 C ANISOU 618 CE3 TRP A 38 1792 695 1822 99 -28 26 C ATOM 619 CZ2 TRP A 38 9.576 42.023 42.547 0.05 11.14 C ANISOU 619 CZ2 TRP A 38 1761 675 1797 74 -16 54 C ATOM 620 CZ3 TRP A 38 9.956 43.933 43.969 0.05 11.33 C ANISOU 620 CZ3 TRP A 38 1808 702 1795 96 -29 32 C ATOM 621 CH2 TRP A 38 10.212 42.599 43.607 0.05 11.24 C ANISOU 621 CH2 TRP A 38 1793 691 1786 88 -24 50 C ATOM 622 H TRP A 38 6.037 48.322 40.703 0.05 12.21 H ANISOU 622 H TRP A 38 1849 746 2046 170 -86 36 H ATOM 623 HA TRP A 38 8.031 46.798 39.742 0.05 11.53 H ANISOU 623 HA TRP A 38 1789 687 1903 101 -93 58 H ATOM 624 HB2 TRP A 38 7.235 46.487 42.002 0.05 11.67 H ANISOU 624 HB2 TRP A 38 1797 714 1922 127 -44 21 H ATOM 625 HB3 TRP A 38 5.872 45.981 41.390 0.05 11.84 H ANISOU 625 HB3 TRP A 38 1775 755 1969 132 -43 26 H ATOM 626 HD1 TRP A 38 6.554 43.598 39.693 0.05 11.43 H ANISOU 626 HD1 TRP A 38 1719 731 1893 69 -55 44 H ATOM 627 HE1 TRP A 38 7.876 41.753 40.348 0.05 11.18 H ANISOU 627 HE1 TRP A 38 1718 689 1840 45 -22 45 H ATOM 628 HE3 TRP A 38 8.896 45.571 43.531 0.05 11.47 H ANISOU 628 HE3 TRP A 38 1813 703 1843 108 -30 13 H ATOM 629 HZ2 TRP A 38 9.739 41.145 42.295 0.05 11.14 H ANISOU 629 HZ2 TRP A 38 1761 669 1801 67 -10 60 H ATOM 630 HZ3 TRP A 38 10.406 44.273 44.700 0.05 11.45 H ANISOU 630 HZ3 TRP A 38 1839 722 1791 101 -35 23 H ATOM 631 HH2 TRP A 38 10.830 42.122 44.109 0.05 11.31 H ANISOU 631 HH2 TRP A 38 1815 702 1780 94 -28 58 H ATOM 632 N CYS A 39 7.021 45.704 37.839 0.05 11.64 N ANISOU 632 N CYS A 39 1770 741 1909 82 -120 76 N ATOM 633 CA CYS A 39 6.406 45.181 36.629 0.05 11.83 C ANISOU 633 CA CYS A 39 1778 794 1924 68 -145 82 C ATOM 634 C CYS A 39 6.769 43.715 36.401 0.05 11.64 C ANISOU 634 C CYS A 39 1752 787 1885 34 -125 62 C ATOM 635 O CYS A 39 7.894 43.316 36.599 0.05 11.39 O ANISOU 635 O CYS A 39 1741 745 1840 22 -103 58 O ATOM 636 CB CYS A 39 6.907 45.988 35.429 0.05 12.04 C ANISOU 636 CB CYS A 39 1838 817 1922 62 -176 112 C ATOM 637 SG CYS A 39 6.646 47.743 35.517 0.05 12.43 S ANISOU 637 SG CYS A 39 1907 823 1993 101 -201 144 S ATOM 638 H CYS A 39 7.865 45.659 37.843 0.05 11.48 H ANISOU 638 H CYS A 39 1769 715 1876 70 -113 77 H ATOM 639 HA CYS A 39 5.444 45.248 36.675 0.05 12.07 H ANISOU 639 HA CYS A 39 1779 833 1973 83 -156 79 H ATOM 640 HB2 CYS A 39 7.852 45.859 35.357 0.05 11.86 H ANISOU 640 HB2 CYS A 39 1836 789 1882 42 -159 111 H ATOM 641 HB3 CYS A 39 6.470 45.717 34.627 0.05 12.26 H ANISOU 641 HB3 CYS A 39 1858 867 1934 55 -198 116 H ATOM 642 HG CYS A 39 7.554 47.997 36.244 0.05 12.18 H ANISOU 642 HG CYS A 39 1895 767 1964 91 -174 134 H ATOM 643 N ILE A 40 5.765 42.997 35.885 0.05 11.90 N ANISOU 643 N ILE A 40 1753 845 1924 21 -137 49 N ATOM 644 CA ILE A 40 5.949 41.579 35.506 0.05 11.89 C ANISOU 644 CA ILE A 40 1752 852 1915 -15 -119 23 C ATOM 645 C ILE A 40 5.466 41.432 34.080 0.05 12.30 C ANISOU 645 C ILE A 40 1796 937 1939 -37 -158 14 C ATOM 646 O ILE A 40 4.311 41.737 33.735 0.05 12.70 O ANISOU 646 O ILE A 40 1811 1014 2001 -30 -196 14 O ATOM 647 CB ILE A 40 5.180 40.624 36.408 0.05 11.97 C ANISOU 647 CB ILE A 40 1734 854 1960 -26 -88 5 C ATOM 648 CG1 ILE A 40 5.467 40.845 37.883 0.05 11.73 C ANISOU 648 CG1 ILE A 40 1716 799 1942 -3 -53 18 C ATOM 649 CG2 ILE A 40 5.531 39.157 35.974 0.05 12.05 C ANISOU 649 CG2 ILE A 40 1757 854 1969 -64 -68 -22 C ATOM 650 CD1 ILE A 40 4.558 39.997 38.812 0.05 11.96 C ANISOU 650 CD1 ILE A 40 1723 822 1998 -18 -14 9 C ATOM 651 H ILE A 40 4.976 43.273 35.739 0.05 12.15 H ANISOU 651 H ILE A 40 1761 887 1967 31 -155 50 H ATOM 652 HA ILE A 40 6.883 41.384 35.562 0.05 11.69 H ANISOU 652 HA ILE A 40 1750 813 1877 -19 -103 23 H ATOM 653 HB ILE A 40 4.239 40.772 36.271 0.05 12.24 H ANISOU 653 HB ILE A 40 1735 906 2011 -25 -103 0 H ATOM 654 HG12 ILE A 40 6.397 40.634 38.064 0.05 11.52 H ANISOU 654 HG12 ILE A 40 1716 758 1902 -3 -44 22 H ATOM 655 HG13 ILE A 40 5.280 41.776 38.078 0.05 11.73 H ANISOU 655 HG13 ILE A 40 1711 802 1944 19 -65 27 H ATOM 656 HG21 ILE A 40 4.967 38.567 36.498 0.05 12.21 H ANISOU 656 HG21 ILE A 40 1759 866 2013 -77 -50 -30 H ATOM 657 HG22 ILE A 40 5.341 39.050 35.036 0.05 12.25 H ANISOU 657 HG22 ILE A 40 1779 899 1978 -80 -91 -35 H ATOM 658 HG23 ILE A 40 6.469 38.999 36.160 0.05 11.83 H ANISOU 658 HG23 ILE A 40 1756 807 1933 -57 -52 -17 H ATOM 659 HD11 ILE A 40 3.633 40.212 38.642 0.05 12.20 H ANISOU 659 HD11 ILE A 40 1719 870 2046 -15 -19 3 H ATOM 660 HD12 ILE A 40 4.725 39.065 38.627 0.05 12.05 H ANISOU 660 HD12 ILE A 40 1738 827 2015 -44 -5 -1 H ATOM 661 HD13 ILE A 40 4.783 40.199 39.726 0.05 11.84 H ANISOU 661 HD13 ILE A 40 1728 793 1977 -6 8 20 H ATOM 662 N VAL A 41 6.381 40.960 33.258 0.05 12.29 N ANISOU 662 N VAL A 41 1827 940 1901 -61 -150 2 N ATOM 663 CA VAL A 41 6.058 40.529 31.895 0.05 12.76 C ANISOU 663 CA VAL A 41 1891 1037 1921 -92 -179 -20 C ATOM 664 C VAL A 41 5.888 39.005 31.969 0.05 12.86 C ANISOU 664 C VAL A 41 1893 1039 1956 -126 -150 -70 C ATOM 665 O VAL A 41 6.825 38.288 32.280 0.05 12.64 O ANISOU 665 O VAL A 41 1887 979 1938 -130 -106 -85 O ATOM 666 CB VAL A 41 7.114 40.947 30.862 0.05 12.89 C ANISOU 666 CB VAL A 41 1953 1068 1875 -103 -181 -8 C ATOM 667 CG1 VAL A 41 6.678 40.570 29.438 0.05 13.51 C ANISOU 667 CG1 VAL A 41 2044 1195 1896 -137 -213 -35 C ATOM 668 CG2 VAL A 41 7.433 42.443 30.933 0.05 12.88 C ANISOU 668 CG2 VAL A 41 1971 1061 1861 -74 -204 48 C ATOM 669 H VAL A 41 7.197 40.839 33.467 0.05 12.07 H ANISOU 669 H VAL A 41 1819 897 1871 -61 -127 1 H ATOM 670 HA VAL A 41 5.206 40.904 31.621 0.05 13.05 H ANISOU 670 HA VAL A 41 1905 1095 1959 -86 -216 -13 H ATOM 671 HB VAL A 41 7.933 40.473 31.071 0.05 12.66 H ANISOU 671 HB VAL A 41 1938 1022 1851 -108 -144 -21 H ATOM 672 HG11 VAL A 41 7.303 40.963 28.807 0.05 13.63 H ANISOU 672 HG11 VAL A 41 2092 1221 1867 -147 -204 -28 H ATOM 673 HG12 VAL A 41 6.706 39.606 29.349 0.05 13.57 H ANISOU 673 HG12 VAL A 41 2042 1200 1916 -158 -197 -75 H ATOM 674 HG13 VAL A 41 5.784 40.904 29.270 0.05 13.80 H ANISOU 674 HG13 VAL A 41 2065 1254 1927 -129 -258 -19 H ATOM 675 HG21 VAL A 41 8.124 42.626 30.283 0.05 13.04 H ANISOU 675 HG21 VAL A 41 2023 1092 1840 -89 -200 57 H ATOM 676 HG22 VAL A 41 6.628 42.941 30.725 0.05 13.14 H ANISOU 676 HG22 VAL A 41 1988 1106 1897 -60 -243 63 H ATOM 677 HG23 VAL A 41 7.742 42.651 31.829 0.05 12.52 H ANISOU 677 HG23 VAL A 41 1922 988 1849 -58 -182 56 H ATOM 678 N ARG A 42 4.671 38.580 31.714 0.05 13.30 N ANISOU 678 N ARG A 42 1911 1118 2026 -147 -177 -94 N ATOM 679 CA ARG A 42 4.311 37.158 31.913 0.05 13.52 C ANISOU 679 CA ARG A 42 1925 1124 2090 -187 -147 -142 C ATOM 680 C ARG A 42 4.996 36.284 30.886 0.05 13.81 C ANISOU 680 C ARG A 42 1998 1159 2090 -220 -136 -188 C ATOM 681 O ARG A 42 5.455 36.740 29.846 0.05 13.98 O ANISOU 681 O ARG A 42 2047 1216 2048 -223 -158 -190 O ATOM 682 CB ARG A 42 2.791 37.035 31.864 0.05 14.05 C ANISOU 682 CB ARG A 42 1930 1222 2187 -209 -181 -160 C ATOM 683 CG ARG A 42 2.085 37.802 32.981 0.05 13.89 C ANISOU 683 CG ARG A 42 1866 1200 2212 -173 -177 -124 C ATOM 684 CD ARG A 42 2.490 37.288 34.347 0.05 13.49 C ANISOU 684 CD ARG A 42 1831 1096 2200 -169 -109 -112 C ATOM 685 NE ARG A 42 1.784 38.048 35.393 0.05 13.45 N ANISOU 685 NE ARG A 42 1788 1095 2226 -137 -97 -87 N ATOM 686 CZ ARG A 42 1.967 37.842 36.667 0.05 13.22 C ANISOU 686 CZ ARG A 42 1773 1033 2217 -129 -43 -70 C ATOM 687 NH1 ARG A 42 2.818 36.912 37.091 0.05 13.03 N ANISOU 687 NH1 ARG A 42 1797 964 2189 -143 -3 -67 N ATOM 688 NH2 ARG A 42 1.271 38.541 37.557 0.05 13.30 N ANISOU 688 NH2 ARG A 42 1749 1055 2251 -103 -28 -57 N ATOM 689 H ARG A 42 4.019 39.050 31.431 0.05 13.55 H ANISOU 689 H ARG A 42 1921 1175 2051 -142 -213 -86 H ATOM 690 HA ARG A 42 4.646 36.903 32.779 0.05 13.23 H ANISOU 690 HA ARG A 42 1894 1050 2081 -176 -111 -131 H ATOM 691 HB2 ARG A 42 2.457 37.344 31.012 0.05 14.41 H ANISOU 691 HB2 ARG A 42 1967 1307 2200 -215 -226 -168 H ATOM 692 HB3 ARG A 42 2.570 36.101 31.985 0.05 14.25 H ANISOU 692 HB3 ARG A 42 1949 1228 2239 -242 -157 -192 H ATOM 693 HG2 ARG A 42 2.345 38.733 32.921 0.05 13.70 H ANISOU 693 HG2 ARG A 42 1853 1184 2168 -139 -196 -94 H ATOM 694 HG3 ARG A 42 1.130 37.731 32.885 0.05 14.31 H ANISOU 694 HG3 ARG A 42 1871 1278 2287 -186 -198 -140 H ATOM 695 HD2 ARG A 42 2.206 36.362 34.434 0.05 13.75 H ANISOU 695 HD2 ARG A 42 1856 1112 2255 -204 -86 -137 H ATOM 696 HD3 ARG A 42 3.440 37.352 34.488 0.05 13.13 H ANISOU 696 HD3 ARG A 42 1826 1028 2135 -153 -92 -98 H ATOM 697 HE ARG A 42 1.062 38.434 35.162 0.05 13.74 H ANISOU 697 HE ARG A 42 1785 1160 2274 -133 -123 -91 H ATOM 698 HH11 ARG A 42 3.274 36.471 36.519 0.05 13.02 H ANISOU 698 HH11 ARG A 42 1816 954 2178 -156 -10 -80 H ATOM 699 HH12 ARG A 42 2.951 36.798 37.926 0.05 12.94 H ANISOU 699 HH12 ARG A 42 1798 933 2185 -136 27 -51 H ATOM 700 HH21 ARG A 42 0.716 39.124 37.281 0.05 13.49 H ANISOU 700 HH21 ARG A 42 1739 1104 2284 -88 -54 -59 H ATOM 701 HH22 ARG A 42 1.393 38.422 38.390 0.05 13.21 H ANISOU 701 HH22 ARG A 42 1751 1025 2243 -99 8 -46 H ATOM 702 N PRO A 43 5.107 34.974 31.190 0.05 13.96 N ANISOU 702 N PRO A 43 2025 1131 2148 -248 -93 -228 N ATOM 703 CA PRO A 43 5.802 34.089 30.251 0.05 14.32 C ANISOU 703 CA PRO A 43 2107 1166 2168 -274 -72 -284 C ATOM 704 C PRO A 43 5.231 34.161 28.840 0.05 14.98 C ANISOU 704 C PRO A 43 2189 1312 2188 -313 -121 -327 C ATOM 705 O PRO A 43 4.010 34.177 28.646 0.05 15.39 O ANISOU 705 O PRO A 43 2201 1400 2248 -340 -167 -340 O ATOM 706 CB PRO A 43 5.512 32.707 30.858 0.05 14.60 C ANISOU 706 CB PRO A 43 2141 1134 2271 -302 -30 -318 C ATOM 707 CG PRO A 43 5.407 32.973 32.335 0.05 14.10 C ANISOU 707 CG PRO A 43 2065 1037 2256 -269 -8 -258 C ATOM 708 CD PRO A 43 4.626 34.257 32.387 0.05 13.92 C ANISOU 708 CD PRO A 43 2001 1075 2211 -254 -56 -222 C ATOM 709 HA PRO A 43 6.757 34.223 30.255 0.05 14.08 H ANISOU 709 HA PRO A 43 2101 1123 2124 -252 -49 -274 H ATOM 710 HB2 PRO A 43 4.678 32.390 30.496 0.05 15.03 H ANISOU 710 HB2 PRO A 43 2175 1205 2331 -340 -50 -349 H ATOM 711 HB3 PRO A 43 6.242 32.109 30.662 0.05 14.70 H ANISOU 711 HB3 PRO A 43 2184 1115 2288 -301 0 -343 H ATOM 712 HG2 PRO A 43 4.919 32.264 32.774 0.05 14.35 H ANISOU 712 HG2 PRO A 43 2089 1034 2328 -292 12 -267 H ATOM 713 HG3 PRO A 43 6.283 33.095 32.720 0.05 13.77 H ANISOU 713 HG3 PRO A 43 2045 974 2212 -236 11 -235 H ATOM 714 HD2 PRO A 43 3.676 34.082 32.332 0.05 14.26 H ANISOU 714 HD2 PRO A 43 2011 1134 2273 -282 -70 -238 H ATOM 715 HD3 PRO A 43 4.855 34.729 33.195 0.05 13.53 H ANISOU 715 HD3 PRO A 43 1952 1015 2172 -223 -44 -183 H ATOM 716 N GLU A 44 6.131 34.204 27.862 0.05 15.16 N ANISOU 716 N GLU A 44 2256 1357 2148 -317 -111 -350 N ATOM 717 CA GLU A 44 5.758 34.202 26.435 0.05 15.93 C ANISOU 717 CA GLU A 44 2369 1520 2163 -356 -153 -394 C ATOM 718 C GLU A 44 4.847 35.337 26.041 0.05 16.11 C ANISOU 718 C GLU A 44 2368 1612 2142 -348 -234 -347 C ATOM 719 O GLU A 44 3.903 35.199 25.262 0.05 16.85 O ANISOU 719 O GLU A 44 2444 1759 2199 -382 -294 -380 O ATOM 720 CB GLU A 44 5.185 32.831 26.001 0.05 16.67 C ANISOU 720 CB GLU A 44 2462 1596 2276 -415 -145 -488 C ATOM 721 CG GLU A 44 6.038 31.682 26.488 0.05 16.68 C ANISOU 721 CG GLU A 44 2499 1518 2321 -413 -63 -537 C ATOM 722 CD GLU A 44 6.259 30.553 25.513 0.05 17.52 C ANISOU 722 CD GLU A 44 2615 1585 2457 -471 -45 -635 C ATOM 723 OE1 GLU A 44 6.397 29.454 26.033 0.05 17.55 O ANISOU 723 OE1 GLU A 44 2593 1532 2543 -489 -35 -637 O ATOM 724 OE2 GLU A 44 6.437 30.786 24.290 0.05 18.23 O ANISOU 724 OE2 GLU A 44 2742 1691 2492 -501 -31 -714 O ATOM 725 H GLU A 44 6.976 34.225 28.002 0.05 14.92 H ANISOU 725 H GLU A 44 2245 1306 2117 -297 -78 -342 H ATOM 726 HA GLU A 44 6.570 34.308 25.924 0.05 15.97 H ANISOU 726 HA GLU A 44 2408 1535 2124 -352 -131 -400 H ATOM 727 HB2 GLU A 44 4.293 32.721 26.358 0.05 16.71 H ANISOU 727 HB2 GLU A 44 2431 1587 2330 -427 -160 -487 H ATOM 728 HB3 GLU A 44 5.154 32.807 25.038 0.05 17.22 H ANISOU 728 HB3 GLU A 44 2544 1715 2282 -441 -177 -519 H ATOM 729 HG2 GLU A 44 6.913 32.025 26.720 0.05 16.70 H ANISOU 729 HG2 GLU A 44 2530 1537 2277 -401 -44 -542 H ATOM 730 HG3 GLU A 44 5.619 31.308 27.280 0.05 16.19 H ANISOU 730 HG3 GLU A 44 2427 1409 2317 -385 -37 -501 H ATOM 731 N THR A 45 5.172 36.514 26.584 0.05 15.53 N ANISOU 731 N THR A 45 2294 1535 2071 -299 -238 -269 N ATOM 732 CA THR A 45 4.454 37.744 26.247 0.05 15.73 C ANISOU 732 CA THR A 45 2306 1610 2061 -275 -311 -211 C ATOM 733 C THR A 45 5.457 38.886 26.087 0.05 15.45 C ANISOU 733 C THR A 45 2319 1575 1978 -244 -298 -148 C ATOM 734 O THR A 45 6.624 38.745 26.447 0.05 15.00 O ANISOU 734 O THR A 45 2288 1481 1931 -239 -232 -150 O ATOM 735 CB THR A 45 3.380 38.111 27.286 0.05 15.48 C ANISOU 735 CB THR A 45 2207 1563 2109 -243 -336 -178 C ATOM 736 OG1 THR A 45 4.011 38.330 28.540 0.05 14.68 O ANISOU 736 OG1 THR A 45 2112 1410 2055 -202 -290 -132 O ATOM 737 CG2 THR A 45 2.273 37.009 27.414 0.05 15.70 C ANISOU 737 CG2 THR A 45 2184 1578 2202 -279 -327 -234 C ATOM 738 H THR A 45 5.799 36.607 27.150 0.05 15.07 H ANISOU 738 H THR A 45 2245 1443 2039 -279 -201 -251 H ATOM 739 HA THR A 45 3.995 37.629 25.401 0.05 16.35 H ANISOU 739 HA THR A 45 2385 1734 2092 -298 -354 -234 H ATOM 740 HB THR A 45 2.955 38.941 27.014 0.05 15.81 H ANISOU 740 HB THR A 45 2237 1642 2129 -228 -391 -152 H ATOM 741 HG1 THR A 45 4.563 37.711 28.676 0.05 14.44 H ANISOU 741 HG1 THR A 45 2080 1349 2057 -210 -250 -152 H ATOM 742 HG21 THR A 45 2.042 36.659 26.541 0.05 16.31 H ANISOU 742 HG21 THR A 45 2238 1697 2260 -303 -373 -261 H ATOM 743 HG22 THR A 45 2.597 36.281 27.970 0.05 15.57 H ANISOU 743 HG22 THR A 45 2189 1529 2199 -300 -280 -267 H ATOM 744 HG23 THR A 45 1.477 37.378 27.823 0.05 15.43 H ANISOU 744 HG23 THR A 45 2116 1527 2222 -258 -319 -211 H ATOM 745 N LYS A 46 4.951 40.005 25.584 0.05 15.82 N ANISOU 745 N LYS A 46 2373 1659 1980 -223 -362 -92 N ATOM 746 CA LYS A 46 5.720 41.240 25.356 0.05 15.71 C ANISOU 746 CA LYS A 46 2407 1636 1928 -197 -356 -21 C ATOM 747 C LYS A 46 4.900 42.387 25.849 0.05 15.84 C ANISOU 747 C LYS A 46 2400 1650 1970 -149 -420 44 C ATOM 748 O LYS A 46 3.686 42.362 25.760 0.05 16.38 O ANISOU 748 O LYS A 46 2428 1756 2042 -140 -490 40 O ATOM 749 CB LYS A 46 5.980 41.463 23.858 0.05 16.45 C ANISOU 749 CB LYS A 46 2568 1781 1902 -231 -363 -17 C ATOM 750 CG LYS A 46 4.833 42.139 23.095 0.05 17.45 C ANISOU 750 CG LYS A 46 2698 1980 1954 -245 -453 -22 C ATOM 751 CD LYS A 46 5.187 42.400 21.649 0.05 18.30 C ANISOU 751 CD LYS A 46 2887 2136 1931 -261 -477 26 C ATOM 752 CE LYS A 46 5.008 43.883 21.301 0.05 18.45 C ANISOU 752 CE LYS A 46 2930 2133 1947 -213 -521 137 C ATOM 753 NZ LYS A 46 3.557 44.211 21.326 0.05 18.98 N ANISOU 753 NZ LYS A 46 2950 2224 2036 -168 -631 169 N ATOM 754 H LYS A 46 4.128 40.098 25.368 0.05 16.21 H ANISOU 754 H LYS A 46 2399 1737 2025 -222 -413 -92 H ATOM 755 HA LYS A 46 6.558 41.198 25.835 0.05 15.18 H ANISOU 755 HA LYS A 46 2343 1530 1895 -190 -304 -19 H ATOM 756 HB2 LYS A 46 6.770 42.017 23.750 0.05 16.44 H ANISOU 756 HB2 LYS A 46 2598 1768 1879 -219 -355 35 H ATOM 757 HB3 LYS A 46 6.136 40.600 23.439 0.05 16.41 H ANISOU 757 HB3 LYS A 46 2576 1775 1885 -259 -315 -64 H ATOM 758 HG2 LYS A 46 4.045 41.572 23.117 0.05 17.63 H ANISOU 758 HG2 LYS A 46 2707 2019 1972 -276 -448 -85 H ATOM 759 HG3 LYS A 46 4.638 43.006 23.483 0.05 17.51 H ANISOU 759 HG3 LYS A 46 2669 1986 1997 -215 -504 6 H ATOM 760 HD2 LYS A 46 6.111 42.144 21.490 0.05 18.19 H ANISOU 760 HD2 LYS A 46 2908 2115 1889 -285 -413 10 H ATOM 761 HD3 LYS A 46 4.589 41.890 21.076 0.05 18.99 H ANISOU 761 HD3 LYS A 46 2978 2275 1961 -280 -527 3 H ATOM 762 HE2 LYS A 46 5.454 44.417 21.974 0.05 17.77 H ANISOU 762 HE2 LYS A 46 2829 1994 1930 -193 -480 151 H ATOM 763 HE3 LYS A 46 5.380 44.076 20.437 0.05 18.93 H ANISOU 763 HE3 LYS A 46 3051 2212 1928 -229 -515 170 H ATOM 764 HZ1 LYS A 46 3.325 44.415 22.161 0.05 18.49 H ANISOU 764 HZ1 LYS A 46 2846 2125 2056 -138 -626 175 H ATOM 765 HZ2 LYS A 46 3.386 44.909 20.800 0.05 19.52 H ANISOU 765 HZ2 LYS A 46 3056 2306 2056 -152 -672 226 H ATOM 766 HZ3 LYS A 46 3.078 43.516 21.054 0.05 19.31 H ANISOU 766 HZ3 LYS A 46 2967 2307 2062 -187 -662 123 H ATOM 767 N SER A 47 5.560 43.474 26.273 0.05 15.48 N ANISOU 767 N SER A 47 2379 1560 1944 -118 -399 104 N ATOM 768 CA SER A 47 4.855 44.707 26.696 0.05 15.68 C ANISOU 768 CA SER A 47 2391 1565 2003 -63 -452 168 C ATOM 769 C SER A 47 4.602 45.688 25.543 0.05 16.62 C ANISOU 769 C SER A 47 2563 1714 2038 -53 -519 233 C ATOM 770 O SER A 47 5.121 45.497 24.468 0.05 17.02 O ANISOU 770 O SER A 47 2669 1799 1997 -94 -509 233 O ATOM 771 CB SER A 47 5.630 45.403 27.804 0.05 15.00 C ANISOU 771 CB SER A 47 2312 1409 1979 -36 -400 194 C ATOM 772 OG SER A 47 6.872 45.877 27.318 0.05 14.91 O ANISOU 772 OG SER A 47 2361 1378 1925 -64 -351 216 O ATOM 773 H SER A 47 6.412 43.519 26.338 0.05 15.16 H ANISOU 773 H SER A 47 2360 1497 1904 -127 -352 104 H ATOM 774 HA SER A 47 3.994 44.466 27.061 0.05 15.76 H ANISOU 774 HA SER A 47 2349 1585 2052 -47 -481 150 H ATOM 775 HB2 SER A 47 5.120 46.153 28.150 0.05 15.18 H ANISOU 775 HB2 SER A 47 2326 1412 2029 1 -430 229 H ATOM 776 HB3 SER A 47 5.805 44.748 28.497 0.05 14.52 H ANISOU 776 HB3 SER A 47 2219 1336 1963 -40 -367 157 H ATOM 777 HG SER A 47 6.751 46.457 26.725 0.05 15.29 H ANISOU 777 HG SER A 47 2440 1423 1946 -57 -373 259 H ATOM 778 N PHE A 48 3.801 46.732 25.806 0.05 17.05 N ANISOU 778 N PHE A 48 2597 1754 2127 6 -585 287 N ATOM 779 CA PHE A 48 3.344 47.720 24.817 0.05 18.12 C ANISOU 779 CA PHE A 48 2776 1909 2198 35 -668 363 C ATOM 780 C PHE A 48 4.477 48.708 24.635 0.05 18.11 C ANISOU 780 C PHE A 48 2861 1850 2169 30 -625 430 C ATOM 781 O PHE A 48 5.000 49.226 25.577 0.05 17.53 O ANISOU 781 O PHE A 48 2781 1708 2170 50 -578 437 O ATOM 782 CB PHE A 48 2.078 48.464 25.347 0.05 18.48 C ANISOU 782 CB PHE A 48 2755 1938 2330 113 -737 388 C ATOM 783 CG PHE A 48 1.194 49.083 24.270 0.05 19.71 C ANISOU 783 CG PHE A 48 2942 2106 2440 164 -838 472 C ATOM 784 CD1 PHE A 48 0.163 48.340 23.697 0.05 20.65 C ANISOU 784 CD1 PHE A 48 3025 2310 2509 169 -936 464 C ATOM 785 CD2 PHE A 48 1.347 50.422 23.872 0.05 20.04 C ANISOU 785 CD2 PHE A 48 3043 2070 2501 213 -844 558 C ATOM 786 CE1 PHE A 48 -0.670 48.911 22.723 0.05 21.92 C ANISOU 786 CE1 PHE A 48 3213 2486 2630 227 -1043 548 C ATOM 787 CE2 PHE A 48 0.526 50.974 22.904 0.05 21.30 C ANISOU 787 CE2 PHE A 48 3235 2231 2626 270 -942 644 C ATOM 788 CZ PHE A 48 -0.494 50.222 22.339 0.05 22.24 C ANISOU 788 CZ PHE A 48 3321 2442 2688 281 -1045 643 C ATOM 789 H PHE A 48 3.502 46.896 26.594 0.05 16.78 H ANISOU 789 H PHE A 48 2522 1695 2159 34 -582 280 H ATOM 790 HA PHE A 48 3.149 47.298 23.965 0.05 18.64 H ANISOU 790 HA PHE A 48 2858 2030 2194 10 -703 354 H ATOM 791 HB2 PHE A 48 1.528 47.858 25.857 0.05 18.45 H ANISOU 791 HB2 PHE A 48 2687 1968 2356 111 -754 340 H ATOM 792 HB3 PHE A 48 2.374 49.183 25.926 0.05 18.03 H ANISOU 792 HB3 PHE A 48 2693 1823 2334 136 -699 396 H ATOM 793 HD1 PHE A 48 0.033 47.459 23.951 0.05 20.50 H ANISOU 793 HD1 PHE A 48 2968 2337 2483 133 -932 403 H ATOM 794 HD2 PHE A 48 2.025 50.945 24.245 0.05 19.48 H ANISOU 794 HD2 PHE A 48 2993 1943 2466 206 -782 559 H ATOM 795 HE1 PHE A 48 -1.354 48.411 22.332 0.05 22.62 H ANISOU 795 HE1 PHE A 48 3277 2639 2680 230 -1115 541 H ATOM 796 HE2 PHE A 48 0.645 51.860 22.645 0.05 21.57 H ANISOU 796 HE2 PHE A 48 3316 2204 2676 300 -941 703 H ATOM 797 HZ PHE A 48 -1.044 50.591 21.689 0.05 23.16 H ANISOU 797 HZ PHE A 48 3460 2562 2779 324 -1117 705 H ATOM 798 N ARG A 49 4.888 48.925 23.401 0.05 18.87 N ANISOU 798 N ARG A 49 3038 1978 2153 -2 -639 476 N ATOM 799 CA ARG A 49 6.038 49.785 23.163 0.05 18.93 C ANISOU 799 CA ARG A 49 3128 1933 2132 -26 -580 534 C ATOM 800 C ARG A 49 5.623 51.240 23.184 0.05 19.52 C ANISOU 800 C ARG A 49 3239 1933 2243 32 -624 630 C ATOM 801 O ARG A 49 4.544 51.606 22.702 0.05 20.40 O ANISOU 801 O ARG A 49 3352 2063 2337 84 -720 679 O ATOM 802 CB ARG A 49 6.740 49.361 21.855 0.05 19.56 C ANISOU 802 CB ARG A 49 3286 2071 2075 -94 -553 544 C ATOM 803 CG ARG A 49 6.044 49.613 20.589 0.05 20.78 C ANISOU 803 CG ARG A 49 3483 2297 2115 -90 -644 585 C ATOM 804 CD ARG A 49 6.763 48.851 19.496 0.05 20.94 C ANISOU 804 CD ARG A 49 3521 2402 2035 -160 -608 512 C ATOM 805 NE ARG A 49 8.185 49.196 19.401 0.05 21.19 N ANISOU 805 NE ARG A 49 3634 2432 1985 -222 -516 533 N ATOM 806 CZ ARG A 49 8.894 49.139 18.259 0.05 22.40 C ANISOU 806 CZ ARG A 49 3887 2616 2009 -246 -535 612 C ATOM 807 NH1 ARG A 49 8.314 48.825 17.099 0.05 23.44 N ANISOU 807 NH1 ARG A 49 4050 2775 2081 -203 -652 684 N ATOM 808 NH2 ARG A 49 10.178 49.463 18.250 0.05 22.68 N ANISOU 808 NH2 ARG A 49 3989 2654 1975 -310 -437 624 N ATOM 809 H ARG A 49 4.544 48.582 22.692 0.05 19.40 H ANISOU 809 H ARG A 49 3116 2098 2159 -13 -680 474 H ATOM 810 HA ARG A 49 6.668 49.697 23.883 0.05 18.19 H ANISOU 810 HA ARG A 49 3011 1813 2088 -41 -520 495 H ATOM 811 HB2 ARG A 49 7.592 49.823 21.814 0.05 19.73 H ANISOU 811 HB2 ARG A 49 3360 2055 2080 -110 -515 590 H ATOM 812 HB3 ARG A 49 6.894 48.406 21.878 0.05 19.10 H ANISOU 812 HB3 ARG A 49 3205 2040 2013 -128 -507 478 H ATOM 813 HG2 ARG A 49 5.133 49.289 20.644 0.05 20.91 H ANISOU 813 HG2 ARG A 49 3450 2327 2166 -48 -712 579 H ATOM 814 HG3 ARG A 49 6.065 50.563 20.394 0.05 21.42 H ANISOU 814 HG3 ARG A 49 3630 2356 2151 -87 -654 660 H ATOM 815 HD2 ARG A 49 6.703 47.902 19.680 0.05 20.22 H ANISOU 815 HD2 ARG A 49 3373 2312 1999 -168 -575 439 H ATOM 816 HD3 ARG A 49 6.336 49.048 18.647 0.05 21.68 H ANISOU 816 HD3 ARG A 49 3625 2551 2061 -156 -676 519 H ATOM 817 HE ARG A 49 8.484 49.723 20.005 0.05 20.60 H ANISOU 817 HE ARG A 49 3546 2317 1963 -233 -453 518 H ATOM 818 HH11 ARG A 49 7.481 48.620 17.069 0.05 23.33 H ANISOU 818 HH11 ARG A 49 3985 2763 2117 -161 -715 674 H ATOM 819 HH12 ARG A 49 8.783 48.813 16.380 0.05 24.28 H ANISOU 819 HH12 ARG A 49 4227 2900 2100 -218 -666 741 H ATOM 820 HH21 ARG A 49 10.553 49.676 18.991 0.05 22.08 H ANISOU 820 HH21 ARG A 49 3887 2561 1941 -333 -365 578 H ATOM 821 HH22 ARG A 49 10.630 49.447 17.521 0.05 23.52 H ANISOU 821 HH22 ARG A 49 4164 2778 1994 -329 -444 679 H ATOM 822 N HIS A 50 6.446 52.056 23.828 0.05 19.11 N ANISOU 822 N HIS A 50 3214 1797 2250 27 -559 650 N ATOM 823 CA HIS A 50 6.162 53.474 23.788 0.05 19.78 C ANISOU 823 CA HIS A 50 3343 1796 2377 80 -595 737 C ATOM 824 C HIS A 50 7.449 54.250 23.843 0.05 19.78 C ANISOU 824 C HIS A 50 3415 1723 2378 29 -513 772 C ATOM 825 O HIS A 50 8.507 53.691 24.180 0.05 19.40 O ANISOU 825 O HIS A 50 3380 1704 2286 -46 -436 738 O ATOM 826 CB HIS A 50 5.181 53.868 24.909 0.05 19.39 C ANISOU 826 CB HIS A 50 3213 1700 2455 158 -624 705 C ATOM 827 CG HIS A 50 5.759 53.902 26.299 0.05 18.26 C ANISOU 827 CG HIS A 50 3025 1516 2398 140 -541 633 C ATOM 828 ND1 HIS A 50 5.039 54.360 27.380 0.05 17.42 N ANISOU 828 ND1 HIS A 50 2829 1447 2343 149 -526 548 N ATOM 829 CD2 HIS A 50 6.926 53.431 26.804 0.05 17.94 C ANISOU 829 CD2 HIS A 50 3020 1405 2391 108 -471 634 C ATOM 830 CE1 HIS A 50 5.777 54.280 28.471 0.05 16.66 C ANISOU 830 CE1 HIS A 50 2720 1305 2305 132 -457 507 C ATOM 831 NE2 HIS A 50 6.927 53.707 28.153 0.05 16.95 N ANISOU 831 NE2 HIS A 50 2827 1279 2333 107 -426 553 N ATOM 832 H HIS A 50 7.157 51.846 24.269 0.05 18.55 H ANISOU 832 H HIS A 50 3137 1714 2197 -6 -498 617 H ATOM 833 HA HIS A 50 5.741 53.663 22.940 0.05 20.62 H ANISOU 833 HA HIS A 50 3485 1923 2428 97 -654 791 H ATOM 834 HB2 HIS A 50 4.826 54.752 24.712 0.05 20.01 H ANISOU 834 HB2 HIS A 50 3320 1724 2559 201 -657 762 H ATOM 835 HB3 HIS A 50 4.460 53.220 24.926 0.05 19.37 H ANISOU 835 HB3 HIS A 50 3155 1751 2454 178 -665 674 H ATOM 836 HD2 HIS A 50 7.617 53.064 26.314 0.05 18.39 H ANISOU 836 HD2 HIS A 50 3138 1420 2431 90 -459 683 H ATOM 837 HE1 HIS A 50 5.511 54.542 29.322 0.05 16.08 H ANISOU 837 HE1 HIS A 50 2599 1243 2269 134 -434 455 H ATOM 838 N SER A 51 7.329 55.540 23.524 0.05 20.23 N ANISOU 838 N SER A 51 3506 1678 2501 70 -526 831 N ATOM 839 CA SER A 51 8.385 56.565 23.692 0.05 20.67 C ANISOU 839 CA SER A 51 3649 1655 2552 18 -464 888 C ATOM 840 C SER A 51 7.905 57.720 24.580 0.05 21.19 C ANISOU 840 C SER A 51 3741 1596 2713 78 -488 937 C ATOM 841 O SER A 51 6.699 57.941 24.701 0.05 21.73 O ANISOU 841 O SER A 51 3795 1644 2816 167 -571 970 O ATOM 842 CB SER A 51 8.903 57.074 22.327 0.05 21.83 C ANISOU 842 CB SER A 51 3896 1830 2567 -26 -474 979 C ATOM 843 OG SER A 51 7.886 57.649 21.523 0.05 23.04 O ANISOU 843 OG SER A 51 4110 1935 2711 43 -563 1082 O ATOM 844 H SER A 51 6.606 55.858 23.183 0.05 20.32 H ANISOU 844 H SER A 51 3490 1663 2567 126 -566 835 H ATOM 845 HA SER A 51 9.116 56.152 24.173 0.05 20.02 H ANISOU 845 HA SER A 51 3544 1577 2486 -29 -399 836 H ATOM 846 HB2 SER A 51 9.595 57.737 22.479 0.05 21.95 H ANISOU 846 HB2 SER A 51 3954 1814 2572 -83 -410 995 H ATOM 847 HB3 SER A 51 9.271 56.323 21.834 0.05 21.72 H ANISOU 847 HB3 SER A 51 3867 1901 2486 -44 -483 951 H ATOM 848 HG SER A 51 7.390 58.132 21.996 0.05 22.94 H ANISOU 848 HG SER A 51 4048 1938 2729 98 -616 1064 H ATOM 849 N HIS A 52 8.832 58.425 25.236 0.05 21.16 N ANISOU 849 N HIS A 52 3776 1507 2757 30 -416 940 N ATOM 850 CA HIS A 52 8.452 59.591 26.061 0.05 21.53 C ANISOU 850 CA HIS A 52 3837 1429 2913 85 -428 957 C ATOM 851 C HIS A 52 9.630 60.478 26.465 0.05 21.71 C ANISOU 851 C HIS A 52 3914 1359 2975 9 -347 962 C ATOM 852 O HIS A 52 10.779 60.060 26.459 0.05 21.16 O ANISOU 852 O HIS A 52 3829 1330 2880 -77 -274 916 O ATOM 853 CB HIS A 52 7.684 59.181 27.319 0.05 20.61 C ANISOU 853 CB HIS A 52 3618 1323 2891 149 -443 862 C ATOM 854 CG HIS A 52 8.268 57.987 28.043 0.05 19.30 C ANISOU 854 CG HIS A 52 3373 1243 2716 99 -389 759 C ATOM 855 ND1 HIS A 52 9.424 58.063 28.794 0.05 18.80 N ANISOU 855 ND1 HIS A 52 3314 1165 2666 21 -309 716 N ATOM 856 CD2 HIS A 52 7.852 56.690 28.141 0.05 18.50 C ANISOU 856 CD2 HIS A 52 3190 1240 2600 115 -404 695 C ATOM 857 CE1 HIS A 52 9.710 56.874 29.299 0.05 17.78 C ANISOU 857 CE1 HIS A 52 3111 1119 2526 0 -283 635 C ATOM 858 NE2 HIS A 52 8.765 56.019 28.930 0.05 17.57 N ANISOU 858 NE2 HIS A 52 3035 1156 2483 54 -336 622 N ATOM 859 H HIS A 52 9.676 58.269 25.214 0.05 21.02 H ANISOU 859 H HIS A 52 3775 1500 2712 -33 -362 931 H ATOM 860 HA HIS A 52 7.857 60.138 25.528 0.05 22.39 H ANISOU 860 HA HIS A 52 3989 1504 3013 131 -482 1027 H ATOM 861 HB2 HIS A 52 7.695 59.925 27.938 0.05 20.75 H ANISOU 861 HB2 HIS A 52 3647 1259 2979 166 -427 854 H ATOM 862 HB3 HIS A 52 6.769 58.977 27.069 0.05 20.84 H ANISOU 862 HB3 HIS A 52 3620 1379 2918 210 -503 875 H ATOM 863 HD2 HIS A 52 7.096 56.322 27.747 0.05 18.63 H ANISOU 863 HD2 HIS A 52 3178 1292 2609 159 -453 699 H ATOM 864 HE1 HIS A 52 10.438 56.669 29.842 0.05 17.35 H ANISOU 864 HE1 HIS A 52 3039 1074 2479 -44 -237 595 H ATOM 865 N ASN A 53 9.309 61.725 26.834 0.05 22.66 N ANISOU 865 N ASN A 53 4099 1348 3162 46 -364 1021 N ATOM 866 CA ASN A 53 10.302 62.727 27.277 0.05 22.99 C ANISOU 866 CA ASN A 53 4189 1274 3273 -15 -295 1015 C ATOM 867 C ASN A 53 10.893 62.435 28.650 0.05 21.85 C ANISOU 867 C ASN A 53 3960 1141 3202 -42 -244 888 C ATOM 868 O ASN A 53 11.981 62.904 28.965 0.05 21.83 O ANISOU 868 O ASN A 53 3969 1106 3218 -131 -176 858 O ATOM 869 CB ASN A 53 9.714 64.165 27.309 0.05 24.18 C ANISOU 869 CB ASN A 53 4410 1270 3509 54 -333 1079 C ATOM 870 CG ASN A 53 9.283 64.673 25.935 0.05 25.65 C ANISOU 870 CG ASN A 53 4702 1412 3631 80 -384 1225 C ATOM 871 OD1 ASN A 53 8.530 65.663 25.840 0.05 26.72 O ANISOU 871 OD1 ASN A 53 4890 1429 3832 162 -435 1287 O ATOM 872 ND2 ASN A 53 9.764 64.026 24.860 0.05 25.85 N ANISOU 872 ND2 ASN A 53 4767 1527 3527 13 -371 1281 N ATOM 873 H ASN A 53 8.503 62.018 26.846 0.05 23.20 H ANISOU 873 H ASN A 53 4184 1389 3243 109 -417 1063 H ATOM 874 HA ASN A 53 11.043 62.713 26.655 0.05 23.33 H ANISOU 874 HA ASN A 53 4277 1323 3263 -88 -255 1051 H ATOM 875 HB2 ASN A 53 8.939 64.176 27.893 0.05 23.93 H ANISOU 875 HB2 ASN A 53 4328 1235 3528 131 -371 1041 H ATOM 876 HB3 ASN A 53 10.392 64.766 27.651 0.05 24.37 H ANISOU 876 HB3 ASN A 53 4459 1218 3581 6 -284 1061 H ATOM 877 HD21 ASN A 53 9.366 64.106 24.103 0.05 26.47 H ANISOU 877 HD21 ASN A 53 4884 1622 3552 44 -419 1350 H ATOM 878 HD22 ASN A 53 10.466 63.536 24.924 0.05 25.41 H ANISOU 878 HD22 ASN A 53 4699 1514 3441 -61 -316 1248 H ATOM 879 N GLU A 54 10.153 61.718 29.482 0.05 21.06 N ANISOU 879 N GLU A 54 3775 1084 3141 35 -281 816 N ATOM 880 CA GLU A 54 10.612 61.425 30.825 0.05 20.09 C ANISOU 880 CA GLU A 54 3581 976 3078 20 -241 701 C ATOM 881 C GLU A 54 11.832 60.530 30.775 0.05 19.36 C ANISOU 881 C GLU A 54 3455 968 2934 -77 -183 657 C ATOM 882 O GLU A 54 11.947 59.688 29.840 0.05 19.15 O ANISOU 882 O GLU A 54 3420 1035 2821 -101 -185 683 O ATOM 883 CB GLU A 54 9.481 60.797 31.641 0.05 19.33 C ANISOU 883 CB GLU A 54 3396 944 3004 104 -280 637 C ATOM 884 CG GLU A 54 8.444 61.808 32.090 0.05 19.97 C ANISOU 884 CG GLU A 54 3478 966 3146 210 -335 660 C ATOM 885 CD GLU A 54 7.186 61.163 32.611 0.05 19.27 C ANISOU 885 CD GLU A 54 3301 917 3104 265 -336 568 C ATOM 886 OE1 GLU A 54 6.415 61.818 33.383 0.05 19.32 O ANISOU 886 OE1 GLU A 54 3301 859 3182 283 -309 507 O ATOM 887 OE2 GLU A 54 7.002 59.951 32.236 0.05 18.78 O ANISOU 887 OE2 GLU A 54 3180 954 3001 286 -363 560 O ATOM 888 H GLU A 54 9.376 61.401 29.297 0.05 21.12 H ANISOU 888 H GLU A 54 3767 1116 3142 94 -327 832 H ATOM 889 HA GLU A 54 10.877 62.248 31.259 0.05 20.48 H ANISOU 889 HA GLU A 54 3657 939 3186 15 -225 690 H ATOM 890 HB2 GLU A 54 9.045 60.135 31.084 0.05 18.95 H ANISOU 890 HB2 GLU A 54 3320 980 2901 100 -293 642 H ATOM 891 HB3 GLU A 54 9.847 60.369 32.432 0.05 18.79 H ANISOU 891 HB3 GLU A 54 3291 883 2966 89 -251 568 H ATOM 892 HG2 GLU A 54 8.815 62.328 32.815 0.05 20.67 H ANISOU 892 HG2 GLU A 54 3617 958 3279 218 -330 684 H ATOM 893 HG3 GLU A 54 8.210 62.386 31.344 0.05 20.25 H ANISOU 893 HG3 GLU A 54 3516 1036 3140 239 -378 711 H ATOM 894 N TYR A 55 12.704 60.690 31.770 0.05 19.04 N ANISOU 894 N TYR A 55 3389 903 2944 -127 -136 584 N ATOM 895 CA TYR A 55 13.828 59.776 32.049 0.05 18.28 C ANISOU 895 CA TYR A 55 3231 892 2821 -199 -89 518 C ATOM 896 C TYR A 55 13.264 58.551 32.735 0.05 17.20 C ANISOU 896 C TYR A 55 3012 850 2672 -144 -114 454 C ATOM 897 O TYR A 55 12.257 58.599 33.409 0.05 17.02 O ANISOU 897 O TYR A 55 2970 811 2686 -70 -148 430 O ATOM 898 CB TYR A 55 14.857 60.403 32.992 0.05 18.42 C ANISOU 898 CB TYR A 55 3240 853 2904 -259 -50 454 C ATOM 899 CG TYR A 55 15.358 61.730 32.487 0.05 19.54 C ANISOU 899 CG TYR A 55 3456 900 3067 -340 -10 506 C ATOM 900 CD1 TYR A 55 14.588 62.852 32.630 0.05 20.46 C ANISOU 900 CD1 TYR A 55 3646 882 3246 -321 -20 538 C ATOM 901 CD2 TYR A 55 16.586 61.845 31.829 0.05 19.75 C ANISOU 901 CD2 TYR A 55 3478 972 3055 -437 46 519 C ATOM 902 CE1 TYR A 55 15.003 64.043 32.150 0.05 21.62 C ANISOU 902 CE1 TYR A 55 3870 932 3413 -404 22 594 C ATOM 903 CE2 TYR A 55 17.034 63.085 31.365 0.05 20.86 C ANISOU 903 CE2 TYR A 55 3684 1030 3212 -523 93 569 C ATOM 904 CZ TYR A 55 16.210 64.145 31.517 0.05 21.80 C ANISOU 904 CZ TYR A 55 3883 1007 3392 -511 81 608 C ATOM 905 OH TYR A 55 16.586 65.400 31.075 0.05 23.00 O ANISOU 905 OH TYR A 55 4104 1072 3561 -608 136 660 O ATOM 906 H TYR A 55 12.648 61.329 32.332 0.05 19.33 H ANISOU 906 H TYR A 55 3441 871 3034 -118 -134 568 H ATOM 907 HA TYR A 55 14.267 59.520 31.226 0.05 18.44 H ANISOU 907 HA TYR A 55 3268 947 2793 -243 -69 552 H ATOM 908 HB2 TYR A 55 14.432 60.537 33.850 0.05 18.35 H ANISOU 908 HB2 TYR A 55 3226 808 2940 -215 -69 420 H ATOM 909 HB3 TYR A 55 15.623 59.821 33.083 0.05 17.91 H ANISOU 909 HB3 TYR A 55 3126 853 2826 -292 -30 409 H ATOM 910 HD1 TYR A 55 13.761 62.788 33.044 0.05 20.41 H ANISOU 910 HD1 TYR A 55 3639 845 3270 -253 -53 526 H ATOM 911 HD2 TYR A 55 17.130 61.102 31.722 0.05 19.20 H ANISOU 911 HD2 TYR A 55 3358 987 2948 -446 55 494 H ATOM 912 HE1 TYR A 55 14.467 64.791 32.266 0.05 22.31 H ANISOU 912 HE1 TYR A 55 4010 919 3548 -390 15 616 H ATOM 913 HE2 TYR A 55 17.849 63.170 30.922 0.05 21.04 H ANISOU 913 HE2 TYR A 55 3696 1090 3209 -590 136 574 H ATOM 914 HH TYR A 55 17.147 65.335 30.451 0.05 22.98 H ANISOU 914 HH TYR A 55 4080 1124 3529 -666 173 658 H ATOM 915 N GLU A 56 13.948 57.425 32.513 0.05 16.59 N ANISOU 915 N GLU A 56 2889 871 2544 -182 -90 427 N ATOM 916 CA GLU A 56 13.496 56.144 33.039 0.05 15.66 C ANISOU 916 CA GLU A 56 2700 837 2412 -141 -107 372 C ATOM 917 C GLU A 56 14.661 55.215 33.153 0.05 15.18 C ANISOU 917 C GLU A 56 2591 845 2333 -197 -65 323 C ATOM 918 O GLU A 56 15.545 55.211 32.333 0.05 15.54 O ANISOU 918 O GLU A 56 2650 906 2348 -259 -27 344 O ATOM 919 CB GLU A 56 12.463 55.587 32.085 0.05 15.68 C ANISOU 919 CB GLU A 56 2708 885 2364 -94 -147 417 C ATOM 920 CG GLU A 56 11.928 54.235 32.517 0.05 14.93 C ANISOU 920 CG GLU A 56 2547 855 2269 -41 -173 369 C ATOM 921 CD GLU A 56 10.634 53.905 31.772 0.05 15.28 C ANISOU 921 CD GLU A 56 2594 892 2319 31 -231 405 C ATOM 922 OE1 GLU A 56 9.687 53.308 32.372 0.05 15.00 O ANISOU 922 OE1 GLU A 56 2512 861 2326 85 -248 368 O ATOM 923 OE2 GLU A 56 10.597 54.276 30.586 0.05 15.93 O ANISOU 923 OE2 GLU A 56 2722 972 2359 31 -259 472 O ATOM 924 H GLU A 56 14.673 57.367 32.070 0.05 16.76 H ANISOU 924 H GLU A 56 2918 907 2541 -232 -62 439 H ATOM 925 HA GLU A 56 13.107 56.280 33.903 0.05 15.47 H ANISOU 925 HA GLU A 56 2660 792 2428 -107 -119 339 H ATOM 926 HB2 GLU A 56 11.707 56.186 32.045 0.05 16.17 H ANISOU 926 HB2 GLU A 56 2804 899 2440 -63 -174 456 H ATOM 927 HB3 GLU A 56 12.867 55.503 31.212 0.05 15.82 H ANISOU 927 HB3 GLU A 56 2740 936 2334 -131 -132 439 H ATOM 928 HG2 GLU A 56 12.600 53.572 32.311 0.05 14.68 H ANISOU 928 HG2 GLU A 56 2500 880 2199 -64 -162 361 H ATOM 929 HG3 GLU A 56 11.743 54.264 33.462 0.05 14.58 H ANISOU 929 HG3 GLU A 56 2476 805 2261 -32 -162 325 H ATOM 930 N ALEU A 57 14.606 54.412 34.215 0.02 14.49 N ANISOU 930 N ALEU A 57 2444 795 2266 -171 -71 259 N ATOM 931 N BLEU A 57 14.608 54.400 34.206 0.03 14.49 N ANISOU 931 N BLEU A 57 2445 795 2265 -171 -71 259 N ATOM 932 CA ALEU A 57 15.582 53.375 34.554 0.02 14.03 C ANISOU 932 CA ALEU A 57 2328 800 2201 -199 -46 206 C ATOM 933 CA BLEU A 57 15.604 53.373 34.525 0.03 14.04 C ANISOU 933 CA BLEU A 57 2331 802 2202 -200 -45 208 C ATOM 934 C ALEU A 57 14.821 52.075 34.821 0.02 13.36 C ANISOU 934 C ALEU A 57 2206 774 2096 -148 -65 185 C ATOM 935 C BLEU A 57 14.867 52.076 34.873 0.03 13.36 C ANISOU 935 C BLEU A 57 2206 774 2096 -149 -64 185 C ATOM 936 O ALEU A 57 13.786 52.099 35.459 0.02 13.14 O ANISOU 936 O ALEU A 57 2174 733 2086 -98 -91 175 O ATOM 937 O BLEU A 57 13.887 52.105 35.606 0.03 13.14 O ANISOU 937 O BLEU A 57 2174 732 2087 -98 -91 174 O ATOM 938 CB ALEU A 57 16.377 53.740 35.831 0.02 14.01 C ANISOU 938 CB ALEU A 57 2299 777 2247 -213 -44 149 C ATOM 939 CB BLEU A 57 16.482 53.790 35.730 0.03 14.05 C ANISOU 939 CB BLEU A 57 2306 782 2250 -219 -41 152 C ATOM 940 CG ALEU A 57 17.008 52.621 36.667 0.02 13.49 C ANISOU 940 CG ALEU A 57 2172 771 2183 -200 -49 92 C ATOM 941 CG BLEU A 57 17.657 52.945 36.233 0.03 13.79 C ANISOU 941 CG BLEU A 57 2209 812 2219 -243 -26 103 C ATOM 942 CD1ALEU A 57 18.478 52.570 36.345 0.02 13.58 C ANISOU 942 CD1ALEU A 57 2141 833 2187 -247 -19 78 C ATOM 943 CD1BLEU A 57 18.790 52.949 35.225 0.03 14.21 C ANISOU 943 CD1BLEU A 57 2253 887 2260 -307 17 118 C ATOM 944 CD2ALEU A 57 16.780 52.844 38.137 0.02 13.64 C ANISOU 944 CD2ALEU A 57 2186 761 2236 -200 -66 43 C ATOM 945 CD2BLEU A 57 18.127 53.475 37.594 0.03 13.91 C ANISOU 945 CD2BLEU A 57 2202 812 2271 -253 -41 48 C ATOM 946 H ALEU A 57 13.968 54.432 34.779 0.05 14.32 H ANISOU 946 H ALEU A 57 2416 763 2262 -131 -91 245 H ATOM 947 H BLEU A 57 13.968 54.404 34.768 0.05 14.31 H ANISOU 947 H BLEU A 57 2415 763 2261 -131 -91 245 H ATOM 948 HA ALEU A 57 16.192 53.273 33.812 0.05 14.25 H ANISOU 948 HA ALEU A 57 2357 846 2209 -240 -20 218 H ATOM 949 HA BLEU A 57 16.164 53.249 33.748 0.05 14.26 H ANISOU 949 HA BLEU A 57 2361 849 2208 -240 -19 222 H ATOM 950 HB2ALEU A 57 17.101 54.318 35.564 0.05 14.41 H ANISOU 950 HB2ALEU A 57 2355 811 2308 -262 -23 151 H ATOM 951 HB2BLEU A 57 16.860 54.657 35.502 0.05 14.54 H ANISOU 951 HB2BLEU A 57 2395 799 2331 -253 -30 164 H ATOM 952 HB3ALEU A 57 15.797 54.211 36.436 0.05 14.09 H ANISOU 952 HB3ALEU A 57 2329 747 2278 -186 -61 146 H ATOM 953 HB3BLEU A 57 15.914 53.907 36.499 0.05 13.86 H ANISOU 953 HB3BLEU A 57 2282 745 2241 -180 -62 135 H ATOM 954 HG ALEU A 57 16.595 51.790 36.430 0.05 13.11 H ANISOU 954 HG ALEU A 57 2116 747 2119 -161 -61 93 H ATOM 955 HG BLEU A 57 17.344 52.039 36.359 0.05 13.36 H ANISOU 955 HG BLEU A 57 2135 795 2147 -210 -35 96 H ATOM 956 HD11ALEU A 57 18.816 51.671 36.480 0.05 13.26 H ANISOU 956 HD11ALEU A 57 2064 830 2145 -224 -28 52 H ATOM 957 HD11BLEU A 57 18.721 52.162 34.660 0.05 13.98 H ANISOU 957 HD11BLEU A 57 2204 902 2205 -297 26 118 H ATOM 958 HD12ALEU A 57 18.598 52.827 35.419 0.05 13.65 H ANISOU 958 HD12ALEU A 57 2162 854 2172 -257 -2 107 H ATOM 959 HD12BLEU A 57 18.725 53.749 34.683 0.05 14.59 H ANISOU 959 HD12BLEU A 57 2345 899 2301 -327 27 156 H ATOM 960 HD13ALEU A 57 18.947 53.197 36.922 0.05 13.97 H ANISOU 960 HD13ALEU A 57 2185 864 2259 -287 -9 66 H ATOM 961 HD13BLEU A 57 19.640 52.942 35.693 0.05 14.42 H ANISOU 961 HD13BLEU A 57 2248 919 2312 -340 27 87 H ATOM 962 HD21ALEU A 57 17.543 52.526 38.646 0.05 13.43 H ANISOU 962 HD21ALEU A 57 2123 776 2205 -196 -72 13 H ATOM 963 HD21BLEU A 57 19.055 53.239 37.745 0.05 14.02 H ANISOU 963 HD21BLEU A 57 2178 856 2292 -283 -31 25 H ATOM 964 HD22ALEU A 57 16.673 53.798 38.306 0.05 14.09 H ANISOU 964 HD22ALEU A 57 2255 786 2314 -242 -55 40 H ATOM 965 HD22BLEU A 57 18.037 54.443 37.559 0.05 14.31 H ANISOU 965 HD22BLEU A 57 2286 808 2343 -272 -40 55 H ATOM 966 HD23ALEU A 57 15.970 52.382 38.393 0.05 13.58 H ANISOU 966 HD23ALEU A 57 2200 728 2233 -164 -80 43 H ATOM 967 HD23BLEU A 57 17.568 53.110 38.296 0.05 13.57 H ANISOU 967 HD23BLEU A 57 2153 781 2224 -211 -62 31 H ATOM 968 N PHE A 58 15.372 50.945 34.370 0.05 13.13 N ANISOU 968 N PHE A 58 2149 806 2036 -164 -45 173 N ATOM 969 CA PHE A 58 14.880 49.631 34.776 0.05 12.57 C ANISOU 969 CA PHE A 58 2041 780 1957 -126 -55 145 C ATOM 970 C PHE A 58 15.938 48.973 35.657 0.05 12.35 C ANISOU 970 C PHE A 58 1965 776 1950 -133 -40 98 C ATOM 971 O PHE A 58 17.119 48.930 35.309 0.05 12.60 O ANISOU 971 O PHE A 58 1977 826 1985 -172 -12 86 O ATOM 972 CB PHE A 58 14.672 48.660 33.602 0.05 12.57 C ANISOU 972 CB PHE A 58 2042 824 1910 -130 -49 155 C ATOM 973 CG PHE A 58 13.614 49.019 32.611 0.05 12.88 C ANISOU 973 CG PHE A 58 2120 857 1915 -116 -79 200 C ATOM 974 CD1 PHE A 58 12.687 50.026 32.800 0.05 13.11 C ANISOU 974 CD1 PHE A 58 2174 839 1966 -88 -111 232 C ATOM 975 CD2 PHE A 58 13.556 48.266 31.443 0.05 13.03 C ANISOU 975 CD2 PHE A 58 2147 921 1881 -127 -79 204 C ATOM 976 CE1 PHE A 58 11.727 50.271 31.858 0.05 13.51 C ANISOU 976 CE1 PHE A 58 2253 889 1990 -66 -149 276 C ATOM 977 CE2 PHE A 58 12.603 48.481 30.518 0.05 13.42 C ANISOU 977 CE2 PHE A 58 2228 977 1895 -113 -119 244 C ATOM 978 CZ PHE A 58 11.687 49.465 30.705 0.05 13.67 C ANISOU 978 CZ PHE A 58 2279 963 1952 -80 -158 283 C ATOM 979 H APHE A 58 16.038 50.920 33.836 0.05 13.35 H ANISOU 979 H APHE A 58 2179 846 2048 -197 -22 180 H ATOM 980 H BPHE A 58 16.006 50.921 33.799 0.05 13.35 H ANISOU 980 H BPHE A 58 2179 846 2048 -197 -22 180 H ATOM 981 HA PHE A 58 14.057 49.722 35.266 0.05 12.43 H ANISOU 981 HA PHE A 58 2025 747 1951 -93 -77 144 H ATOM 982 HB2 PHE A 58 15.505 48.574 33.125 0.05 12.77 H ANISOU 982 HB2 PHE A 58 2066 866 1920 -162 -21 152 H ATOM 983 HB3 PHE A 58 14.446 47.808 34.000 0.05 12.25 H ANISOU 983 HB3 PHE A 58 1976 802 1874 -109 -52 131 H ATOM 984 HD1 PHE A 58 12.712 50.534 33.573 0.05 13.07 H ANISOU 984 HD1 PHE A 58 2168 802 1995 -82 -109 223 H ATOM 985 HD2 PHE A 58 14.169 47.574 31.323 0.05 12.93 H ANISOU 985 HD2 PHE A 58 2118 937 1858 -143 -54 177 H ATOM 986 HE1 PHE A 58 11.098 50.942 31.974 0.05 13.74 H ANISOU 986 HE1 PHE A 58 2297 883 2041 -40 -172 298 H ATOM 987 HE2 PHE A 58 12.585 47.966 29.746 0.05 13.59 H ANISOU 987 HE2 PHE A 58 2255 1032 1875 -124 -122 242 H ATOM 988 HZ PHE A 58 11.047 49.638 30.051 0.05 14.01 H ANISOU 988 HZ PHE A 58 2340 1012 1973 -65 -191 313 H ATOM 989 N ILE A 59 15.451 48.420 36.754 0.05 11.98 N ANISOU 989 N ILE A 59 1900 735 1916 -94 -59 76 N ATOM 990 CA ILE A 59 16.233 47.561 37.649 0.05 11.81 C ANISOU 990 CA ILE A 59 1840 741 1908 -84 -58 42 C ATOM 991 C ILE A 59 15.663 46.118 37.457 0.05 11.50 C ANISOU 991 C ILE A 59 1789 726 1855 -54 -55 40 C ATOM 992 O ILE A 59 14.523 45.856 37.789 0.05 11.30 O ANISOU 992 O ILE A 59 1776 693 1824 -28 -67 48 O ATOM 993 CB ILE A 59 16.065 47.980 39.118 0.05 11.79 C ANISOU 993 CB ILE A 59 1838 723 1918 -64 -81 22 C ATOM 994 CG1 ILE A 59 16.506 49.445 39.352 0.05 12.20 C ANISOU 994 CG1 ILE A 59 1906 739 1990 -97 -85 14 C ATOM 995 CG2 ILE A 59 16.800 47.008 40.068 0.05 11.73 C ANISOU 995 CG2 ILE A 59 1797 749 1912 -45 -92 -2 C ATOM 996 CD1 ILE A 59 15.905 50.056 40.602 0.05 12.27 C ANISOU 996 CD1 ILE A 59 1934 724 2005 -76 -104 -9 C ATOM 997 H ILE A 59 14.648 48.524 37.016 0.05 11.88 H ANISOU 997 H ILE A 59 1898 710 1905 -70 -73 82 H ATOM 998 HA ILE A 59 17.163 47.577 37.398 0.05 12.01 H ANISOU 998 HA ILE A 59 1846 779 1939 -109 -44 32 H ATOM 999 HB ILE A 59 15.123 47.934 39.325 0.05 11.64 H ANISOU 999 HB ILE A 59 1835 695 1894 -40 -88 30 H ATOM 1000 HG12 ILE A 59 17.468 49.449 39.452 0.05 12.38 H ANISOU 1000 HG12 ILE A 59 1904 778 2022 -121 -81 -2 H ATOM 1001 HG13 ILE A 59 16.235 49.965 38.585 0.05 12.33 H ANISOU 1001 HG13 ILE A 59 1944 734 2005 -111 -76 37 H ATOM 1002 HG21 ILE A 59 16.637 47.227 40.995 0.05 11.75 H ANISOU 1002 HG21 ILE A 59 1807 748 1911 -31 -108 -13 H ATOM 1003 HG22 ILE A 59 16.457 46.120 39.892 0.05 11.54 H ANISOU 1003 HG22 ILE A 59 1768 737 1881 -27 -86 5 H ATOM 1004 HG23 ILE A 59 17.745 47.041 39.861 0.05 11.94 H ANISOU 1004 HG23 ILE A 59 1799 788 1950 -66 -89 -14 H ATOM 1005 HD11 ILE A 59 16.168 50.989 40.642 0.05 12.58 H ANISOU 1005 HD11 ILE A 59 1990 730 2061 -99 -103 -13 H ATOM 1006 HD12 ILE A 59 14.937 49.993 40.563 0.05 12.11 H ANISOU 1006 HD12 ILE A 59 1927 695 1977 -47 -105 3 H ATOM 1007 HD13 ILE A 59 16.240 49.591 41.384 0.05 12.27 H ANISOU 1007 HD13 ILE A 59 1916 746 2000 -71 -116 -32 H ATOM 1008 N VAL A 60 16.468 45.254 36.855 0.05 11.59 N ANISOU 1008 N VAL A 60 1776 762 1864 -64 -33 27 N ATOM 1009 CA VAL A 60 15.972 43.897 36.536 0.05 11.43 C ANISOU 1009 CA VAL A 60 1752 754 1837 -43 -25 20 C ATOM 1010 C VAL A 60 16.073 43.025 37.775 0.05 11.30 C ANISOU 1010 C VAL A 60 1720 734 1840 -7 -37 10 C ATOM 1011 O VAL A 60 17.109 42.895 38.383 0.05 11.46 O ANISOU 1011 O VAL A 60 1714 763 1878 3 -44 -2 O ATOM 1012 CB VAL A 60 16.729 43.330 35.368 0.05 11.70 C ANISOU 1012 CB VAL A 60 1772 810 1862 -65 9 2 C ATOM 1013 CG1 VAL A 60 16.169 41.929 35.020 0.05 11.64 C ANISOU 1013 CG1 VAL A 60 1766 803 1852 -46 18 -15 C ATOM 1014 CG2 VAL A 60 16.650 44.248 34.160 0.05 11.96 C ANISOU 1014 CG2 VAL A 60 1833 851 1860 -105 23 21 C ATOM 1015 H VAL A 60 17.270 45.389 36.607 0.05 11.78 H ANISOU 1015 H VAL A 60 1785 797 1895 -82 -21 18 H ATOM 1016 HA VAL A 60 15.045 43.976 36.285 0.05 11.34 H ANISOU 1016 HA VAL A 60 1759 736 1812 -41 -33 32 H ATOM 1017 HB VAL A 60 17.651 43.211 35.617 0.05 11.85 H ANISOU 1017 HB VAL A 60 1764 838 1900 -64 18 -13 H ATOM 1018 HG11 VAL A 60 16.652 41.597 34.250 0.05 11.87 H ANISOU 1018 HG11 VAL A 60 1791 847 1871 -60 43 -31 H ATOM 1019 HG12 VAL A 60 16.295 41.337 35.773 0.05 11.58 H ANISOU 1019 HG12 VAL A 60 1745 787 1868 -21 13 -22 H ATOM 1020 HG13 VAL A 60 15.225 42.011 34.815 0.05 11.51 H ANISOU 1020 HG13 VAL A 60 1770 782 1822 -46 5 -3 H ATOM 1021 HG21 VAL A 60 15.718 44.422 33.969 0.05 11.87 H ANISOU 1021 HG21 VAL A 60 1846 833 1831 -100 6 37 H ATOM 1022 HG22 VAL A 60 17.110 45.076 34.357 0.05 12.08 H ANISOU 1022 HG22 VAL A 60 1849 858 1883 -121 22 31 H ATOM 1023 HG23 VAL A 60 17.067 43.805 33.405 0.05 12.18 H ANISOU 1023 HG23 VAL A 60 1855 898 1876 -120 50 6 H ATOM 1024 N ILE A 61 14.932 42.448 38.119 0.05 11.11 N ANISOU 1024 N ILE A 61 1713 698 1810 12 -43 19 N ATOM 1025 CA ILE A 61 14.776 41.711 39.385 0.05 11.08 C ANISOU 1025 CA ILE A 61 1710 685 1814 43 -51 23 C ATOM 1026 C ILE A 61 14.889 40.181 39.222 0.05 11.19 C ANISOU 1026 C ILE A 61 1722 687 1842 59 -36 19 C ATOM 1027 O ILE A 61 15.634 39.563 39.981 0.05 11.37 O ANISOU 1027 O ILE A 61 1740 703 1876 87 -45 24 O ATOM 1028 CB ILE A 61 13.442 42.181 40.037 0.05 10.95 C ANISOU 1028 CB ILE A 61 1714 660 1786 48 -58 36 C ATOM 1029 CG1 ILE A 61 13.598 43.635 40.528 0.05 11.00 C ANISOU 1029 CG1 ILE A 61 1726 667 1788 44 -74 32 C ATOM 1030 CG2 ILE A 61 12.936 41.247 41.145 0.05 11.00 C ANISOU 1030 CG2 ILE A 61 1732 657 1790 68 -50 47 C ATOM 1031 CD1 ILE A 61 12.356 44.227 41.017 0.05 10.99 C ANISOU 1031 CD1 ILE A 61 1741 655 1781 55 -75 35 C ATOM 1032 H ILE A 61 14.222 42.493 37.652 0.05 11.06 H ANISOU 1032 H ILE A 61 1717 690 1795 5 -41 25 H ATOM 1033 HA ILE A 61 15.497 41.951 39.980 0.05 11.18 H ANISOU 1033 HA ILE A 61 1714 704 1831 50 -63 20 H ATOM 1034 HB ILE A 61 12.768 42.187 39.346 0.05 10.90 H ANISOU 1034 HB ILE A 61 1710 653 1779 37 -53 38 H ATOM 1035 HG12 ILE A 61 14.249 43.636 41.240 0.05 11.11 H ANISOU 1035 HG12 ILE A 61 1734 686 1799 53 -84 27 H ATOM 1036 HG13 ILE A 61 13.911 44.161 39.783 0.05 11.04 H ANISOU 1036 HG13 ILE A 61 1727 671 1796 27 -74 31 H ATOM 1037 HG21 ILE A 61 12.056 41.521 41.427 0.05 10.99 H ANISOU 1037 HG21 ILE A 61 1739 655 1781 70 -48 51 H ATOM 1038 HG22 ILE A 61 12.892 40.355 40.783 0.05 11.01 H ANISOU 1038 HG22 ILE A 61 1733 651 1800 64 -38 46 H ATOM 1039 HG23 ILE A 61 13.544 41.290 41.894 0.05 11.11 H ANISOU 1039 HG23 ILE A 61 1748 674 1802 83 -59 49 H ATOM 1040 HD11 ILE A 61 11.716 44.231 40.290 0.05 10.95 H ANISOU 1040 HD11 ILE A 61 1734 646 1781 50 -71 41 H ATOM 1041 HD12 ILE A 61 12.011 43.700 41.755 0.05 11.01 H ANISOU 1041 HD12 ILE A 61 1748 661 1776 68 -69 37 H ATOM 1042 HD13 ILE A 61 12.540 45.129 41.325 0.05 11.09 H ANISOU 1042 HD13 ILE A 61 1759 662 1793 52 -84 27 H ATOM 1043 N GLN A 62 14.179 39.609 38.263 0.05 11.18 N ANISOU 1043 N GLN A 62 1728 681 1841 42 -18 9 N ATOM 1044 CA GLN A 62 14.107 38.133 38.188 0.05 11.38 C ANISOU 1044 CA GLN A 62 1758 680 1887 53 1 -1 C ATOM 1045 C GLN A 62 13.742 37.761 36.785 0.05 11.49 C ANISOU 1045 C GLN A 62 1774 699 1893 23 18 -29 C ATOM 1046 O GLN A 62 12.946 38.428 36.110 0.05 11.40 O ANISOU 1046 O GLN A 62 1767 708 1856 -3 9 -27 O ATOM 1047 CB GLN A 62 13.058 37.642 39.186 0.05 11.37 C ANISOU 1047 CB GLN A 62 1777 656 1888 60 1 23 C ATOM 1048 CG GLN A 62 12.601 36.150 39.043 0.05 11.68 C ANISOU 1048 CG GLN A 62 1832 653 1953 64 23 20 C ATOM 1049 CD GLN A 62 11.481 35.867 40.018 0.05 11.75 C ANISOU 1049 CD GLN A 62 1862 645 1960 58 32 48 C ATOM 1050 OE1 GLN A 62 11.209 36.718 40.847 0.05 11.70 O ANISOU 1050 OE1 GLN A 62 1865 650 1932 74 22 75 O ATOM 1051 NE2 GLN A 62 10.848 34.719 39.958 0.05 11.98 N ANISOU 1051 NE2 GLN A 62 1897 646 2007 30 56 38 N ATOM 1052 H GLN A 62 13.736 39.991 37.651 0.05 11.14 H ANISOU 1052 H GLN A 62 1725 683 1823 24 -17 7 H ATOM 1053 HA GLN A 62 14.982 37.798 38.419 0.05 11.54 H ANISOU 1053 HA GLN A 62 1768 696 1922 72 1 -5 H ATOM 1054 HB2 GLN A 62 13.431 37.742 40.071 0.05 11.37 H ANISOU 1054 HB2 GLN A 62 1780 658 1882 78 -11 39 H ATOM 1055 HB3 GLN A 62 12.270 38.192 39.123 0.05 11.26 H ANISOU 1055 HB3 GLN A 62 1763 651 1863 43 -1 24 H ATOM 1056 HG2 GLN A 62 12.262 36.012 38.148 0.05 11.73 H ANISOU 1056 HG2 GLN A 62 1835 659 1964 43 33 -3 H ATOM 1057 HG3 GLN A 62 13.351 35.580 39.240 0.05 11.86 H ANISOU 1057 HG3 GLN A 62 1854 662 1989 89 21 24 H ATOM 1058 HE21 GLN A 62 10.047 34.667 40.277 0.05 12.02 H ANISOU 1058 HE21 GLN A 62 1906 651 2012 16 65 48 H ATOM 1059 HE22 GLN A 62 11.221 34.040 39.577 0.05 12.13 H ANISOU 1059 HE22 GLN A 62 1918 648 2043 24 64 18 H ATOM 1060 N GLY A 63 14.287 36.621 36.335 0.05 11.81 N ANISOU 1060 N GLY A 63 1813 719 1955 30 42 -57 N ATOM 1061 CA GLY A 63 13.971 36.109 35.018 0.05 12.05 C ANISOU 1061 CA GLY A 63 1851 755 1973 -1 61 -96 C ATOM 1062 C GLY A 63 14.983 36.636 34.050 0.05 12.23 C ANISOU 1062 C GLY A 63 1863 814 1969 -16 78 -121 C ATOM 1063 O GLY A 63 15.753 37.499 34.442 0.05 12.23 O ANISOU 1063 O GLY A 63 1841 828 1979 0 83 -114 O ATOM 1064 H GLY A 63 14.863 36.168 36.773 0.05 11.95 H ANISOU 1064 H GLY A 63 1827 719 1994 53 46 -56 H ATOM 1065 HA2 GLY A 63 14.023 35.138 35.016 0.05 12.30 H ANISOU 1065 HA2 GLY A 63 1889 756 2028 6 77 -114 H ATOM 1066 HA3 GLY A 63 13.082 36.368 34.743 0.05 11.97 H ANISOU 1066 HA3 GLY A 63 1848 754 1944 -23 49 -91 H ATOM 1067 N ASN A 64 14.983 36.069 32.848 0.05 12.48 N ANISOU 1067 N ASN A 64 1911 867 1965 -51 89 -151 N ATOM 1068 CA ASN A 64 15.736 36.505 31.670 0.05 12.83 C ANISOU 1068 CA ASN A 64 1957 950 1970 -74 117 -179 C ATOM 1069 C ASN A 64 14.729 37.086 30.687 0.05 12.90 C ANISOU 1069 C ASN A 64 1991 999 1911 -114 93 -166 C ATOM 1070 O ASN A 64 13.650 36.480 30.556 0.05 12.88 O ANISOU 1070 O ASN A 64 2001 997 1898 -127 62 -164 O ATOM 1071 CB ASN A 64 16.312 35.223 31.052 0.05 13.39 C ANISOU 1071 CB ASN A 64 2030 1004 2053 -74 160 -245 C ATOM 1072 CG ASN A 64 17.797 35.285 30.776 0.05 13.56 C ANISOU 1072 CG ASN A 64 2020 996 2136 -28 188 -259 C ATOM 1073 OD1 ASN A 64 18.200 35.457 29.612 0.05 13.81 O ANISOU 1073 OD1 ASN A 64 2024 1057 2167 -25 218 -274 O ATOM 1074 ND2 ASN A 64 18.610 34.984 31.797 0.05 13.53 N ANISOU 1074 ND2 ASN A 64 2017 935 2190 8 178 -251 N ATOM 1075 H ASN A 64 14.534 35.355 32.684 0.05 12.52 H ANISOU 1075 H ASN A 64 1926 867 1963 -66 79 -157 H ATOM 1076 HA ASN A 64 16.448 37.120 31.893 0.05 12.79 H ANISOU 1076 HA ASN A 64 1934 953 1972 -65 125 -167 H ATOM 1077 HB2 ASN A 64 16.172 34.490 31.670 0.05 13.43 H ANISOU 1077 HB2 ASN A 64 2049 986 2069 -79 151 -257 H ATOM 1078 HB3 ASN A 64 15.859 35.050 30.213 0.05 13.68 H ANISOU 1078 HB3 ASN A 64 2077 1074 2049 -99 179 -267 H ATOM 1079 HD21 ASN A 64 18.287 34.775 32.566 0.05 13.37 H ANISOU 1079 HD21 ASN A 64 2013 897 2168 0 159 -236 H ATOM 1080 HD22 ASN A 64 19.461 34.957 31.669 0.05 13.74 H ANISOU 1080 HD22 ASN A 64 2027 940 2253 40 190 -260 H ATOM 1081 N ALA A 65 15.079 38.174 29.960 0.05 13.12 N ANISOU 1081 N ALA A 65 2029 1064 1893 -137 109 -157 N ATOM 1082 CA ALA A 65 14.237 38.800 28.912 0.05 13.36 C ANISOU 1082 CA ALA A 65 2093 1131 1851 -170 81 -135 C ATOM 1083 C ALA A 65 14.926 39.857 28.013 0.05 13.81 C ANISOU 1083 C ALA A 65 2168 1225 1855 -200 120 -132 C ATOM 1084 O ALA A 65 16.009 40.318 28.341 0.05 13.85 O ANISOU 1084 O ALA A 65 2146 1225 1890 -196 164 -141 O ATOM 1085 CB ALA A 65 12.943 39.338 29.511 0.05 12.97 C ANISOU 1085 CB ALA A 65 2046 1072 1810 -157 28 -75 C ATOM 1086 H ALA A 65 15.831 38.570 30.055 0.05 13.22 H ANISOU 1086 H ALA A 65 2029 1082 1913 -135 135 -162 H ATOM 1087 HA ALA A 65 13.974 38.065 28.323 0.05 13.59 H ANISOU 1087 HA ALA A 65 2134 1170 1860 -183 74 -163 H ATOM 1088 HB1 ALA A 65 12.557 39.988 28.909 0.05 13.22 H ANISOU 1088 HB1 ALA A 65 2099 1127 1796 -172 3 -59 H ATOM 1089 HB2 ALA A 65 12.326 38.599 29.644 0.05 12.71 H ANISOU 1089 HB2 ALA A 65 1999 1019 1813 -139 12 -78 H ATOM 1090 HB3 ALA A 65 13.136 39.770 30.353 0.05 12.82 H ANISOU 1090 HB3 ALA A 65 2021 1045 1805 -151 35 -50 H ATOM 1091 N ILE A 66 14.296 40.287 26.911 0.05 14.26 N ANISOU 1091 N ILE A 66 2267 1320 1830 -232 100 -117 N ATOM 1092 CA ILE A 66 14.972 41.207 25.965 0.05 14.77 C ANISOU 1092 CA ILE A 66 2367 1419 1826 -268 126 -85 C ATOM 1093 C ILE A 66 14.354 42.580 26.046 0.05 14.62 C ANISOU 1093 C ILE A 66 2372 1387 1798 -263 72 -4 C ATOM 1094 O ILE A 66 13.149 42.720 25.972 0.05 14.60 O ANISOU 1094 O ILE A 66 2382 1386 1780 -249 8 17 O ATOM 1095 CB ILE A 66 14.980 40.603 24.546 0.05 15.57 C ANISOU 1095 CB ILE A 66 2515 1574 1826 -306 135 -114 C ATOM 1096 CG1 ILE A 66 15.806 39.317 24.569 0.05 15.83 C ANISOU 1096 CG1 ILE A 66 2530 1613 1872 -309 190 -205 C ATOM 1097 CG2 ILE A 66 15.564 41.562 23.577 0.05 16.22 C ANISOU 1097 CG2 ILE A 66 2644 1692 1827 -348 168 -71 C ATOM 1098 CD1 ILE A 66 15.835 38.518 23.323 0.05 16.55 C ANISOU 1098 CD1 ILE A 66 2664 1749 1873 -341 177 -251 C ATOM 1099 H ILE A 66 13.493 40.095 26.696 0.05 14.33 H ANISOU 1099 H ILE A 66 2288 1337 1820 -235 69 -122 H ATOM 1100 HA ILE A 66 15.900 41.300 26.224 0.05 14.81 H ANISOU 1100 HA ILE A 66 2353 1420 1853 -272 171 -96 H ATOM 1101 HB ILE A 66 14.069 40.400 24.284 0.05 15.59 H ANISOU 1101 HB ILE A 66 2533 1584 1806 -303 82 -101 H ATOM 1102 HG12 ILE A 66 16.727 39.545 24.785 0.05 16.06 H ANISOU 1102 HG12 ILE A 66 2551 1651 1902 -319 246 -221 H ATOM 1103 HG13 ILE A 66 15.450 38.735 25.258 0.05 15.40 H ANISOU 1103 HG13 ILE A 66 2444 1523 1885 -281 180 -224 H ATOM 1104 HG21 ILE A 66 14.929 42.275 23.408 0.05 16.14 H ANISOU 1104 HG21 ILE A 66 2652 1670 1810 -344 129 -12 H ATOM 1105 HG22 ILE A 66 16.379 41.919 23.958 0.05 16.22 H ANISOU 1105 HG22 ILE A 66 2621 1686 1857 -354 222 -84 H ATOM 1106 HG23 ILE A 66 15.761 41.092 22.752 0.05 16.80 H ANISOU 1106 HG23 ILE A 66 2751 1804 1827 -373 177 -93 H ATOM 1107 HD11 ILE A 66 16.020 37.592 23.547 0.05 16.79 H ANISOU 1107 HD11 ILE A 66 2687 1779 1915 -344 220 -315 H ATOM 1108 HD12 ILE A 66 14.973 38.590 22.884 0.05 16.35 H ANISOU 1108 HD12 ILE A 66 2639 1717 1858 -332 121 -244 H ATOM 1109 HD13 ILE A 66 16.533 38.866 22.745 0.05 17.03 H ANISOU 1109 HD13 ILE A 66 2764 1849 1857 -369 180 -226 H ATOM 1110 N ILE A 67 15.186 43.598 26.257 0.05 14.64 N ANISOU 1110 N ILE A 67 2378 1372 1814 -275 96 36 N ATOM 1111 CA ILE A 67 14.697 44.971 26.172 0.05 14.79 C ANISOU 1111 CA ILE A 67 2436 1371 1813 -276 54 114 C ATOM 1112 C ILE A 67 15.071 45.432 24.776 0.05 15.69 C ANISOU 1112 C ILE A 67 2611 1522 1829 -327 84 145 C ATOM 1113 O ILE A 67 16.245 45.456 24.433 0.05 16.04 O ANISOU 1113 O ILE A 67 2654 1577 1863 -366 155 135 O ATOM 1114 CB ILE A 67 15.280 45.918 27.245 0.05 14.44 C ANISOU 1114 CB ILE A 67 2370 1275 1841 -268 61 142 C ATOM 1115 CG1 ILE A 67 15.359 45.240 28.623 0.05 13.70 C ANISOU 1115 CG1 ILE A 67 2215 1158 1831 -228 57 98 C ATOM 1116 CG2 ILE A 67 14.482 47.224 27.309 0.05 14.59 C ANISOU 1116 CG2 ILE A 67 2431 1257 1856 -254 7 214 C ATOM 1117 CD1 ILE A 67 14.037 44.850 29.215 0.05 13.26 C ANISOU 1117 CD1 ILE A 67 2149 1091 1800 -186 1 95 C ATOM 1118 H ILE A 67 16.014 43.516 26.461 0.05 14.62 H ANISOU 1118 H ILE A 67 2353 1366 1838 -281 136 19 H ATOM 1119 HA ILE A 67 13.732 44.994 26.251 0.05 14.69 H ANISOU 1119 HA ILE A 67 2428 1354 1798 -254 3 128 H ATOM 1120 HB ILE A 67 16.187 46.126 26.972 0.05 14.73 H ANISOU 1120 HB ILE A 67 2409 1320 1869 -299 107 140 H ATOM 1121 HG12 ILE A 67 15.899 44.442 28.541 0.05 13.71 H ANISOU 1121 HG12 ILE A 67 2193 1177 1838 -233 90 57 H ATOM 1122 HG13 ILE A 67 15.784 45.848 29.246 0.05 13.57 H ANISOU 1122 HG13 ILE A 67 2188 1116 1852 -228 60 111 H ATOM 1123 HG21 ILE A 67 14.835 47.773 28.024 0.05 14.46 H ANISOU 1123 HG21 ILE A 67 2406 1206 1883 -254 16 225 H ATOM 1124 HG22 ILE A 67 14.565 47.686 26.459 0.05 15.15 H ANISOU 1124 HG22 ILE A 67 2546 1342 1868 -277 8 248 H ATOM 1125 HG23 ILE A 67 13.549 47.029 27.485 0.05 14.35 H ANISOU 1125 HG23 ILE A 67 2392 1223 1839 -220 -37 214 H ATOM 1126 HD11 ILE A 67 13.535 44.353 28.553 0.05 13.44 H ANISOU 1126 HD11 ILE A 67 2179 1138 1788 -191 -6 79 H ATOM 1127 HD12 ILE A 67 14.188 44.302 30.003 0.05 12.88 H ANISOU 1127 HD12 ILE A 67 2069 1029 1798 -166 6 72 H ATOM 1128 HD13 ILE A 67 13.557 45.654 29.462 0.05 13.28 H ANISOU 1128 HD13 ILE A 67 2167 1074 1805 -175 -31 132 H ATOM 1129 N ARG A 68 14.082 45.821 23.982 0.05 16.17 N ANISOU 1129 N ARG A 68 2723 1605 1816 -326 28 185 N ATOM 1130 CA ARG A 68 14.325 46.345 22.645 0.05 17.17 C ANISOU 1130 CA ARG A 68 2924 1770 1830 -371 43 230 C ATOM 1131 C ARG A 68 14.169 47.837 22.764 0.05 17.45 C ANISOU 1131 C ARG A 68 3004 1756 1871 -368 14 326 C ATOM 1132 O ARG A 68 13.131 48.317 23.163 0.05 17.36 O ANISOU 1132 O ARG A 68 2998 1716 1881 -322 -65 369 O ATOM 1133 CB ARG A 68 13.332 45.769 21.636 0.05 17.68 C ANISOU 1133 CB ARG A 68 3021 1891 1806 -368 -16 220 C ATOM 1134 CG ARG A 68 13.597 46.233 20.188 0.05 18.87 C ANISOU 1134 CG ARG A 68 3260 2090 1819 -413 -10 271 C ATOM 1135 CD ARG A 68 12.916 45.357 19.125 0.05 19.49 C ANISOU 1135 CD ARG A 68 3364 2247 1796 -426 -46 223 C ATOM 1136 NE ARG A 68 13.597 44.058 18.895 0.05 19.34 N ANISOU 1136 NE ARG A 68 3309 2256 1784 -451 30 113 N ATOM 1137 CZ ARG A 68 13.440 43.270 17.814 0.05 19.69 C ANISOU 1137 CZ ARG A 68 3354 2352 1777 -462 13 35 C ATOM 1138 NH1 ARG A 68 12.603 43.600 16.846 0.05 20.21 N ANISOU 1138 NH1 ARG A 68 3447 2458 1774 -456 -83 51 N ATOM 1139 NH2 ARG A 68 14.110 42.120 17.708 0.05 19.60 N ANISOU 1139 NH2 ARG A 68 3311 2346 1790 -477 92 -63 N ATOM 1140 H ARG A 68 13.257 45.823 24.209 0.05 15.99 H ANISOU 1140 H ARG A 68 2692 1577 1805 -298 -23 191 H ATOM 1141 HA ARG A 68 15.220 46.128 22.354 0.05 17.42 H ANISOU 1141 HA ARG A 68 2956 1821 1842 -405 108 204 H ATOM 1142 HB2 ARG A 68 13.403 44.802 21.656 0.05 17.53 H ANISOU 1142 HB2 ARG A 68 2974 1895 1791 -372 5 153 H ATOM 1143 HB3 ARG A 68 12.439 46.045 21.890 0.05 17.48 H ANISOU 1143 HB3 ARG A 68 2986 1849 1808 -333 -82 245 H ATOM 1144 HG2 ARG A 68 13.259 47.135 20.089 0.05 19.11 H ANISOU 1144 HG2 ARG A 68 3323 2098 1840 -399 -54 342 H ATOM 1145 HG3 ARG A 68 14.549 46.208 20.015 0.05 19.10 H ANISOU 1145 HG3 ARG A 68 3300 2127 1831 -450 62 262 H ATOM 1146 HD2 ARG A 68 12.017 45.211 19.439 0.05 19.26 H ANISOU 1146 HD2 ARG A 68 3311 2213 1794 -393 -116 222 H ATOM 1147 HD3 ARG A 68 12.897 45.836 18.283 0.05 20.32 H ANISOU 1147 HD3 ARG A 68 3531 2384 1804 -453 -50 265 H ATOM 1148 HE ARG A 68 14.104 43.764 19.525 0.05 18.94 H ANISOU 1148 HE ARG A 68 3224 2179 1792 -450 82 91 H ATOM 1149 HH11 ARG A 68 12.162 44.336 16.893 0.05 20.33 H ANISOU 1149 HH11 ARG A 68 3480 2467 1778 -439 -137 116 H ATOM 1150 HH12 ARG A 68 12.509 43.086 16.162 0.05 20.48 H ANISOU 1150 HH12 ARG A 68 3480 2524 1776 -468 -93 -6 H ATOM 1151 HH21 ARG A 68 14.657 41.881 18.325 0.05 19.32 H ANISOU 1151 HH21 ARG A 68 3252 2288 1802 -477 150 -72 H ATOM 1152 HH22 ARG A 68 13.999 41.619 17.018 0.05 19.86 H ANISOU 1152 HH22 ARG A 68 3347 2406 1795 -486 86 -119 H ATOM 1153 N AILE A 69 15.244 48.543 22.447 0.02 17.89 N ANISOU 1153 N AILE A 69 3087 1795 1915 -417 83 356 N ATOM 1154 N BILE A 69 15.242 48.543 22.441 0.02 17.89 N ANISOU 1154 N BILE A 69 3086 1795 1915 -417 84 355 N ATOM 1155 CA AILE A 69 15.302 49.996 22.527 0.02 18.27 C ANISOU 1155 CA AILE A 69 3183 1779 1980 -423 69 445 C ATOM 1156 CA BILE A 69 15.298 49.994 22.525 0.02 18.27 C ANISOU 1156 CA BILE A 69 3183 1779 1980 -424 71 444 C ATOM 1157 C AILE A 69 15.661 50.488 21.131 0.02 19.51 C ANISOU 1157 C AILE A 69 3430 1966 2015 -484 107 508 C ATOM 1158 C BILE A 69 15.660 50.487 21.130 0.02 19.51 C ANISOU 1158 C BILE A 69 3431 1967 2015 -484 107 507 C ATOM 1159 O AILE A 69 16.762 50.248 20.640 0.02 19.93 O ANISOU 1159 O AILE A 69 3485 2052 2035 -547 200 482 O ATOM 1160 O BILE A 69 16.761 50.246 20.639 0.02 19.93 O ANISOU 1160 O BILE A 69 3486 2054 2034 -547 200 481 O ATOM 1161 CB AILE A 69 16.346 50.462 23.556 0.02 17.76 C ANISOU 1161 CB AILE A 69 3066 1657 2024 -435 118 424 C ATOM 1162 CB BILE A 69 16.334 50.456 23.564 0.02 17.79 C ANISOU 1162 CB BILE A 69 3071 1662 2026 -439 122 423 C ATOM 1163 CG1AILE A 69 16.085 49.858 24.933 0.02 16.66 C ANISOU 1163 CG1AILE A 69 2851 1493 1986 -373 74 369 C ATOM 1164 CG1BILE A 69 16.041 49.866 24.943 0.02 16.68 C ANISOU 1164 CG1BILE A 69 2852 1497 1988 -378 82 367 C ATOM 1165 CG2AILE A 69 16.340 51.971 23.645 0.02 18.34 C ANISOU 1165 CG2AILE A 69 3198 1654 2114 -455 114 509 C ATOM 1166 CG2BILE A 69 16.348 51.966 23.637 0.02 18.37 C ANISOU 1166 CG2BILE A 69 3204 1660 2115 -459 118 509 C ATOM 1167 CD1AILE A 69 17.118 50.222 25.975 0.02 16.19 C ANISOU 1167 CD1AILE A 69 2730 1402 2018 -385 118 327 C ATOM 1168 CD1BILE A 69 17.094 50.171 25.993 0.02 16.25 C ANISOU 1168 CD1BILE A 69 2735 1414 2023 -394 130 323 C ATOM 1169 H AILE A 69 15.976 48.192 22.173 0.02 18.04 H ANISOU 1169 H AILE A 69 3095 1838 1921 -449 142 323 H ATOM 1170 H BILE A 69 15.971 48.193 22.162 0.02 18.03 H ANISOU 1170 H BILE A 69 3094 1837 1920 -448 142 323 H ATOM 1171 HA AILE A 69 14.435 50.347 22.775 0.02 18.17 H ANISOU 1171 HA AILE A 69 3179 1742 1981 -381 3 476 H ATOM 1172 HA BILE A 69 14.430 50.344 22.769 0.02 18.16 H ANISOU 1172 HA BILE A 69 3177 1740 1982 -381 4 475 H ATOM 1173 HB AILE A 69 17.223 50.178 23.262 0.02 17.87 H ANISOU 1173 HB AILE A 69 3058 1698 2033 -473 181 387 H ATOM 1174 HB BILE A 69 17.210 50.156 23.286 0.02 17.93 H ANISOU 1174 HB BILE A 69 3069 1709 2035 -478 186 389 H ATOM 1175 HG12AILE A 69 15.222 50.150 25.263 0.02 16.58 H ANISOU 1175 HG12AILE A 69 2857 1450 1995 -337 21 403 H ATOM 1176 HG12BILE A 69 15.193 50.199 25.272 0.02 16.57 H ANISOU 1176 HG12BILE A 69 2851 1448 1996 -342 29 399 H ATOM 1177 HG13AILE A 69 16.090 48.892 24.839 0.02 16.40 H ANISOU 1177 HG13AILE A 69 2792 1500 1938 -358 69 325 H ATOM 1178 HG13BILE A 69 15.996 48.901 24.847 0.02 16.42 H ANISOU 1178 HG13BILE A 69 2793 1504 1940 -363 77 323 H ATOM 1179 HG21AILE A 69 16.325 52.220 24.579 0.02 17.86 H ANISOU 1179 HG21AILE A 69 3103 1550 2133 -436 104 493 H ATOM 1180 HG21BILE A 69 17.188 52.293 23.281 0.02 18.97 H ANISOU 1180 HG21BILE A 69 3307 1745 2155 -514 176 527 H ATOM 1181 HG22AILE A 69 17.137 52.319 23.217 0.02 18.88 H ANISOU 1181 HG22AILE A 69 3289 1731 2154 -511 175 522 H ATOM 1182 HG22BILE A 69 15.607 52.317 23.121 0.02 18.66 H ANISOU 1182 HG22BILE A 69 3286 1684 2121 -431 63 560 H ATOM 1183 HG23AILE A 69 15.548 52.310 23.202 0.02 18.70 H ANISOU 1183 HG23AILE A 69 3294 1690 2121 -432 64 562 H ATOM 1184 HG23BILE A 69 16.255 52.223 24.564 0.02 17.91 H ANISOU 1184 HG23BILE A 69 3109 1558 2136 -444 114 492 H ATOM 1185 HD11AILE A 69 16.890 51.078 26.363 0.02 16.43 H ANISOU 1185 HD11AILE A 69 2783 1387 2071 -399 119 364 H ATOM 1186 HD11BILE A 69 17.099 51.120 26.178 0.02 16.52 H ANISOU 1186 HD11BILE A 69 2794 1405 2078 -412 135 360 H ATOM 1187 HD12AILE A 69 17.121 49.536 26.663 0.02 15.56 H ANISOU 1187 HD12AILE A 69 2609 1318 1986 -345 91 293 H ATOM 1188 HD12BILE A 69 16.887 49.675 26.803 0.02 15.62 H ANISOU 1188 HD12BILE A 69 2614 1326 1994 -354 103 291 H ATOM 1189 HD13AILE A 69 17.983 50.269 25.542 0.02 16.36 H ANISOU 1189 HD13AILE A 69 2733 1458 2027 -418 172 296 H ATOM 1190 HD13BILE A 69 17.960 49.899 25.649 0.02 16.41 H ANISOU 1190 HD13BILE A 69 2736 1471 2029 -425 183 290 H ATOM 1191 N ASN A 70 14.699 51.126 20.478 0.05 20.18 N ANISOU 1191 N ASN A 70 3590 2048 2032 -461 32 589 N ATOM 1192 CA ASN A 70 14.856 51.523 19.083 0.05 21.51 C ANISOU 1192 CA ASN A 70 3858 2256 2057 -512 49 657 C ATOM 1193 C ASN A 70 15.433 50.382 18.255 0.05 21.74 C ANISOU 1193 C ASN A 70 3878 2383 1999 -556 112 576 C ATOM 1194 O ASN A 70 16.435 50.534 17.503 0.05 22.17 O ANISOU 1194 O ASN A 70 3939 2459 2025 -623 220 556 O ATOM 1195 CB ASN A 70 15.712 52.786 18.965 0.05 22.27 C ANISOU 1195 CB ASN A 70 4015 2295 2152 -575 123 733 C ATOM 1196 CG ASN A 70 15.103 53.963 19.703 0.05 22.46 C ANISOU 1196 CG ASN A 70 4080 2213 2239 -535 60 827 C ATOM 1197 OD1 ASN A 70 15.751 54.641 20.503 0.05 22.82 O ANISOU 1197 OD1 ASN A 70 4154 2186 2332 -578 114 871 O ATOM 1198 ND2 ASN A 70 13.846 54.187 19.453 0.05 22.30 N ANISOU 1198 ND2 ASN A 70 4061 2183 2230 -454 -53 853 N ATOM 1199 H AASN A 70 13.939 51.329 20.820 0.05 19.96 H ANISOU 1199 H AASN A 70 3554 1995 2035 -415 -32 607 H ATOM 1200 H BASN A 70 13.940 51.330 20.820 0.05 19.96 H ANISOU 1200 H BASN A 70 3554 1995 2035 -415 -32 607 H ATOM 1201 HA ASN A 70 13.974 51.711 18.731 0.05 21.87 H ANISOU 1201 HA ASN A 70 3942 2307 2062 -478 -26 703 H ATOM 1202 HB2 ASN A 70 16.589 52.617 19.342 0.05 21.86 H ANISOU 1202 HB2 ASN A 70 3911 2234 2160 -602 188 683 H ATOM 1203 HB3 ASN A 70 15.791 53.028 18.028 0.05 23.17 H ANISOU 1203 HB3 ASN A 70 4193 2447 2163 -616 151 769 H ATOM 1204 HD21 ASN A 70 13.291 53.536 19.443 0.05 22.63 H ANISOU 1204 HD21 ASN A 70 4123 2274 2201 -440 -94 862 H ATOM 1205 HD22 ASN A 70 13.580 54.988 19.300 0.05 21.91 H ANISOU 1205 HD22 ASN A 70 3987 2080 2259 -416 -83 858 H ATOM 1206 N ASP A 71 14.760 49.252 18.377 0.05 21.54 N ANISOU 1206 N ASP A 71 3832 2416 1937 -522 51 521 N ATOM 1207 CA ASP A 71 15.097 48.028 17.599 0.05 22.06 C ANISOU 1207 CA ASP A 71 3910 2576 1897 -566 105 445 C ATOM 1208 C ASP A 71 16.390 47.197 17.948 0.05 21.71 C ANISOU 1208 C ASP A 71 3800 2545 1903 -606 234 345 C ATOM 1209 O ASP A 71 16.443 45.985 17.644 0.05 22.18 O ANISOU 1209 O ASP A 71 3864 2674 1888 -635 284 270 O ATOM 1210 CB ASP A 71 14.993 48.352 16.110 0.05 23.62 C ANISOU 1210 CB ASP A 71 4227 2831 1915 -612 99 520 C ATOM 1211 CG ASP A 71 13.583 48.754 15.731 0.05 24.14 C ANISOU 1211 CG ASP A 71 4323 2974 1875 -590 1 497 C ATOM 1212 OD1 ASP A 71 12.696 48.592 16.603 0.05 24.33 O ANISOU 1212 OD1 ASP A 71 4368 2987 1891 -539 -121 566 O ATOM 1213 OD2 ASP A 71 13.352 49.215 14.599 0.05 24.50 O ANISOU 1213 OD2 ASP A 71 4369 3096 1843 -626 45 406 O ATOM 1214 H ASP A 71 14.072 49.167 18.878 0.05 21.18 H ANISOU 1214 H ASP A 71 3765 2359 1925 -477 -17 523 H ATOM 1215 HA ASP A 71 14.380 47.399 17.779 0.05 21.74 H ANISOU 1215 HA ASP A 71 3840 2557 1863 -534 51 400 H ATOM 1216 HB2 ASP A 71 15.594 49.072 15.867 0.05 23.94 H ANISOU 1216 HB2 ASP A 71 4313 2829 1955 -606 70 609 H ATOM 1217 HB3 ASP A 71 15.216 47.559 15.593 0.05 24.08 H ANISOU 1217 HB3 ASP A 71 4303 2922 1924 -664 186 494 H ATOM 1218 N AGLU A 72 17.396 47.827 18.561 0.03 21.05 N ANISOU 1218 N AGLU A 72 3658 2400 1941 -605 282 344 N ATOM 1219 N BGLU A 72 17.383 47.843 18.571 0.03 21.01 N ANISOU 1219 N BGLU A 72 3650 2393 1940 -603 279 343 N ATOM 1220 CA AGLU A 72 18.520 47.072 19.119 0.03 20.65 C ANISOU 1220 CA AGLU A 72 3523 2359 1966 -621 379 248 C ATOM 1221 CA BGLU A 72 18.545 47.165 19.168 0.03 20.64 C ANISOU 1221 CA BGLU A 72 3521 2354 1969 -622 379 253 C ATOM 1222 C AGLU A 72 18.109 46.367 20.400 0.03 19.37 C ANISOU 1222 C AGLU A 72 3267 2159 1935 -555 335 184 C ATOM 1223 C BGLU A 72 18.107 46.378 20.410 0.03 19.35 C ANISOU 1223 C BGLU A 72 3261 2153 1940 -556 339 186 C ATOM 1224 O AGLU A 72 17.445 46.936 21.256 0.03 18.70 O ANISOU 1224 O AGLU A 72 3171 2020 1915 -509 256 225 O ATOM 1225 O BGLU A 72 17.387 46.906 21.248 0.03 18.65 O ANISOU 1225 O BGLU A 72 3157 2007 1924 -512 266 225 O ATOM 1226 CB AGLU A 72 19.703 47.975 19.414 0.03 20.92 C ANISOU 1226 CB AGLU A 72 3540 2357 2050 -671 461 281 C ATOM 1227 CB BGLU A 72 19.584 48.222 19.555 0.03 21.01 C ANISOU 1227 CB BGLU A 72 3564 2363 2055 -675 457 298 C ATOM 1228 CG AGLU A 72 20.226 48.696 18.208 0.03 22.29 C ANISOU 1228 CG AGLU A 72 3796 2566 2107 -753 540 336 C ATOM 1229 CG BGLU A 72 20.922 47.715 20.080 0.03 20.64 C ANISOU 1229 CG BGLU A 72 3413 2317 2114 -687 544 215 C ATOM 1230 CD AGLU A 72 21.328 49.675 18.565 0.03 22.57 C ANISOU 1230 CD AGLU A 72 3814 2551 2212 -807 611 377 C ATOM 1231 CD BGLU A 72 21.801 48.841 20.651 0.03 20.98 C ANISOU 1231 CD BGLU A 72 3440 2316 2217 -741 602 259 C ATOM 1232 OE1AGLU A 72 22.343 49.254 19.162 0.03 21.74 O ANISOU 1232 OE1AGLU A 72 3614 2404 2241 -784 612 333 O ATOM 1233 OE1BGLU A 72 21.260 49.871 21.110 0.03 21.38 O ANISOU 1233 OE1BGLU A 72 3564 2318 2242 -765 575 356 O ATOM 1234 OE2AGLU A 72 21.175 50.875 18.259 0.03 23.71 O ANISOU 1234 OE2AGLU A 72 4040 2695 2275 -876 662 455 O ATOM 1235 OE2BGLU A 72 23.044 48.695 20.657 0.03 20.95 O ANISOU 1235 OE2BGLU A 72 3346 2324 2291 -760 675 194 O ATOM 1236 H AGLU A 72 17.454 48.677 18.669 0.05 20.89 H ANISOU 1236 H AGLU A 72 3643 2330 1964 -595 258 395 H ATOM 1237 H BGLU A 72 17.410 48.696 18.670 0.05 20.78 H ANISOU 1237 H BGLU A 72 3624 2315 1958 -587 248 392 H ATOM 1238 HA AGLU A 72 18.800 46.397 18.481 0.05 21.12 H ANISOU 1238 HA AGLU A 72 3592 2472 1962 -644 422 200 H ATOM 1239 HA BGLU A 72 18.938 46.551 18.528 0.05 21.12 H ANISOU 1239 HA BGLU A 72 3590 2467 1967 -646 425 205 H ATOM 1240 HB2AGLU A 72 19.437 48.637 20.071 0.05 20.55 H ANISOU 1240 HB2AGLU A 72 3493 2254 2059 -652 417 328 H ATOM 1241 HB2BGLU A 72 19.767 48.766 18.771 0.05 21.91 H ANISOU 1241 HB2BGLU A 72 3738 2507 2080 -724 500 331 H ATOM 1242 HB3AGLU A 72 20.427 47.437 19.766 0.05 20.63 H ANISOU 1242 HB3AGLU A 72 3436 2328 2074 -671 511 216 H ATOM 1243 HB3BGLU A 72 19.195 48.775 20.250 0.05 20.72 H ANISOU 1243 HB3BGLU A 72 3537 2272 2063 -657 409 353 H ATOM 1244 HG2AGLU A 72 20.582 48.038 17.587 0.05 22.69 H ANISOU 1244 HG2AGLU A 72 3838 2673 2111 -776 600 279 H ATOM 1245 HG2BGLU A 72 20.770 47.074 20.789 0.05 19.82 H ANISOU 1245 HG2BGLU A 72 3254 2189 2087 -638 503 179 H ATOM 1246 HG3AGLU A 72 19.500 49.192 17.798 0.05 22.70 H ANISOU 1246 HG3AGLU A 72 3922 2617 2086 -750 488 401 H ATOM 1247 HG3BGLU A 72 21.408 47.302 19.349 0.05 21.10 H ANISOU 1247 HG3BGLU A 72 3464 2426 2129 -709 605 164 H ATOM 1248 N ASP A 73 18.543 45.127 20.538 0.05 19.16 N ANISOU 1248 N ASP A 73 3175 2156 1947 -549 392 86 N ATOM 1249 CA ASP A 73 18.035 44.254 21.581 0.05 18.13 C ANISOU 1249 CA ASP A 73 2970 1994 1926 -488 354 27 C ATOM 1250 C ASP A 73 19.068 44.095 22.698 0.05 17.62 C ANISOU 1250 C ASP A 73 2819 1893 1981 -473 398 -3 C ATOM 1251 O ASP A 73 20.226 43.801 22.436 0.05 18.13 O ANISOU 1251 O ASP A 73 2858 1977 2053 -512 481 -22 O ATOM 1252 CB ASP A 73 17.665 42.899 20.953 0.05 18.33 C ANISOU 1252 CB ASP A 73 2991 2061 1914 -479 367 -62 C ATOM 1253 CG ASP A 73 16.805 43.052 19.723 0.05 18.65 C ANISOU 1253 CG ASP A 73 3095 2131 1860 -480 289 -42 C ATOM 1254 OD1 ASP A 73 16.140 44.103 19.557 0.05 18.41 O ANISOU 1254 OD1 ASP A 73 3089 2075 1831 -462 210 38 O ATOM 1255 OD2 ASP A 73 16.843 42.136 18.879 0.05 19.23 O ANISOU 1255 OD2 ASP A 73 3193 2254 1861 -498 305 -107 O ATOM 1256 H AASP A 73 19.134 44.758 20.039 0.05 19.66 H ANISOU 1256 H AASP A 73 3238 2254 1976 -579 456 52 H ATOM 1257 H BASP A 73 19.133 44.759 20.036 0.05 19.67 H ANISOU 1257 H BASP A 73 3244 2258 1972 -578 452 52 H ATOM 1258 HA ASP A 73 17.226 44.630 21.958 0.05 17.71 H ANISOU 1258 HA ASP A 73 2924 1912 1891 -459 285 63 H ATOM 1259 HB2 ASP A 73 18.475 42.443 20.681 0.05 18.93 H ANISOU 1259 HB2 ASP A 73 3071 2172 1951 -510 436 -97 H ATOM 1260 HB3 ASP A 73 17.171 42.365 21.589 0.05 17.76 H ANISOU 1260 HB3 ASP A 73 2868 1962 1918 -443 355 -102 H ATOM 1261 N PHE A 74 18.598 44.273 23.930 0.05 16.69 N ANISOU 1261 N PHE A 74 2657 1730 1954 -418 338 -9 N ATOM 1262 CA PHE A 74 19.429 44.219 25.147 0.05 16.17 C ANISOU 1262 CA PHE A 74 2514 1631 2000 -393 353 -33 C ATOM 1263 C PHE A 74 18.907 43.060 26.017 0.05 15.51 C ANISOU 1263 C PHE A 74 2394 1528 1972 -333 312 -80 C ATOM 1264 O PHE A 74 17.946 43.230 26.780 0.05 14.93 O ANISOU 1264 O PHE A 74 2330 1422 1919 -301 242 -49 O ATOM 1265 CB PHE A 74 19.336 45.572 25.875 0.05 15.79 C ANISOU 1265 CB PHE A 74 2470 1533 1996 -390 307 33 C ATOM 1266 CG PHE A 74 20.035 46.694 25.142 0.05 16.50 C ANISOU 1266 CG PHE A 74 2595 1622 2052 -454 350 85 C ATOM 1267 CD1 PHE A 74 19.364 47.434 24.168 0.05 17.02 C ANISOU 1267 CD1 PHE A 74 2750 1688 2031 -482 331 156 C ATOM 1268 CD2 PHE A 74 21.376 46.985 25.378 0.05 16.80 C ANISOU 1268 CD2 PHE A 74 2577 1661 2144 -489 411 65 C ATOM 1269 CE1 PHE A 74 20.016 48.481 23.472 0.05 17.82 C ANISOU 1269 CE1 PHE A 74 2894 1777 2100 -546 377 213 C ATOM 1270 CE2 PHE A 74 22.013 48.012 24.695 0.05 17.57 C ANISOU 1270 CE2 PHE A 74 2709 1753 2216 -560 460 112 C ATOM 1271 CZ PHE A 74 21.340 48.756 23.745 0.05 18.09 C ANISOU 1271 CZ PHE A 74 2873 1807 2192 -590 447 189 C ATOM 1272 H PHE A 74 17.771 44.453 24.092 0.05 16.39 H ANISOU 1272 H PHE A 74 2634 1682 1912 -394 285 2 H ATOM 1273 HA PHE A 74 20.359 44.076 24.918 0.05 16.56 H ANISOU 1273 HA PHE A 74 2534 1701 2059 -414 413 -62 H ATOM 1274 HB2 PHE A 74 18.401 45.807 25.973 0.05 15.52 H ANISOU 1274 HB2 PHE A 74 2466 1482 1948 -369 252 63 H ATOM 1275 HB3 PHE A 74 19.734 45.476 26.751 0.05 15.42 H ANISOU 1275 HB3 PHE A 74 2372 1469 2017 -367 303 11 H ATOM 1276 HD1 PHE A 74 18.471 47.255 23.986 0.05 16.91 H ANISOU 1276 HD1 PHE A 74 2765 1678 1981 -458 285 168 H ATOM 1277 HD2 PHE A 74 21.845 46.498 26.017 0.05 16.54 H ANISOU 1277 HD2 PHE A 74 2484 1632 2169 -466 417 20 H ATOM 1278 HE1 PHE A 74 19.552 48.971 22.832 0.05 18.24 H ANISOU 1278 HE1 PHE A 74 3012 1825 2092 -561 360 268 H ATOM 1279 HE2 PHE A 74 22.907 48.196 24.876 0.05 17.83 H ANISOU 1279 HE2 PHE A 74 2696 1788 2290 -589 501 94 H ATOM 1280 HZ PHE A 74 21.781 49.436 23.293 0.05 18.67 H ANISOU 1280 HZ PHE A 74 2975 1871 2249 -640 482 226 H ATOM 1281 N PRO A 75 19.536 41.876 25.888 0.05 15.70 N ANISOU 1281 N PRO A 75 2374 1565 2026 -316 361 -154 N ATOM 1282 CA PRO A 75 19.384 40.743 26.809 0.05 15.06 C ANISOU 1282 CA PRO A 75 2263 1445 2014 -258 316 -178 C ATOM 1283 C PRO A 75 19.655 41.135 28.274 0.05 14.54 C ANISOU 1283 C PRO A 75 2145 1345 2034 -226 290 -156 C ATOM 1284 O PRO A 75 20.628 41.848 28.579 0.05 14.82 O ANISOU 1284 O PRO A 75 2137 1392 2102 -240 328 -161 O ATOM 1285 CB PRO A 75 20.432 39.769 26.284 0.05 15.52 C ANISOU 1285 CB PRO A 75 2296 1514 2088 -243 372 -261 C ATOM 1286 CG PRO A 75 20.523 40.070 24.805 0.05 16.42 C ANISOU 1286 CG PRO A 75 2417 1683 2139 -294 454 -287 C ATOM 1287 CD PRO A 75 20.365 41.531 24.714 0.05 16.45 C ANISOU 1287 CD PRO A 75 2436 1698 2116 -336 451 -216 C ATOM 1288 HA PRO A 75 18.495 40.363 26.737 0.05 14.83 H ANISOU 1288 HA PRO A 75 2264 1407 1962 -252 272 -162 H ATOM 1289 HB2 PRO A 75 21.294 39.945 26.698 0.05 15.37 H ANISOU 1289 HB2 PRO A 75 2231 1473 2137 -208 376 -279 H ATOM 1290 HB3 PRO A 75 20.163 38.848 26.442 0.05 15.49 H ANISOU 1290 HB3 PRO A 75 2320 1505 2061 -239 351 -277 H ATOM 1291 HG2 PRO A 75 21.388 39.800 24.466 0.05 16.70 H ANISOU 1291 HG2 PRO A 75 2405 1721 2219 -279 499 -331 H ATOM 1292 HG3 PRO A 75 19.808 39.614 24.333 0.05 16.76 H ANISOU 1292 HG3 PRO A 75 2503 1747 2117 -314 461 -305 H ATOM 1293 HD2 PRO A 75 21.227 41.972 24.766 0.05 16.46 H ANISOU 1293 HD2 PRO A 75 2388 1695 2172 -332 473 -221 H ATOM 1294 HD3 PRO A 75 19.904 41.760 23.888 0.05 16.99 H ANISOU 1294 HD3 PRO A 75 2543 1800 2113 -378 484 -209 H ATOM 1295 N VAL A 76 18.797 40.682 29.171 0.05 13.90 N ANISOU 1295 N VAL A 76 2069 1227 1986 -187 229 -137 N ATOM 1296 CA VAL A 76 18.910 41.068 30.586 0.05 13.43 C ANISOU 1296 CA VAL A 76 1976 1137 1988 -157 193 -112 C ATOM 1297 C VAL A 76 18.468 40.011 31.565 0.05 13.08 C ANISOU 1297 C VAL A 76 1916 1061 1992 -105 166 -128 C ATOM 1298 O VAL A 76 17.618 39.140 31.269 0.05 13.07 O ANISOU 1298 O VAL A 76 1938 1049 1979 -97 163 -148 O ATOM 1299 CB VAL A 76 18.181 42.405 30.894 0.05 13.10 C ANISOU 1299 CB VAL A 76 1970 1079 1929 -170 147 -53 C ATOM 1300 CG1 VAL A 76 18.853 43.575 30.168 0.05 13.57 C ANISOU 1300 CG1 VAL A 76 2052 1156 1949 -224 175 -24 C ATOM 1301 CG2 VAL A 76 16.718 42.309 30.568 0.05 12.84 C ANISOU 1301 CG2 VAL A 76 1976 1036 1865 -158 103 -34 C ATOM 1302 H VAL A 76 18.143 40.155 29.000 0.05 13.79 H ANISOU 1302 H VAL A 76 2077 1207 1955 -181 209 -139 H ATOM 1303 HA VAL A 76 19.843 41.239 30.774 0.05 13.64 H ANISOU 1303 HA VAL A 76 1968 1174 2041 -162 217 -123 H ATOM 1304 HB VAL A 76 18.252 42.557 31.846 0.05 12.85 H ANISOU 1304 HB VAL A 76 1916 1030 1936 -150 127 -47 H ATOM 1305 HG11 VAL A 76 19.781 43.621 30.446 0.05 13.97 H ANISOU 1305 HG11 VAL A 76 2089 1231 1988 -243 220 -49 H ATOM 1306 HG12 VAL A 76 18.795 43.441 29.213 0.05 13.62 H ANISOU 1306 HG12 VAL A 76 2100 1161 1914 -234 157 5 H ATOM 1307 HG13 VAL A 76 18.390 44.386 30.418 0.05 13.49 H ANISOU 1307 HG13 VAL A 76 2027 1130 1970 -227 166 -9 H ATOM 1308 HG21 VAL A 76 16.193 42.747 31.249 0.05 12.55 H ANISOU 1308 HG21 VAL A 76 1945 980 1845 -145 72 -7 H ATOM 1309 HG22 VAL A 76 16.557 42.690 29.694 0.05 13.12 H ANISOU 1309 HG22 VAL A 76 2042 1091 1854 -183 108 -24 H ATOM 1310 HG23 VAL A 76 16.479 41.365 30.546 0.05 12.75 H ANISOU 1310 HG23 VAL A 76 1956 1021 1868 -140 104 -60 H ATOM 1311 N THR A 77 19.052 40.089 32.756 0.05 12.87 N ANISOU 1311 N THR A 77 1854 1018 2018 -74 144 -118 N ATOM 1312 CA THR A 77 18.877 39.115 33.844 0.05 12.70 C ANISOU 1312 CA THR A 77 1818 965 2042 -22 121 -124 C ATOM 1313 C THR A 77 18.822 39.859 35.192 0.05 12.39 C ANISOU 1313 C THR A 77 1768 917 2023 -3 76 -90 C ATOM 1314 O THR A 77 19.179 41.049 35.269 0.05 12.39 O ANISOU 1314 O THR A 77 1762 932 2013 -32 69 -76 O ATOM 1315 CB THR A 77 20.024 37.932 33.932 0.05 13.22 C ANISOU 1315 CB THR A 77 1841 1030 2152 9 157 -170 C ATOM 1316 OG1 THR A 77 20.332 37.755 35.288 0.05 13.16 O ANISOU 1316 OG1 THR A 77 1842 979 2180 57 136 -167 O ATOM 1317 CG2 THR A 77 21.348 38.270 33.436 0.05 13.57 C ANISOU 1317 CG2 THR A 77 1820 1102 2235 17 164 -180 C ATOM 1318 H THR A 77 19.552 40.748 32.976 0.05 12.88 H ANISOU 1318 H THR A 77 1842 1027 2026 -84 140 -106 H ATOM 1319 HA THR A 77 18.009 38.712 33.722 0.05 12.53 H ANISOU 1319 HA THR A 77 1826 928 2009 -20 111 -120 H ATOM 1320 HB THR A 77 19.718 37.106 33.523 0.05 13.48 H ANISOU 1320 HB THR A 77 1882 1074 2165 -10 191 -197 H ATOM 1321 HG1 THR A 77 19.667 37.453 35.696 0.05 13.47 H ANISOU 1321 HG1 THR A 77 1855 1012 2252 84 147 -186 H ATOM 1322 HG21 THR A 77 21.650 37.603 32.799 0.05 13.99 H ANISOU 1322 HG21 THR A 77 1850 1173 2294 9 206 -213 H ATOM 1323 HG22 THR A 77 21.376 39.152 33.040 0.05 13.43 H ANISOU 1323 HG22 THR A 77 1805 1099 2200 -12 153 -160 H ATOM 1324 HG23 THR A 77 21.940 38.269 34.202 0.05 13.61 H ANISOU 1324 HG23 THR A 77 1802 1092 2275 57 139 -176 H ATOM 1325 N LYS A 78 18.319 39.294 36.257 0.05 12.21 N ANISOU 1325 N LYS A 78 1752 867 2021 37 46 -76 N ATOM 1326 CA LYS A 78 18.680 39.729 37.613 0.05 12.07 C ANISOU 1326 CA LYS A 78 1729 845 2010 58 4 -51 C ATOM 1327 C LYS A 78 19.952 40.514 37.759 0.05 12.35 C ANISOU 1327 C LYS A 78 1719 910 2064 48 -4 -63 C ATOM 1328 O LYS A 78 21.042 40.108 37.515 0.05 12.79 O ANISOU 1328 O LYS A 78 1724 983 2153 61 10 -89 O ATOM 1329 CB LYS A 78 18.826 38.515 38.542 0.05 12.20 C ANISOU 1329 CB LYS A 78 1749 835 2051 110 -15 -39 C ATOM 1330 CG LYS A 78 18.776 39.036 39.927 0.05 12.10 C ANISOU 1330 CG LYS A 78 1748 826 2024 126 -58 -11 C ATOM 1331 CD LYS A 78 18.264 38.077 40.796 0.05 12.32 C ANISOU 1331 CD LYS A 78 1796 828 2058 173 -78 15 C ATOM 1332 CE LYS A 78 19.384 37.417 41.386 0.05 12.90 C ANISOU 1332 CE LYS A 78 1827 905 2169 221 -98 9 C ATOM 1333 NZ LYS A 78 18.900 35.982 41.726 0.05 13.25 N ANISOU 1333 NZ LYS A 78 1907 917 2209 272 -127 52 N ATOM 1334 H LYS A 78 17.743 38.648 36.230 0.05 12.23 H ANISOU 1334 H LYS A 78 1767 851 2030 51 52 -81 H ATOM 1335 HA LYS A 78 17.957 40.265 37.951 0.05 11.80 H ANISOU 1335 HA LYS A 78 1721 806 1955 45 -7 -33 H ATOM 1336 HB2 LYS A 78 18.092 37.919 38.369 0.05 12.10 H ANISOU 1336 HB2 LYS A 78 1763 800 2034 110 -4 -35 H ATOM 1337 HB3 LYS A 78 19.675 38.111 38.394 0.05 12.53 H ANISOU 1337 HB3 LYS A 78 1760 881 2120 131 -10 -55 H ATOM 1338 HG2 LYS A 78 19.662 39.298 40.229 0.05 12.27 H ANISOU 1338 HG2 LYS A 78 1741 870 2053 125 -74 -20 H ATOM 1339 HG3 LYS A 78 18.175 39.791 39.959 0.05 11.82 H ANISOU 1339 HG3 LYS A 78 1737 789 1965 105 -59 -2 H ATOM 1340 HD2 LYS A 78 17.785 38.532 41.505 0.05 12.25 H ANISOU 1340 HD2 LYS A 78 1806 823 2024 174 -98 33 H ATOM 1341 HD3 LYS A 78 17.706 37.449 40.318 0.05 12.27 H ANISOU 1341 HD3 LYS A 78 1811 794 2055 172 -56 19 H ATOM 1342 HE2 LYS A 78 20.126 37.368 40.771 0.05 13.03 H ANISOU 1342 HE2 LYS A 78 1828 911 2213 224 -71 -12 H ATOM 1343 HE3 LYS A 78 19.629 37.864 42.209 0.05 13.02 H ANISOU 1343 HE3 LYS A 78 1810 952 2186 217 -119 -2 H ATOM 1344 HZ1 LYS A 78 18.787 35.919 42.601 0.05 13.25 H ANISOU 1344 HZ1 LYS A 78 1917 935 2182 273 -155 68 H ATOM 1345 HZ2 LYS A 78 18.137 35.810 41.322 0.05 13.11 H ANISOU 1345 HZ2 LYS A 78 1923 871 2187 264 -106 63 H ATOM 1346 HZ3 LYS A 78 19.518 35.403 41.466 0.05 13.65 H ANISOU 1346 HZ3 LYS A 78 1935 961 2289 307 -137 51 H ATOM 1347 N GLY A 79 19.753 41.729 38.261 0.05 12.18 N ANISOU 1347 N GLY A 79 1711 892 2025 23 -27 -48 N ATOM 1348 CA GLY A 79 20.848 42.644 38.610 0.05 12.50 C ANISOU 1348 CA GLY A 79 1712 956 2083 2 -41 -63 C ATOM 1349 C GLY A 79 21.170 43.657 37.544 0.05 12.68 C ANISOU 1349 C GLY A 79 1731 987 2101 -58 -4 -69 C ATOM 1350 O GLY A 79 21.763 44.686 37.878 0.05 12.94 O ANISOU 1350 O GLY A 79 1744 1026 2147 -91 -15 -77 O ATOM 1351 H GLY A 79 18.973 42.023 38.420 0.05 11.93 H ANISOU 1351 H GLY A 79 1710 848 1974 19 -34 -33 H ATOM 1352 HA2 GLY A 79 20.624 43.106 39.427 0.05 12.41 H ANISOU 1352 HA2 GLY A 79 1714 939 2062 5 -70 -54 H ATOM 1353 HA3 GLY A 79 21.659 42.157 38.776 0.05 12.81 H ANISOU 1353 HA3 GLY A 79 1709 1011 2148 21 -45 -78 H ATOM 1354 N ASP A 80 20.784 43.441 36.311 0.05 12.65 N ANISOU 1354 N ASP A 80 1750 983 2075 -77 36 -65 N ATOM 1355 CA ASP A 80 21.100 44.380 35.253 0.05 12.96 C ANISOU 1355 CA ASP A 80 1797 1030 2097 -136 74 -60 C ATOM 1356 C ASP A 80 20.267 45.644 35.414 0.05 12.77 C ANISOU 1356 C ASP A 80 1827 974 2053 -161 52 -25 C ATOM 1357 O ASP A 80 19.149 45.642 35.898 0.05 12.37 O ANISOU 1357 O ASP A 80 1812 899 1987 -132 20 -6 O ATOM 1358 CB ASP A 80 20.819 43.780 33.872 0.05 13.08 C ANISOU 1358 CB ASP A 80 1835 1058 2077 -149 119 -64 C ATOM 1359 CG ASP A 80 21.697 42.576 33.551 0.05 13.42 C ANISOU 1359 CG ASP A 80 1826 1126 2147 -125 154 -108 C ATOM 1360 OD1 ASP A 80 22.720 42.366 34.218 0.05 13.71 O ANISOU 1360 OD1 ASP A 80 1799 1177 2233 -107 150 -132 O ATOM 1361 OD2 ASP A 80 21.351 41.862 32.598 0.05 13.49 O ANISOU 1361 OD2 ASP A 80 1859 1140 2127 -123 182 -122 O ATOM 1362 H ASP A 80 20.336 42.757 36.049 0.05 12.52 H ANISOU 1362 H ASP A 80 1747 961 2050 -60 43 -64 H ATOM 1363 HA ASP A 80 22.038 44.596 35.294 0.05 13.32 H ANISOU 1363 HA ASP A 80 1801 1093 2168 -154 88 -79 H ATOM 1364 HB2 ASP A 80 19.897 43.498 33.824 0.05 12.77 H ANISOU 1364 HB2 ASP A 80 1831 1006 2017 -132 102 -50 H ATOM 1365 HB3 ASP A 80 20.994 44.443 33.193 0.05 13.34 H ANISOU 1365 HB3 ASP A 80 1882 1099 2090 -190 144 -54 H ATOM 1366 N ALEU A 81 20.897 46.748 35.026 0.03 13.21 N ANISOU 1366 N ALEU A 81 1881 1025 2112 -215 73 -19 N ATOM 1367 N BLEU A 81 20.894 46.743 35.007 0.02 13.21 N ANISOU 1367 N BLEU A 81 1882 1026 2112 -216 75 -19 N ATOM 1368 CA ALEU A 81 20.253 48.057 34.986 0.03 13.25 C ANISOU 1368 CA ALEU A 81 1942 987 2106 -242 60 16 C ATOM 1369 CA BLEU A 81 20.257 48.055 34.956 0.02 13.27 C ANISOU 1369 CA BLEU A 81 1944 990 2108 -244 63 16 C ATOM 1370 C ALEU A 81 20.304 48.578 33.581 0.03 13.70 C ANISOU 1370 C ALEU A 81 2035 1042 2127 -292 104 47 C ATOM 1371 C BLEU A 81 20.271 48.576 33.536 0.02 13.70 C ANISOU 1371 C BLEU A 81 2038 1042 2124 -292 105 49 C ATOM 1372 O ALEU A 81 21.298 48.415 32.891 0.03 14.17 O ANISOU 1372 O ALEU A 81 2064 1134 2187 -332 154 31 O ATOM 1373 O BLEU A 81 21.230 48.388 32.799 0.02 14.16 O ANISOU 1373 O BLEU A 81 2069 1134 2178 -331 156 35 O ATOM 1374 CB ALEU A 81 20.980 49.036 35.883 0.03 13.55 C ANISOU 1374 CB ALEU A 81 1958 1006 2185 -270 45 -3 C ATOM 1375 CB BLEU A 81 20.972 49.035 35.869 0.02 13.61 C ANISOU 1375 CB BLEU A 81 1962 1016 2193 -275 50 -4 C ATOM 1376 CG ALEU A 81 21.522 48.567 37.218 0.03 13.45 C ANISOU 1376 CG ALEU A 81 1891 1017 2202 -237 8 -44 C ATOM 1377 CG BLEU A 81 20.722 48.957 37.374 0.02 13.35 C ANISOU 1377 CG BLEU A 81 1913 978 2181 -237 -2 -30 C ATOM 1378 CD1ALEU A 81 22.588 49.494 37.709 0.03 13.98 C ANISOU 1378 CD1ALEU A 81 1928 1078 2305 -282 -3 -72 C ATOM 1379 CD1BLEU A 81 20.271 47.612 37.882 0.02 12.84 C ANISOU 1379 CD1BLEU A 81 1840 936 2103 -170 -26 -34 C ATOM 1380 CD2ALEU A 81 20.416 48.425 38.236 0.03 12.90 C ANISOU 1380 CD2ALEU A 81 1858 930 2115 -179 -35 -35 C ATOM 1381 CD2BLEU A 81 22.002 49.311 38.058 0.02 13.85 C ANISOU 1381 CD2BLEU A 81 1912 1066 2285 -267 -9 -72 C ATOM 1382 H ALEU A 81 21.711 46.762 34.770 0.05 13.55 H ANISOU 1382 H ALEU A 81 1891 1087 2170 -238 98 -36 H ATOM 1383 H BLEU A 81 21.705 46.751 34.740 0.05 13.55 H ANISOU 1383 H BLEU A 81 1893 1088 2168 -239 101 -35 H ATOM 1384 HA ALEU A 81 19.334 47.990 35.268 0.05 12.91 H ANISOU 1384 HA ALEU A 81 1928 927 2051 -211 35 30 H ATOM 1385 HA BLEU A 81 19.340 47.983 35.245 0.05 12.93 H ANISOU 1385 HA BLEU A 81 1929 929 2055 -213 35 29 H ATOM 1386 HB2ALEU A 81 21.734 49.376 35.382 0.05 13.99 H ANISOU 1386 HB2ALEU A 81 1996 1070 2250 -314 77 -8 H ATOM 1387 HB2BLEU A 81 21.923 48.945 35.718 0.05 13.95 H ANISOU 1387 HB2BLEU A 81 1961 1086 2254 -301 74 -25 H ATOM 1388 HB3ALEU A 81 20.340 49.732 36.075 0.05 13.49 H ANISOU 1388 HB3ALEU A 81 1991 961 2173 -269 28 15 H ATOM 1389 HB3BLEU A 81 20.696 49.921 35.587 0.05 13.81 H ANISOU 1389 HB3BLEU A 81 2025 1008 2214 -304 56 19 H ATOM 1390 HG ALEU A 81 21.925 47.694 37.096 0.05 13.49 H ANISOU 1390 HG ALEU A 81 1857 1054 2213 -223 18 -59 H ATOM 1391 HG BLEU A 81 20.048 49.604 37.633 0.05 13.30 H ANISOU 1391 HG BLEU A 81 1945 936 2172 -237 -17 -18 H ATOM 1392 HD11ALEU A 81 22.194 50.344 37.966 0.05 13.98 H ANISOU 1392 HD11ALEU A 81 1970 1039 2303 -293 -14 -63 H ATOM 1393 HD11BLEU A 81 19.397 47.393 37.528 0.05 12.57 H ANISOU 1393 HD11BLEU A 81 1840 889 2047 -154 -22 -12 H ATOM 1394 HD12ALEU A 81 23.023 49.076 38.474 0.05 13.99 H ANISOU 1394 HD12ALEU A 81 1892 1103 2319 -259 -32 -98 H ATOM 1395 HD12BLEU A 81 20.922 46.948 37.600 0.05 12.95 H ANISOU 1395 HD12BLEU A 81 1815 978 2125 -165 -13 -48 H ATOM 1396 HD13ALEU A 81 23.234 49.634 37.000 0.05 14.38 H ANISOU 1396 HD13ALEU A 81 1955 1140 2370 -325 31 -77 H ATOM 1397 HD13BLEU A 81 20.234 47.646 38.850 0.05 12.78 H ANISOU 1397 HD13BLEU A 81 1830 925 2100 -151 -56 -46 H ATOM 1398 HD21ALEU A 81 20.799 48.537 39.123 0.05 12.94 H ANISOU 1398 HD21ALEU A 81 1837 949 2131 -163 -60 -56 H ATOM 1399 HD21BLEU A 81 21.901 49.149 39.011 0.05 13.75 H ANISOU 1399 HD21BLEU A 81 1894 1055 2275 -242 -47 -88 H ATOM 1400 HD22ALEU A 81 19.752 49.111 38.071 0.05 12.89 H ANISOU 1400 HD22ALEU A 81 1895 896 2109 -188 -41 -21 H ATOM 1401 HD22BLEU A 81 22.718 48.758 37.710 0.05 13.98 H ANISOU 1401 HD22BLEU A 81 1884 1118 2311 -264 7 -85 H ATOM 1402 HD23ALEU A 81 20.004 47.549 38.155 0.05 12.63 H ANISOU 1402 HD23ALEU A 81 1831 903 2063 -153 -29 -23 H ATOM 1403 HD23BLEU A 81 22.198 50.250 37.896 0.05 14.23 H ANISOU 1403 HD23BLEU A 81 1968 1093 2346 -316 7 -71 H ATOM 1404 N AILE A 82 19.217 49.200 33.151 0.02 13.66 N ANISOU 1404 N AILE A 82 2096 1003 2089 -287 87 93 N ATOM 1405 N BILE A 82 19.169 49.216 33.172 0.03 13.63 N ANISOU 1405 N BILE A 82 2095 998 2085 -284 84 94 N ATOM 1406 CA AILE A 82 19.173 49.782 31.832 0.02 14.22 C ANISOU 1406 CA AILE A 82 2217 1070 2114 -333 119 136 C ATOM 1407 CA BILE A 82 18.911 49.719 31.839 0.03 14.11 C ANISOU 1407 CA BILE A 82 2212 1053 2094 -320 108 142 C ATOM 1408 C AILE A 82 18.426 51.112 31.847 0.02 14.45 C ANISOU 1408 C AILE A 82 2312 1033 2145 -336 91 189 C ATOM 1409 C BILE A 82 18.401 51.129 31.943 0.03 14.41 C ANISOU 1409 C BILE A 82 2306 1024 2144 -332 86 189 C ATOM 1410 O AILE A 82 17.335 51.237 32.392 0.02 14.08 O ANISOU 1410 O AILE A 82 2283 959 2109 -285 42 199 O ATOM 1411 O BILE A 82 17.426 51.380 32.625 0.03 14.07 O ANISOU 1411 O BILE A 82 2280 948 2119 -284 39 196 O ATOM 1412 CB AILE A 82 18.679 48.730 30.792 0.02 14.16 C ANISOU 1412 CB AILE A 82 2227 1108 2046 -318 129 139 C ATOM 1413 CB BILE A 82 17.836 48.856 31.151 0.03 13.85 C ANISOU 1413 CB BILE A 82 2206 1047 2010 -283 87 154 C ATOM 1414 CG1AILE A 82 18.696 49.269 29.369 0.02 14.91 C ANISOU 1414 CG1AILE A 82 2377 1215 2075 -372 168 182 C ATOM 1415 CG1BILE A 82 18.434 47.507 30.737 0.03 13.83 C ANISOU 1415 CG1BILE A 82 2166 1102 1988 -285 124 110 C ATOM 1416 CG2AILE A 82 17.332 48.178 31.183 0.02 13.66 C ANISOU 1416 CG2AILE A 82 2184 1032 1974 -261 72 152 C ATOM 1417 CG2BILE A 82 17.152 49.615 30.009 0.03 14.37 C ANISOU 1417 CG2BILE A 82 2344 1096 2019 -301 79 218 C ATOM 1418 CD1AILE A 82 18.911 48.188 28.301 0.02 15.18 C ANISOU 1418 CD1AILE A 82 2402 1313 2052 -387 215 153 C ATOM 1419 CD1BILE A 82 18.988 47.417 29.305 0.03 14.56 C ANISOU 1419 CD1BILE A 82 2275 1228 2029 -342 186 115 C ATOM 1420 H AILE A 82 18.498 49.277 33.595 0.05 13.37 H ANISOU 1420 H AILE A 82 2077 949 2055 -257 56 101 H ATOM 1421 H BILE A 82 18.531 49.367 33.711 0.05 13.36 H ANISOU 1421 H BILE A 82 2073 943 2058 -255 52 100 H ATOM 1422 HA AILE A 82 20.082 49.993 31.591 0.05 14.61 H ANISOU 1422 HA AILE A 82 2247 1131 2173 -375 157 126 H ATOM 1423 HA BILE A 82 19.718 49.717 31.311 0.05 14.50 H ANISOU 1423 HA BILE A 82 2249 1124 2136 -360 150 135 H ATOM 1424 HB AILE A 82 19.308 47.995 30.831 0.05 14.06 H ANISOU 1424 HB AILE A 82 2172 1126 2044 -312 149 101 H ATOM 1425 HB BILE A 82 17.156 48.672 31.812 0.05 13.44 H ANISOU 1425 HB BILE A 82 2148 982 1977 -243 52 149 H ATOM 1426 HG12AILE A 82 17.852 49.709 29.183 0.05 14.96 H ANISOU 1426 HG12AILE A 82 2430 1201 2054 -358 136 222 H ATOM 1427 HG12BILE A 82 19.190 47.362 31.321 0.05 13.67 H ANISOU 1427 HG12BILE A 82 2100 1086 2008 -275 131 77 H ATOM 1428 HG13AILE A 82 19.421 49.904 29.297 0.05 15.30 H ANISOU 1428 HG13AILE A 82 2425 1249 2140 -412 197 191 H ATOM 1429 HG13BILE A 82 17.770 46.820 30.880 0.05 13.60 H ANISOU 1429 HG13BILE A 82 2146 1082 1939 -257 102 107 H ATOM 1430 HG21AILE A 82 16.898 47.821 30.392 0.05 13.62 H ANISOU 1430 HG21AILE A 82 2179 1057 1938 -253 75 141 H ATOM 1431 HG21BILE A 82 16.440 50.157 30.380 0.05 14.29 H ANISOU 1431 HG21BILE A 82 2354 1049 2026 -277 43 241 H ATOM 1432 HG22AILE A 82 17.458 47.454 31.828 0.05 13.28 H ANISOU 1432 HG22AILE A 82 2109 973 1965 -233 52 131 H ATOM 1433 HG22BILE A 82 17.803 50.178 29.560 0.05 14.85 H ANISOU 1433 HG22BILE A 82 2421 1154 2069 -346 114 234 H ATOM 1434 HG23AILE A 82 16.798 48.895 31.559 0.05 13.86 H ANISOU 1434 HG23AILE A 82 2250 1029 1987 -262 52 192 H ATOM 1435 HG23BILE A 82 16.772 48.981 29.384 0.05 14.37 H ANISOU 1435 HG23BILE A 82 2355 1128 1978 -292 74 217 H ATOM 1436 HD11AILE A 82 18.208 47.527 28.378 0.05 14.87 H ANISOU 1436 HD11AILE A 82 2369 1285 1996 -353 185 144 H ATOM 1437 HD11BILE A 82 19.851 47.862 29.275 0.05 14.88 H ANISOU 1437 HD11BILE A 82 2317 1253 2085 -377 207 130 H ATOM 1438 HD12AILE A 82 18.893 48.606 27.425 0.05 15.74 H ANISOU 1438 HD12AILE A 82 2515 1391 2074 -425 241 184 H ATOM 1439 HD12BILE A 82 19.092 46.482 29.064 0.05 14.58 H ANISOU 1439 HD12BILE A 82 2242 1262 2037 -340 216 74 H ATOM 1440 HD13AILE A 82 19.778 47.776 28.444 0.05 15.18 H ANISOU 1440 HD13AILE A 82 2352 1333 2084 -394 247 111 H ATOM 1441 HD13BILE A 82 18.382 47.834 28.677 0.05 14.75 H ANISOU 1441 HD13BILE A 82 2345 1257 2001 -346 177 144 H ATOM 1442 N AILE A 83 19.097 52.087 31.248 0.02 15.18 N ANISOU 1442 N AILE A 83 2437 1099 2233 -400 128 222 N ATOM 1443 N BILE A 83 19.079 52.026 31.243 0.03 15.14 N ANISOU 1443 N BILE A 83 2429 1095 2229 -397 126 219 N ATOM 1444 CA AILE A 83 18.620 53.461 31.137 0.02 15.66 C ANISOU 1444 CA AILE A 83 2563 1078 2308 -413 111 274 C ATOM 1445 CA BILE A 83 18.578 53.381 31.066 0.03 15.67 C ANISOU 1445 CA BILE A 83 2565 1083 2305 -413 113 275 C ATOM 1446 C AILE A 83 17.886 53.549 29.799 0.02 16.21 C ANISOU 1446 C AILE A 83 2711 1139 2309 -420 112 350 C ATOM 1447 C BILE A 83 17.803 53.421 29.773 0.03 16.12 C ANISOU 1447 C BILE A 83 2694 1142 2289 -414 110 345 C ATOM 1448 O AILE A 83 18.414 53.110 28.767 0.02 16.87 O ANISOU 1448 O AILE A 83 2818 1242 2351 -483 166 376 O ATOM 1449 O BILE A 83 18.218 52.886 28.750 0.03 16.60 O ANISOU 1449 O BILE A 83 2768 1245 2295 -464 160 361 O ATOM 1450 CB AILE A 83 19.794 54.477 31.166 0.02 16.32 C ANISOU 1450 CB AILE A 83 2639 1124 2439 -490 154 264 C ATOM 1451 CB BILE A 83 19.677 54.438 31.021 0.03 16.39 C ANISOU 1451 CB BILE A 83 2657 1134 2438 -494 158 273 C ATOM 1452 CG1AILE A 83 20.836 54.133 32.233 0.02 15.96 C ANISOU 1452 CG1AILE A 83 2510 1100 2454 -489 146 185 C ATOM 1453 CG1BILE A 83 20.089 54.825 32.421 0.03 16.19 C ANISOU 1453 CG1BILE A 83 2598 1066 2486 -483 128 224 C ATOM 1454 CG2AILE A 83 19.296 55.921 31.331 0.02 16.95 C ANISOU 1454 CG2AILE A 83 2799 1102 2540 -505 140 320 C ATOM 1455 CG2BILE A 83 19.178 55.731 30.354 0.03 17.29 C ANISOU 1455 CG2BILE A 83 2864 1177 2528 -533 173 356 C ATOM 1456 CD1AILE A 83 20.336 54.027 33.655 0.02 15.31 C ANISOU 1456 CD1AILE A 83 2419 996 2400 -418 83 155 C ATOM 1457 CD1BILE A 83 20.985 53.915 33.034 0.03 15.71 C ANISOU 1457 CD1BILE A 83 2448 1070 2451 -472 125 151 C ATOM 1458 H AILE A 83 19.859 51.973 30.880 0.05 15.50 H ANISOU 1458 H AILE A 83 2463 1163 2262 -438 168 215 H ATOM 1459 H BILE A 83 19.826 51.878 30.859 0.05 15.42 H ANISOU 1459 H BILE A 83 2447 1157 2256 -433 165 209 H ATOM 1460 HA AILE A 83 18.004 53.665 31.854 0.05 15.33 H ANISOU 1460 HA AILE A 83 2523 1010 2292 -369 72 267 H ATOM 1461 HA BILE A 83 17.971 53.602 31.785 0.05 15.37 H ANISOU 1461 HA BILE A 83 2531 1014 2294 -372 74 270 H ATOM 1462 HB AILE A 83 20.247 54.426 30.310 0.05 16.73 H ANISOU 1462 HB AILE A 83 2689 1203 2466 -537 199 274 H ATOM 1463 HB BILE A 83 20.445 54.111 30.530 0.05 16.55 H ANISOU 1463 HB BILE A 83 2638 1198 2452 -530 199 250 H ATOM 1464 HG12AILE A 83 21.226 53.277 31.999 0.05 15.77 H ANISOU 1464 HG12AILE A 83 2439 1133 2419 -486 162 158 H ATOM 1465 HG12BILE A 83 20.535 55.687 32.391 0.05 16.76 H ANISOU 1465 HG12BILE A 83 2686 1096 2584 -534 150 231 H ATOM 1466 HG13AILE A 83 21.525 54.816 32.211 0.05 16.45 H ANISOU 1466 HG13AILE A 83 2568 1135 2549 -540 167 178 H ATOM 1467 HG13BILE A 83 19.294 54.900 32.970 0.05 15.91 H ANISOU 1467 HG13BILE A 83 2588 1002 2456 -434 89 233 H ATOM 1468 HG21AILE A 83 19.404 56.192 32.254 0.05 17.10 H ANISOU 1468 HG21AILE A 83 2799 1088 2609 -529 144 290 H ATOM 1469 HG21BILE A 83 19.845 56.426 30.478 0.05 17.72 H ANISOU 1469 HG21BILE A 83 2922 1189 2623 -578 193 351 H ATOM 1470 HG22AILE A 83 19.831 56.490 30.756 0.05 17.55 H ANISOU 1470 HG22AILE A 83 2915 1167 2585 -546 172 365 H ATOM 1471 HG22BILE A 83 19.043 55.586 29.405 0.05 17.62 H ANISOU 1471 HG22BILE A 83 2925 1252 2519 -561 205 383 H ATOM 1472 HG23AILE A 83 18.365 55.964 31.071 0.05 16.70 H ANISOU 1472 HG23AILE A 83 2793 1048 2503 -449 99 338 H ATOM 1473 HG23BILE A 83 18.344 55.991 30.772 0.05 17.17 H ANISOU 1473 HG23BILE A 83 2887 1127 2510 -485 130 385 H ATOM 1474 HD11AILE A 83 19.674 53.325 33.693 0.05 14.87 H ANISOU 1474 HD11AILE A 83 2369 963 2318 -371 64 165 H ATOM 1475 HD11BILE A 83 20.618 53.014 33.004 0.05 15.24 H ANISOU 1475 HD11BILE A 83 2374 1050 2365 -429 113 146 H ATOM 1476 HD12AILE A 83 21.088 53.812 34.230 0.05 15.17 H ANISOU 1476 HD12AILE A 83 2351 1004 2409 -420 79 109 H ATOM 1477 HD12BILE A 83 21.797 53.965 32.517 0.05 16.09 H ANISOU 1477 HD12BILE A 83 2464 1141 2508 -521 162 136 H ATOM 1478 HD13AILE A 83 19.945 54.872 33.930 0.05 15.56 H ANISOU 1478 HD13AILE A 83 2491 969 2452 -420 70 172 H ATOM 1479 HD13BILE A 83 21.151 54.185 33.950 0.05 15.59 H ANISOU 1479 HD13BILE A 83 2423 1031 2471 -458 97 124 H ATOM 1480 N ILE A 84 16.652 54.043 29.825 0.05 16.04 N ANISOU 1480 N ILE A 84 2725 1093 2275 -356 52 384 N ATOM 1481 CA ILE A 84 15.914 54.266 28.606 0.05 16.55 C ANISOU 1481 CA ILE A 84 2857 1162 2269 -342 26 455 C ATOM 1482 C ILE A 84 16.261 55.659 28.071 0.05 17.59 C ANISOU 1482 C ILE A 84 3072 1216 2395 -382 40 535 C ATOM 1483 O ILE A 84 15.952 56.687 28.699 0.05 17.80 O ANISOU 1483 O ILE A 84 3128 1156 2479 -353 9 558 O ATOM 1484 CB ILE A 84 14.440 54.200 28.846 0.05 16.11 C ANISOU 1484 CB ILE A 84 2792 1103 2226 -254 -49 456 C ATOM 1485 CG1 ILE A 84 14.002 52.867 29.399 0.05 15.14 C ANISOU 1485 CG1 ILE A 84 2589 1038 2126 -221 -55 378 C ATOM 1486 CG2 ILE A 84 13.689 54.515 27.538 0.05 16.69 C ANISOU 1486 CG2 ILE A 84 2920 1199 2223 -233 -91 523 C ATOM 1487 CD1 ILE A 84 14.389 51.660 28.531 0.05 15.01 C ANISOU 1487 CD1 ILE A 84 2555 1104 2046 -237 -38 355 C ATOM 1488 H AILE A 84 16.216 54.220 30.536 0.05 15.66 H ANISOU 1488 H AILE A 84 2659 1030 2261 -316 22 364 H ATOM 1489 H BILE A 84 16.271 54.318 30.535 0.05 15.73 H ANISOU 1489 H BILE A 84 2673 1030 2273 -320 23 368 H ATOM 1490 HA ILE A 84 16.135 53.617 27.925 0.05 16.60 H ANISOU 1490 HA ILE A 84 2859 1224 2224 -361 47 449 H ATOM 1491 HB ILE A 84 14.224 54.890 29.498 0.05 16.19 H ANISOU 1491 HB ILE A 84 2813 1055 2285 -234 -66 465 H ATOM 1492 HG12 ILE A 84 14.409 52.728 30.270 0.05 14.88 H ANISOU 1492 HG12 ILE A 84 2524 998 2130 -236 -31 340 H ATOM 1493 HG13 ILE A 84 13.038 52.870 29.496 0.05 14.94 H ANISOU 1493 HG13 ILE A 84 2555 1001 2119 -173 -95 377 H ATOM 1494 HG21 ILE A 84 12.741 54.429 27.714 0.05 16.48 H ANISOU 1494 HG21 ILE A 84 2877 1171 2214 -180 -139 520 H ATOM 1495 HG22 ILE A 84 13.885 55.415 27.236 0.05 17.36 H ANISOU 1495 HG22 ILE A 84 3061 1240 2296 -250 -90 579 H ATOM 1496 HG23 ILE A 84 13.957 53.865 26.873 0.05 16.69 H ANISOU 1496 HG23 ILE A 84 2914 1257 2169 -257 -73 510 H ATOM 1497 HD11 ILE A 84 15.351 51.605 28.452 0.05 15.26 H ANISOU 1497 HD11 ILE A 84 2590 1149 2058 -283 7 351 H ATOM 1498 HD12 ILE A 84 14.055 50.862 28.967 0.05 14.47 H ANISOU 1498 HD12 ILE A 84 2442 1058 1999 -214 -43 311 H ATOM 1499 HD13 ILE A 84 13.978 51.740 27.658 0.05 15.32 H ANISOU 1499 HD13 ILE A 84 2624 1155 2040 -224 -67 388 H ATOM 1500 N PRO A 85 16.898 55.725 26.904 0.05 18.34 N ANISOU 1500 N PRO A 85 3210 1336 2421 -452 94 575 N ATOM 1501 CA PRO A 85 17.086 57.075 26.369 0.05 19.47 C ANISOU 1501 CA PRO A 85 3442 1402 2555 -504 120 659 C ATOM 1502 C PRO A 85 15.762 57.773 26.118 0.05 19.94 C ANISOU 1502 C PRO A 85 3574 1394 2607 -438 45 739 C ATOM 1503 O PRO A 85 14.717 57.242 25.798 0.05 19.73 O ANISOU 1503 O PRO A 85 3548 1407 2541 -370 -20 753 O ATOM 1504 CB PRO A 85 17.822 56.812 25.066 0.05 20.18 C ANISOU 1504 CB PRO A 85 3567 1560 2539 -573 182 691 C ATOM 1505 CG PRO A 85 18.557 55.541 25.322 0.05 19.36 C ANISOU 1505 CG PRO A 85 3370 1558 2427 -572 211 595 C ATOM 1506 CD PRO A 85 17.588 54.720 26.072 0.05 18.31 C ANISOU 1506 CD PRO A 85 3185 1433 2338 -483 136 548 C ATOM 1507 HA PRO A 85 17.636 57.611 26.960 0.05 19.57 H ANISOU 1507 HA PRO A 85 3441 1370 2626 -539 149 640 H ATOM 1508 HB2 PRO A 85 17.175 56.680 24.358 0.05 20.54 H ANISOU 1508 HB2 PRO A 85 3666 1616 2522 -548 147 744 H ATOM 1509 HB3 PRO A 85 18.427 57.542 24.863 0.05 20.80 H ANISOU 1509 HB3 PRO A 85 3670 1607 2626 -637 235 713 H ATOM 1510 HG2 PRO A 85 18.807 55.129 24.482 0.05 19.67 H ANISOU 1510 HG2 PRO A 85 3431 1652 2389 -589 229 607 H ATOM 1511 HG3 PRO A 85 19.333 55.721 25.872 0.05 19.31 H ANISOU 1511 HG3 PRO A 85 3320 1551 2465 -613 258 555 H ATOM 1512 HD2 PRO A 85 16.959 54.287 25.477 0.05 18.29 H ANISOU 1512 HD2 PRO A 85 3203 1462 2286 -449 98 566 H ATOM 1513 HD3 PRO A 85 18.064 54.087 26.624 0.05 17.76 H ANISOU 1513 HD3 PRO A 85 3050 1397 2301 -484 156 484 H ATOM 1514 N LEU A 86 15.845 59.092 26.285 0.05 20.75 N ANISOU 1514 N LEU A 86 3741 1386 2758 -462 55 794 N ATOM 1515 CA LEU A 86 14.666 59.937 26.161 0.05 21.35 C ANISOU 1515 CA LEU A 86 3887 1375 2852 -390 -17 871 C ATOM 1516 C LEU A 86 14.104 59.817 24.770 0.05 22.09 C ANISOU 1516 C LEU A 86 4050 1512 2831 -369 -56 962 C ATOM 1517 O LEU A 86 14.836 59.758 23.800 0.05 22.77 O ANISOU 1517 O LEU A 86 4188 1636 2829 -443 -4 1007 O ATOM 1518 CB LEU A 86 14.970 61.405 26.511 0.05 22.29 C ANISOU 1518 CB LEU A 86 4074 1351 3045 -425 9 915 C ATOM 1519 CG LEU A 86 15.646 61.552 27.888 0.05 21.67 C ANISOU 1519 CG LEU A 86 3927 1230 3077 -444 36 814 C ATOM 1520 CD1 LEU A 86 15.311 62.926 28.493 0.05 22.72 C ANISOU 1520 CD1 LEU A 86 4137 1201 3295 -457 41 855 C ATOM 1521 CD2 LEU A 86 15.308 60.392 28.846 0.05 20.41 C ANISOU 1521 CD2 LEU A 86 3673 1125 2955 -357 -15 723 C ATOM 1522 H LEU A 86 16.570 59.518 26.462 0.05 21.04 H ANISOU 1522 H LEU A 86 3782 1393 2819 -519 102 788 H ATOM 1523 HA LEU A 86 13.979 59.599 26.757 0.05 20.74 H ANISOU 1523 HA LEU A 86 3764 1303 2813 -325 -61 831 H ATOM 1524 HB2 LEU A 86 15.566 61.780 25.844 0.05 22.97 H ANISOU 1524 HB2 LEU A 86 4206 1428 3094 -496 59 957 H ATOM 1525 HB3 LEU A 86 14.133 61.893 26.523 0.05 22.72 H ANISOU 1525 HB3 LEU A 86 4172 1347 3115 -367 -41 965 H ATOM 1526 HG LEU A 86 16.606 61.533 27.752 0.05 21.55 H ANISOU 1526 HG LEU A 86 3880 1255 3054 -513 90 780 H ATOM 1527 HD11 LEU A 86 16.019 63.551 28.260 0.05 23.06 H ANISOU 1527 HD11 LEU A 86 4185 1223 3356 -539 97 843 H ATOM 1528 HD12 LEU A 86 14.472 63.248 28.133 0.05 23.48 H ANISOU 1528 HD12 LEU A 86 4306 1252 3364 -435 19 939 H ATOM 1529 HD13 LEU A 86 15.241 62.849 29.452 0.05 22.35 H ANISOU 1529 HD13 LEU A 86 4061 1122 3310 -407 12 807 H ATOM 1530 HD21 LEU A 86 15.460 60.694 29.752 0.05 20.36 H ANISOU 1530 HD21 LEU A 86 3656 1060 3018 -345 -18 686 H ATOM 1531 HD22 LEU A 86 14.378 60.146 28.745 0.05 20.38 H ANISOU 1531 HD22 LEU A 86 3680 1135 2929 -293 -64 754 H ATOM 1532 HD23 LEU A 86 15.883 59.642 28.649 0.05 19.79 H ANISOU 1532 HD23 LEU A 86 3538 1127 2854 -382 8 673 H ATOM 1533 N ASP A 87 12.791 59.705 24.706 0.05 21.96 N ANISOU 1533 N ASP A 87 4025 1504 2815 -269 -148 979 N ATOM 1534 CA ASP A 87 12.092 59.598 23.438 0.05 22.75 C ANISOU 1534 CA ASP A 87 4185 1651 2809 -235 -211 1063 C ATOM 1535 C ASP A 87 12.355 58.297 22.677 0.05 22.39 C ANISOU 1535 C ASP A 87 4110 1747 2651 -274 -192 1024 C ATOM 1536 O ASP A 87 12.020 58.198 21.515 0.05 23.23 O ANISOU 1536 O ASP A 87 4278 1904 2644 -275 -227 1090 O ATOM 1537 CB ASP A 87 12.435 60.802 22.564 0.05 24.33 C ANISOU 1537 CB ASP A 87 4516 1760 2968 -266 -204 1195 C ATOM 1538 CG ASP A 87 12.149 62.111 23.266 0.05 24.88 C ANISOU 1538 CG ASP A 87 4623 1680 3152 -202 -244 1239 C ATOM 1539 OD1 ASP A 87 13.016 63.007 23.252 0.05 25.72 O ANISOU 1539 OD1 ASP A 87 4803 1677 3291 -261 -189 1290 O ATOM 1540 OD2 ASP A 87 11.058 62.222 23.841 0.05 24.56 O ANISOU 1540 OD2 ASP A 87 4533 1629 3170 -95 -325 1217 O ATOM 1541 H ASP A 87 12.276 59.692 25.396 0.05 21.47 H ANISOU 1541 H ASP A 87 3919 1425 2813 -220 -176 939 H ATOM 1542 HA ASP A 87 11.140 59.636 23.615 0.05 22.62 H ANISOU 1542 HA ASP A 87 4144 1628 2823 -159 -278 1062 H ATOM 1543 HB2 ASP A 87 13.368 60.786 22.309 0.05 24.53 H ANISOU 1543 HB2 ASP A 87 4564 1779 2977 -346 -131 1195 H ATOM 1544 HB3 ASP A 87 11.880 60.767 21.770 0.05 24.91 H ANISOU 1544 HB3 ASP A 87 4631 1875 2958 -246 -248 1251 H ATOM 1545 N SER A 88 12.924 57.295 23.347 0.05 21.23 N ANISOU 1545 N SER A 88 3870 1660 2537 -300 -143 914 N ATOM 1546 CA SER A 88 13.184 56.012 22.660 0.05 20.88 C ANISOU 1546 CA SER A 88 3791 1739 2403 -332 -119 859 C ATOM 1547 C SER A 88 11.928 55.152 22.494 0.05 20.50 C ANISOU 1547 C SER A 88 3700 1753 2335 -256 -208 833 C ATOM 1548 O SER A 88 10.987 55.274 23.223 0.05 19.80 O ANISOU 1548 O SER A 88 3548 1638 2337 -192 -252 793 O ATOM 1549 CB SER A 88 14.298 55.188 23.341 0.05 19.92 C ANISOU 1549 CB SER A 88 3585 1652 2332 -380 -36 754 C ATOM 1550 OG SER A 88 14.266 55.171 24.756 0.05 18.77 O ANISOU 1550 OG SER A 88 3349 1501 2283 -326 -62 674 O ATOM 1551 H SER A 88 13.168 57.327 24.169 0.05 20.70 H ANISOU 1551 H SER A 88 3760 1563 2541 -299 -124 868 H ATOM 1552 HA SER A 88 13.505 56.208 21.767 0.05 21.64 H ANISOU 1552 HA SER A 88 3948 1858 2417 -374 -97 907 H ATOM 1553 HB2 SER A 88 14.212 54.272 23.034 0.05 19.92 H ANISOU 1553 HB2 SER A 88 3577 1724 2269 -405 -13 728 H ATOM 1554 HB3 SER A 88 15.156 55.544 23.055 0.05 20.21 H ANISOU 1554 HB3 SER A 88 3639 1648 2392 -428 16 767 H ATOM 1555 HG SER A 88 14.344 54.384 25.035 0.05 18.66 H ANISOU 1555 HG SER A 88 3328 1493 2270 -278 -116 680 H ATOM 1556 N GLU A 89 11.937 54.256 21.527 0.05 21.06 N ANISOU 1556 N GLU A 89 3806 1910 2286 -272 -230 850 N ATOM 1557 CA GLU A 89 10.861 53.303 21.330 0.05 20.68 C ANISOU 1557 CA GLU A 89 3704 1945 2209 -230 -294 796 C ATOM 1558 C GLU A 89 11.107 51.964 22.095 0.05 19.53 C ANISOU 1558 C GLU A 89 3471 1838 2112 -255 -229 681 C ATOM 1559 O GLU A 89 11.638 50.997 21.519 0.05 19.48 O ANISOU 1559 O GLU A 89 3468 1856 2078 -321 -141 647 O ATOM 1560 CB GLU A 89 10.733 53.049 19.845 0.05 21.66 C ANISOU 1560 CB GLU A 89 3892 2158 2181 -261 -316 826 C ATOM 1561 CG GLU A 89 9.494 52.282 19.469 0.05 21.71 C ANISOU 1561 CG GLU A 89 3859 2242 2148 -214 -413 792 C ATOM 1562 CD GLU A 89 8.976 52.638 18.060 0.05 23.13 C ANISOU 1562 CD GLU A 89 4130 2491 2167 -232 -466 860 C ATOM 1563 OE1 GLU A 89 8.265 53.663 17.895 0.05 24.18 O ANISOU 1563 OE1 GLU A 89 4330 2589 2267 -192 -541 971 O ATOM 1564 OE2 GLU A 89 9.291 51.913 17.093 0.05 23.31 O ANISOU 1564 OE2 GLU A 89 4164 2601 2091 -288 -429 803 O ATOM 1565 H GLU A 89 12.565 54.177 20.973 0.05 21.75 H ANISOU 1565 H GLU A 89 3953 2010 2303 -310 -208 894 H ATOM 1566 HA GLU A 89 10.027 53.693 21.635 0.05 20.61 H ANISOU 1566 HA GLU A 89 3671 1912 2247 -170 -359 807 H ATOM 1567 HB2 GLU A 89 10.695 53.904 19.383 0.05 22.54 H ANISOU 1567 HB2 GLU A 89 4075 2241 2247 -263 -335 910 H ATOM 1568 HB3 GLU A 89 11.502 52.541 19.546 0.05 21.55 H ANISOU 1568 HB3 GLU A 89 3877 2182 2130 -316 -247 785 H ATOM 1569 HG2 GLU A 89 9.701 51.353 19.517 0.05 21.10 H ANISOU 1569 HG2 GLU A 89 3731 2206 2080 -232 -382 712 H ATOM 1570 HG3 GLU A 89 8.800 52.490 20.108 0.05 21.56 H ANISOU 1570 HG3 GLU A 89 3807 2189 2195 -156 -472 805 H ATOM 1571 N HIS A 90 10.662 51.864 23.350 0.05 18.69 N ANISOU 1571 N HIS A 90 3284 1733 2083 -202 -269 621 N ATOM 1572 CA HIS A 90 11.101 50.778 24.235 0.05 17.80 C ANISOU 1572 CA HIS A 90 3103 1663 1997 -224 -217 521 C ATOM 1573 C HIS A 90 9.976 49.803 24.554 0.05 17.48 C ANISOU 1573 C HIS A 90 3006 1669 1966 -179 -284 473 C ATOM 1574 O HIS A 90 8.870 50.198 24.645 0.05 18.20 O ANISOU 1574 O HIS A 90 3122 1787 2005 -152 -364 517 O ATOM 1575 CB HIS A 90 11.769 51.406 25.503 0.05 17.06 C ANISOU 1575 CB HIS A 90 2968 1507 2007 -225 -165 493 C ATOM 1576 CG HIS A 90 10.839 51.732 26.652 0.05 16.62 C ANISOU 1576 CG HIS A 90 2875 1398 2043 -160 -216 495 C ATOM 1577 ND1 HIS A 90 11.322 51.960 27.917 0.05 16.50 N ANISOU 1577 ND1 HIS A 90 2864 1304 2102 -152 -198 511 N ATOM 1578 CD2 HIS A 90 9.496 51.662 26.792 0.05 16.30 C ANISOU 1578 CD2 HIS A 90 2783 1373 2036 -104 -275 469 C ATOM 1579 CE1 HIS A 90 10.321 52.057 28.772 0.05 16.16 C ANISOU 1579 CE1 HIS A 90 2781 1230 2129 -89 -243 497 C ATOM 1580 NE2 HIS A 90 9.196 51.917 28.107 0.05 16.06 N ANISOU 1580 NE2 HIS A 90 2733 1275 2094 -58 -290 476 N ATOM 1581 H HIS A 90 10.101 52.396 23.717 0.05 18.66 H ANISOU 1581 H HIS A 90 3265 1707 2117 -156 -320 636 H ATOM 1582 HA HIS A 90 11.783 50.262 23.782 0.05 18.05 H ANISOU 1582 HA HIS A 90 3154 1734 1969 -268 -174 506 H ATOM 1583 HB2 HIS A 90 12.404 50.757 25.840 0.05 16.57 H ANISOU 1583 HB2 HIS A 90 2864 1472 1959 -240 -129 433 H ATOM 1584 HB3 HIS A 90 12.258 52.201 25.245 0.05 17.41 H ANISOU 1584 HB3 HIS A 90 3049 1521 2046 -257 -130 528 H ATOM 1585 HD2 HIS A 90 8.869 51.526 26.136 0.05 16.33 H ANISOU 1585 HD2 HIS A 90 2772 1425 2009 -99 -300 449 H ATOM 1586 HE1 HIS A 90 10.395 52.261 29.672 0.05 16.10 H ANISOU 1586 HE1 HIS A 90 2773 1169 2176 -71 -242 501 H ATOM 1587 N HIS A 91 10.265 48.503 24.616 0.05 16.65 N ANISOU 1587 N HIS A 91 2834 1583 1909 -184 -248 387 N ATOM 1588 CA HIS A 91 9.328 47.524 25.197 0.05 16.10 C ANISOU 1588 CA HIS A 91 2693 1530 1893 -149 -285 328 C ATOM 1589 C HIS A 91 10.146 46.311 25.631 0.05 15.39 C ANISOU 1589 C HIS A 91 2562 1450 1836 -176 -213 246 C ATOM 1590 O HIS A 91 11.324 46.218 25.325 0.05 15.39 O ANISOU 1590 O HIS A 91 2580 1449 1819 -214 -145 235 O ATOM 1591 CB HIS A 91 8.181 47.140 24.212 0.05 16.71 C ANISOU 1591 CB HIS A 91 2767 1671 1911 -140 -362 323 C ATOM 1592 CG HIS A 91 8.559 46.254 23.051 0.05 17.30 C ANISOU 1592 CG HIS A 91 2884 1816 1876 -193 -346 293 C ATOM 1593 ND1 HIS A 91 9.138 46.729 21.894 0.05 18.15 N ANISOU 1593 ND1 HIS A 91 3072 1947 1876 -229 -332 344 N ATOM 1594 CD2 HIS A 91 8.321 44.933 22.823 0.05 17.25 C ANISOU 1594 CD2 HIS A 91 2850 1856 1848 -220 -334 210 C ATOM 1595 CE1 HIS A 91 9.274 45.748 21.021 0.05 18.58 C ANISOU 1595 CE1 HIS A 91 3146 2069 1844 -274 -311 288 C ATOM 1596 NE2 HIS A 91 8.817 44.635 21.575 0.05 18.03 N ANISOU 1596 NE2 HIS A 91 3011 2010 1830 -269 -312 203 N ATOM 1597 H HIS A 91 11.000 48.163 24.339 0.05 16.43 H ANISOU 1597 H HIS A 91 2803 1558 1884 -213 -194 360 H ATOM 1598 HA HIS A 91 8.921 47.917 25.982 0.05 15.83 H ANISOU 1598 HA HIS A 91 2636 1457 1921 -114 -303 342 H ATOM 1599 HB2 HIS A 91 7.505 46.676 24.722 0.05 16.25 H ANISOU 1599 HB2 HIS A 91 2659 1617 1899 -132 -359 272 H ATOM 1600 HB3 HIS A 91 7.801 47.948 23.850 0.05 17.07 H ANISOU 1600 HB3 HIS A 91 2814 1708 1962 -105 -420 366 H ATOM 1601 HD2 HIS A 91 7.937 44.337 23.422 0.05 16.82 H ANISOU 1601 HD2 HIS A 91 2747 1795 1849 -210 -335 166 H ATOM 1602 HE1 HIS A 91 9.669 45.823 20.185 0.05 19.21 H ANISOU 1602 HE1 HIS A 91 3279 2181 1838 -307 -294 304 H ATOM 1603 N AVAL A 92 9.492 45.364 26.311 0.03 14.89 N ANISOU 1603 N AVAL A 92 2440 1390 1827 -154 -227 193 N ATOM 1604 N BVAL A 92 9.486 45.358 26.285 0.02 14.88 N ANISOU 1604 N BVAL A 92 2438 1388 1827 -154 -226 193 N ATOM 1605 CA AVAL A 92 10.132 44.210 26.927 0.03 14.35 C ANISOU 1605 CA AVAL A 92 2336 1319 1796 -169 -170 124 C ATOM 1606 CA BVAL A 92 10.136 44.219 26.916 0.02 14.34 C ANISOU 1606 CA BVAL A 92 2336 1318 1796 -169 -169 123 C ATOM 1607 C AVAL A 92 9.562 42.902 26.393 0.03 14.54 C ANISOU 1607 C AVAL A 92 2344 1384 1797 -187 -179 60 C ATOM 1608 C BVAL A 92 9.564 42.901 26.399 0.02 14.57 C ANISOU 1608 C BVAL A 92 2349 1388 1797 -188 -179 61 C ATOM 1609 O AVAL A 92 8.349 42.750 26.369 0.03 14.67 O ANISOU 1609 O AVAL A 92 2335 1414 1825 -173 -234 54 O ATOM 1610 O BVAL A 92 8.351 42.729 26.391 0.02 14.73 O ANISOU 1610 O BVAL A 92 2347 1426 1825 -175 -236 57 O ATOM 1611 CB AVAL A 92 9.897 44.269 28.425 0.03 13.63 C ANISOU 1611 CB AVAL A 92 2200 1180 1799 -133 -165 118 C ATOM 1612 CB BVAL A 92 9.923 44.306 28.425 0.02 13.60 C ANISOU 1612 CB BVAL A 92 2194 1176 1797 -134 -161 114 C ATOM 1613 CG1AVAL A 92 10.582 43.146 29.147 0.03 13.18 C ANISOU 1613 CG1AVAL A 92 2113 1115 1781 -139 -115 61 C ATOM 1614 CG1BVAL A 92 10.577 43.162 29.141 0.02 13.19 C ANISOU 1614 CG1BVAL A 92 2111 1119 1782 -141 -115 52 C ATOM 1615 CG2AVAL A 92 10.396 45.594 28.970 0.03 13.52 C ANISOU 1615 CG2AVAL A 92 2203 1122 1810 -122 -153 166 C ATOM 1616 CG2BVAL A 92 10.455 45.638 28.962 0.02 13.42 C ANISOU 1616 CG2BVAL A 92 2186 1110 1805 -124 -143 155 C ATOM 1617 H AVAL A 92 8.644 45.384 26.438 0.05 14.89 H ANISOU 1617 H AVAL A 92 2420 1389 1850 -129 -268 200 H ATOM 1618 H BVAL A 92 8.634 45.359 26.384 0.05 14.87 H ANISOU 1618 H BVAL A 92 2417 1385 1850 -129 -267 200 H ATOM 1619 HA AVAL A 92 11.086 44.215 26.762 0.05 14.38 H ANISOU 1619 HA AVAL A 92 2357 1323 1785 -191 -125 119 H ATOM 1620 HA BVAL A 92 11.088 44.221 26.736 0.05 14.39 H ANISOU 1620 HA BVAL A 92 2358 1324 1784 -191 -124 118 H ATOM 1621 HB AVAL A 92 8.947 44.216 28.590 0.05 13.63 H ANISOU 1621 HB AVAL A 92 2180 1181 1818 -112 -202 122 H ATOM 1622 HB BVAL A 92 8.974 44.280 28.598 0.05 13.61 H ANISOU 1622 HB BVAL A 92 2177 1176 1817 -112 -199 121 H ATOM 1623 HG11AVAL A 92 11.452 42.995 28.752 0.05 13.42 H ANISOU 1623 HG11AVAL A 92 2157 1166 1776 -163 -89 37 H ATOM 1624 HG11BVAL A 92 10.571 43.346 30.091 0.05 12.81 H ANISOU 1624 HG11BVAL A 92 2039 1044 1783 -118 -114 53 H ATOM 1625 HG12AVAL A 92 10.683 43.383 30.079 0.05 12.87 H ANISOU 1625 HG12AVAL A 92 2065 1050 1777 -129 -94 67 H ATOM 1626 HG12BVAL A 92 10.077 42.351 28.966 0.05 13.36 H ANISOU 1626 HG12BVAL A 92 2126 1160 1789 -150 -124 23 H ATOM 1627 HG13AVAL A 92 10.039 42.347 29.075 0.05 13.06 H ANISOU 1627 HG13AVAL A 92 2074 1099 1790 -129 -130 40 H ATOM 1628 HG13BVAL A 92 11.489 43.070 28.833 0.05 13.22 H ANISOU 1628 HG13BVAL A 92 2124 1124 1774 -156 -76 42 H ATOM 1629 HG21AVAL A 92 10.223 45.632 29.921 0.05 13.09 H ANISOU 1629 HG21AVAL A 92 2123 1043 1806 -106 -139 151 H ATOM 1630 HG21BVAL A 92 10.268 45.700 29.909 0.05 12.99 H ANISOU 1630 HG21BVAL A 92 2104 1034 1797 -112 -125 136 H ATOM 1631 HG22AVAL A 92 11.349 45.676 28.804 0.05 13.71 H ANISOU 1631 HG22AVAL A 92 2252 1152 1806 -149 -122 172 H ATOM 1632 HG22BVAL A 92 11.412 45.693 28.810 0.05 13.65 H ANISOU 1632 HG22BVAL A 92 2239 1145 1802 -151 -114 163 H ATOM 1633 HG23AVAL A 92 9.921 46.312 28.523 0.05 13.77 H ANISOU 1633 HG23AVAL A 92 2249 1146 1838 -104 -191 203 H ATOM 1634 HG23BVAL A 92 10.007 46.359 28.493 0.05 13.60 H ANISOU 1634 HG23BVAL A 92 2218 1118 1830 -104 -178 191 H ATOM 1635 N ILE A 93 10.450 41.993 25.997 0.05 14.65 N ANISOU 1635 N ILE A 93 2368 1412 1785 -219 -121 8 N ATOM 1636 CA ILE A 93 10.087 40.718 25.361 0.05 14.98 C ANISOU 1636 CA ILE A 93 2406 1484 1802 -243 -119 -63 C ATOM 1637 C ILE A 93 10.509 39.599 26.252 0.05 14.47 C ANISOU 1637 C ILE A 93 2303 1377 1819 -232 -72 -117 C ATOM 1638 O ILE A 93 11.687 39.374 26.501 0.05 14.26 O ANISOU 1638 O ILE A 93 2273 1328 1819 -227 -13 -131 O ATOM 1639 CB ILE A 93 10.799 40.581 23.996 0.05 15.74 C ANISOU 1639 CB ILE A 93 2554 1630 1798 -286 -85 -88 C ATOM 1640 CG1 ILE A 93 10.390 41.699 23.043 0.05 16.41 C ANISOU 1640 CG1 ILE A 93 2690 1758 1788 -298 -135 -21 C ATOM 1641 CG2 ILE A 93 10.466 39.196 23.376 0.05 16.20 C ANISOU 1641 CG2 ILE A 93 2610 1713 1830 -314 -81 -177 C ATOM 1642 CD1 ILE A 93 11.373 41.900 21.888 0.05 17.12 C ANISOU 1642 CD1 ILE A 93 2839 1887 1778 -341 -79 -20 C ATOM 1643 H AILE A 93 11.291 42.071 26.097 0.05 14.59 H ANISOU 1643 H AILE A 93 2370 1398 1777 -227 -81 9 H ATOM 1644 H BILE A 93 11.291 42.072 26.094 0.05 14.57 H ANISOU 1644 H BILE A 93 2366 1394 1777 -226 -80 8 H ATOM 1645 HA ILE A 93 9.131 40.665 25.230 0.05 15.16 H ANISOU 1645 HA ILE A 93 2418 1522 1819 -241 -169 -62 H ATOM 1646 HB ILE A 93 11.756 40.615 24.137 0.05 15.62 H ANISOU 1646 HB ILE A 93 2539 1602 1794 -290 -30 -95 H ATOM 1647 HG12 ILE A 93 9.521 41.500 22.666 0.05 16.76 H ANISOU 1647 HG12 ILE A 93 2736 1832 1802 -301 -187 -31 H ATOM 1648 HG13 ILE A 93 10.350 42.525 23.547 0.05 16.13 H ANISOU 1648 HG13 ILE A 93 2650 1695 1785 -274 -152 33 H ATOM 1649 HG21 ILE A 93 10.767 39.173 22.456 0.05 16.77 H ANISOU 1649 HG21 ILE A 93 2719 1824 1829 -342 -63 -195 H ATOM 1650 HG22 ILE A 93 10.913 38.502 23.882 0.05 15.88 H ANISOU 1650 HG22 ILE A 93 2546 1640 1848 -307 -41 -216 H ATOM 1651 HG23 ILE A 93 9.506 39.079 23.412 0.05 16.29 H ANISOU 1651 HG23 ILE A 93 2609 1736 1845 -312 -136 -176 H ATOM 1652 HD11 ILE A 93 11.349 41.118 21.311 0.05 17.41 H ANISOU 1652 HD11 ILE A 93 2879 1948 1787 -362 -53 -82 H ATOM 1653 HD12 ILE A 93 11.109 42.688 21.398 0.05 17.63 H ANISOU 1653 HD12 ILE A 93 2944 1979 1777 -348 -116 27 H ATOM 1654 HD13 ILE A 93 12.266 42.010 22.242 0.05 16.84 H ANISOU 1654 HD13 ILE A 93 2797 1826 1776 -340 -29 -7 H ATOM 1655 N ASN A 94 9.518 38.844 26.728 0.05 14.38 N ANISOU 1655 N ASN A 94 2260 1351 1851 -228 -100 -146 N ATOM 1656 CA ASN A 94 9.804 37.661 27.539 0.05 14.08 C ANISOU 1656 CA ASN A 94 2199 1265 1887 -221 -57 -192 C ATOM 1657 C ASN A 94 9.445 36.390 26.798 0.05 14.66 C ANISOU 1657 C ASN A 94 2281 1345 1945 -257 -48 -270 C ATOM 1658 O ASN A 94 8.300 35.962 26.797 0.05 14.90 O ANISOU 1658 O ASN A 94 2293 1382 1986 -276 -88 -290 O ATOM 1659 CB ASN A 94 9.046 37.696 28.862 0.05 13.57 C ANISOU 1659 CB ASN A 94 2096 1162 1897 -194 -76 -164 C ATOM 1660 CG ASN A 94 9.366 36.509 29.746 0.05 13.36 C ANISOU 1660 CG ASN A 94 2058 1080 1940 -185 -32 -194 C ATOM 1661 OD1 ASN A 94 10.295 35.758 29.489 0.05 13.53 O ANISOU 1661 OD1 ASN A 94 2093 1081 1967 -186 12 -233 O ATOM 1662 ND2 ASN A 94 8.643 36.383 30.812 0.05 13.10 N ANISOU 1662 ND2 ASN A 94 1999 1018 1959 -172 -42 -174 N ATOM 1663 H ASN A 94 8.687 38.999 26.605 0.05 14.53 H ANISOU 1663 H ASN A 94 2272 1387 1863 -230 -142 -137 H ATOM 1664 HA ASN A 94 10.747 37.617 27.740 0.05 13.93 H ANISOU 1664 HA ASN A 94 2183 1229 1880 -211 -17 -194 H ATOM 1665 HB2 ASN A 94 9.283 38.493 29.352 0.05 13.25 H ANISOU 1665 HB2 ASN A 94 2053 1115 1865 -171 -80 -122 H ATOM 1666 HB3 ASN A 94 8.095 37.701 28.696 0.05 13.76 H ANISOU 1666 HB3 ASN A 94 2108 1203 1918 -204 -112 -165 H ATOM 1667 HD21 ASN A 94 8.950 35.917 31.457 0.05 12.95 H ANISOU 1667 HD21 ASN A 94 1979 965 1975 -159 -18 -175 H ATOM 1668 HD22 ASN A 94 7.886 36.771 30.873 0.05 13.12 H ANISOU 1668 HD22 ASN A 94 1987 1037 1959 -174 -70 -160 H ATOM 1669 N ASN A 95 10.439 35.806 26.154 0.05 14.98 N ANISOU 1669 N ASN A 95 2344 1384 1965 -268 8 -319 N ATOM 1670 CA ASN A 95 10.174 34.623 25.365 0.05 15.66 C ANISOU 1670 CA ASN A 95 2446 1468 2036 -303 28 -407 C ATOM 1671 C ASN A 95 10.092 33.364 26.181 0.05 15.57 C ANISOU 1671 C ASN A 95 2419 1377 2121 -290 65 -448 C ATOM 1672 O ASN A 95 9.599 32.363 25.639 0.05 16.21 O ANISOU 1672 O ASN A 95 2516 1437 2205 -317 91 -529 O ATOM 1673 CB ASN A 95 11.230 34.400 24.265 0.05 16.25 C ANISOU 1673 CB ASN A 95 2556 1575 2042 -319 82 -453 C ATOM 1674 CG ASN A 95 11.161 35.419 23.136 0.05 16.77 C ANISOU 1674 CG ASN A 95 2661 1725 1987 -352 49 -431 C ATOM 1675 OD1 ASN A 95 12.202 35.875 22.638 0.05 17.06 O ANISOU 1675 OD1 ASN A 95 2723 1793 1966 -359 96 -426 O ATOM 1676 ND2 ASN A 95 9.978 35.788 22.754 0.05 16.99 N ANISOU 1676 ND2 ASN A 95 2690 1789 1976 -370 -28 -413 N ATOM 1677 H ASN A 95 11.253 36.065 26.154 0.05 14.88 H ANISOU 1677 H ASN A 95 2336 1370 1948 -257 37 -307 H ATOM 1678 HA ASN A 95 9.316 34.723 24.932 0.05 15.96 H ANISOU 1678 HA ASN A 95 2486 1535 2044 -328 -16 -416 H ATOM 1679 HB2 ASN A 95 12.118 34.423 24.654 0.05 15.98 H ANISOU 1679 HB2 ASN A 95 2513 1523 2036 -294 120 -437 H ATOM 1680 HB3 ASN A 95 11.067 33.528 23.869 0.05 16.69 H ANISOU 1680 HB3 ASN A 95 2621 1617 2103 -336 104 -519 H ATOM 1681 HD21 ASN A 95 9.890 36.454 22.219 0.05 17.17 H ANISOU 1681 HD21 ASN A 95 2731 1852 1942 -376 -58 -376 H ATOM 1682 HD22 ASN A 95 9.287 35.365 23.029 0.05 17.01 H ANISOU 1682 HD22 ASN A 95 2674 1775 2012 -377 -50 -438 H ATOM 1683 N AASN A 96 10.620 33.290 27.414 0.03 14.93 N ANISOU 1683 N AASN A 96 2312 1245 2115 -250 72 -399 N ATOM 1684 N BASN A 96 10.434 33.452 27.465 0.02 14.91 N ANISOU 1684 N BASN A 96 2308 1246 2110 -252 65 -395 N ATOM 1685 CA AASN A 96 10.508 32.018 28.114 0.03 15.01 C ANISOU 1685 CA AASN A 96 2318 1175 2208 -238 104 -428 C ATOM 1686 CA BASN A 96 10.644 32.323 28.358 0.02 14.86 C ANISOU 1686 CA BASN A 96 2296 1159 2190 -229 102 -411 C ATOM 1687 C AASN A 96 9.394 31.823 29.098 0.03 14.82 C ANISOU 1687 C AASN A 96 2277 1117 2238 -247 79 -402 C ATOM 1688 C BASN A 96 9.412 31.882 29.153 0.02 14.80 C ANISOU 1688 C BASN A 96 2273 1114 2235 -245 79 -399 C ATOM 1689 O AASN A 96 8.443 32.554 29.131 0.03 14.70 O ANISOU 1689 O AASN A 96 2241 1142 2201 -266 33 -375 O ATOM 1690 O BASN A 96 8.377 32.523 29.113 0.02 14.71 O ANISOU 1690 O BASN A 96 2242 1144 2203 -267 32 -376 O ATOM 1691 CB AASN A 96 11.803 31.320 28.620 0.03 14.85 C ANISOU 1691 CB AASN A 96 2296 1110 2238 -185 154 -421 C ATOM 1692 CB BASN A 96 11.809 32.638 29.303 0.02 14.35 C ANISOU 1692 CB BASN A 96 2218 1072 2163 -174 127 -363 C ATOM 1693 CG AASN A 96 12.974 31.553 27.727 0.03 15.44 C ANISOU 1693 CG AASN A 96 2384 1203 2279 -188 202 -486 C ATOM 1694 CG BASN A 96 13.141 32.592 28.594 0.02 14.68 C ANISOU 1694 CG BASN A 96 2265 1131 2181 -162 172 -400 C ATOM 1695 OD1AASN A 96 13.306 30.703 26.842 0.03 16.08 O ANISOU 1695 OD1AASN A 96 2480 1235 2394 -188 244 -558 O ATOM 1696 OD1BASN A 96 13.197 32.657 27.371 0.02 15.20 O ANISOU 1696 OD1BASN A 96 2351 1240 2185 -196 186 -449 O ATOM 1697 ND2AASN A 96 13.653 32.667 27.971 0.03 15.35 N ANISOU 1697 ND2AASN A 96 2372 1259 2201 -194 203 -465 N ATOM 1698 ND2BASN A 96 14.209 32.396 29.344 0.02 14.50 N ANISOU 1698 ND2BASN A 96 2221 1080 2209 -114 198 -381 N ATOM 1699 H AASN A 96 11.014 33.918 27.846 0.03 14.51 H ANISOU 1699 H AASN A 96 2249 1200 2066 -230 58 -350 H ATOM 1700 H BASN A 96 10.547 34.209 27.869 0.02 14.53 H ANISOU 1700 H BASN A 96 2249 1212 2060 -238 42 -346 H ATOM 1701 HA AASN A 96 10.306 31.439 27.415 0.03 15.54 H ANISOU 1701 HA AASN A 96 2401 1234 2269 -263 119 -487 H ATOM 1702 HA BASN A 96 10.912 31.559 27.818 0.02 15.33 H ANISOU 1702 HA BASN A 96 2371 1201 2252 -240 131 -468 H ATOM 1703 HB2AASN A 96 12.013 31.615 29.517 0.03 14.40 H ANISOU 1703 HB2AASN A 96 2225 1071 2176 -163 142 -371 H ATOM 1704 HB2BASN A 96 11.685 33.515 29.695 0.02 13.95 H ANISOU 1704 HB2BASN A 96 2157 1047 2096 -166 101 -315 H ATOM 1705 HB3AASN A 96 11.647 30.367 28.621 0.03 14.92 H ANISOU 1705 HB3AASN A 96 2305 1062 2303 -171 168 -425 H ATOM 1706 HB3BASN A 96 11.842 31.987 30.016 0.02 14.29 H ANISOU 1706 HB3BASN A 96 2208 1013 2210 -153 139 -357 H ATOM 1707 HD21AASN A 96 14.304 32.908 27.464 0.03 15.61 H ANISOU 1707 HD21AASN A 96 2405 1304 2223 -189 237 -490 H ATOM 1708 HD21BASN A 96 14.122 32.143 30.165 0.02 14.49 H ANISOU 1708 HD21BASN A 96 2216 1032 2257 -90 203 -377 H ATOM 1709 HD22AASN A 96 13.431 33.149 28.645 0.03 15.07 H ANISOU 1709 HD22AASN A 96 2336 1254 2137 -204 170 -425 H ATOM 1710 HD22BASN A 96 14.992 32.498 29.005 0.02 14.45 H ANISOU 1710 HD22BASN A 96 2204 1101 2186 -106 209 -371 H ATOM 1711 N GLN A 97 9.561 30.778 29.881 0.05 14.96 N ANISOU 1711 N GLN A 97 2302 1054 2328 -233 115 -414 N ATOM 1712 CA GLN A 97 8.479 30.129 30.583 0.05 15.11 C ANISOU 1712 CA GLN A 97 2315 1023 2402 -258 113 -408 C ATOM 1713 C GLN A 97 8.214 30.636 31.984 0.05 14.53 C ANISOU 1713 C GLN A 97 2221 944 2355 -233 101 -329 C ATOM 1714 O GLN A 97 7.319 30.150 32.649 0.05 14.71 O ANISOU 1714 O GLN A 97 2233 941 2415 -263 102 -320 O ATOM 1715 CB GLN A 97 8.851 28.627 30.692 0.05 15.66 C ANISOU 1715 CB GLN A 97 2417 994 2539 -249 165 -448 C ATOM 1716 CG GLN A 97 9.035 27.931 29.397 0.05 16.53 C ANISOU 1716 CG GLN A 97 2549 1084 2648 -301 181 -546 C ATOM 1717 CD GLN A 97 7.725 27.678 28.759 0.05 16.84 C ANISOU 1717 CD GLN A 97 2569 1135 2693 -370 152 -563 C ATOM 1718 OE1 GLN A 97 6.910 26.842 29.210 0.05 16.69 O ANISOU 1718 OE1 GLN A 97 2539 1079 2725 -376 155 -515 O ATOM 1719 NE2 GLN A 97 7.478 28.411 27.725 0.05 17.28 N ANISOU 1719 NE2 GLN A 97 2619 1258 2690 -421 119 -626 N ATOM 1720 H AGLN A 97 10.313 30.432 30.087 0.05 15.03 H ANISOU 1720 H AGLN A 97 2320 1032 2358 -208 144 -422 H ATOM 1721 H BGLN A 97 10.315 30.394 30.009 0.05 15.04 H ANISOU 1721 H BGLN A 97 2322 1034 2358 -209 144 -424 H ATOM 1722 HA GLN A 97 7.666 30.242 30.073 0.05 15.39 H ANISOU 1722 HA GLN A 97 2341 1087 2418 -300 90 -436 H ATOM 1723 HB2 GLN A 97 9.683 28.543 31.186 0.05 15.54 H ANISOU 1723 HB2 GLN A 97 2408 968 2529 -206 183 -439 H ATOM 1724 HB3 GLN A 97 8.143 28.169 31.170 0.05 15.66 H ANISOU 1724 HB3 GLN A 97 2418 947 2583 -249 173 -418 H ATOM 1725 HG2 GLN A 97 9.553 28.500 28.809 0.05 16.61 H ANISOU 1725 HG2 GLN A 97 2560 1146 2604 -306 175 -577 H ATOM 1726 HG3 GLN A 97 9.488 27.084 29.535 0.05 16.90 H ANISOU 1726 HG3 GLN A 97 2617 1060 2743 -287 216 -568 H ATOM 1727 HE21 GLN A 97 8.089 28.932 27.418 0.05 17.55 H ANISOU 1727 HE21 GLN A 97 2671 1306 2692 -422 128 -669 H ATOM 1728 HE22 GLN A 97 6.708 28.365 27.343 0.05 17.35 H ANISOU 1728 HE22 GLN A 97 2604 1299 2691 -453 88 -625 H ATOM 1729 N GLU A 98 9.046 31.569 32.400 0.05 13.95 N ANISOU 1729 N GLU A 98 2143 898 2261 -185 93 -279 N ATOM 1730 CA GLU A 98 9.060 32.128 33.755 0.05 13.44 C ANISOU 1730 CA GLU A 98 2068 825 2212 -149 88 -209 C ATOM 1731 C GLU A 98 8.809 33.633 33.720 0.05 12.97 C ANISOU 1731 C GLU A 98 1986 835 2109 -142 49 -175 C ATOM 1732 O GLU A 98 9.296 34.318 32.805 0.05 12.94 O ANISOU 1732 O GLU A 98 1983 874 2058 -142 35 -186 O ATOM 1733 CB GLU A 98 10.447 31.928 34.339 0.05 13.30 C ANISOU 1733 CB GLU A 98 2064 775 2213 -94 108 -187 C ATOM 1734 CG GLU A 98 10.951 30.448 34.313 0.05 13.90 C ANISOU 1734 CG GLU A 98 2168 768 2344 -85 146 -217 C ATOM 1735 CD GLU A 98 11.585 29.940 32.949 0.05 14.29 C ANISOU 1735 CD GLU A 98 2221 815 2392 -74 169 -280 C ATOM 1736 OE1 GLU A 98 12.048 30.732 32.078 0.05 14.11 O ANISOU 1736 OE1 GLU A 98 2183 855 2322 -75 163 -295 O ATOM 1737 OE2 GLU A 98 11.636 28.705 32.778 0.05 14.90 O ANISOU 1737 OE2 GLU A 98 2322 822 2518 -68 201 -319 O ATOM 1738 H GLU A 98 9.654 31.901 31.898 0.05 13.90 H ANISOU 1738 H GLU A 98 2140 915 2227 -174 94 -288 H ATOM 1739 HA GLU A 98 8.395 31.714 34.325 0.05 13.56 H ANISOU 1739 HA GLU A 98 2082 813 2256 -163 95 -198 H ATOM 1740 HB2 GLU A 98 11.072 32.475 33.837 0.05 13.19 H ANISOU 1740 HB2 GLU A 98 2045 794 2174 -85 104 -197 H ATOM 1741 HB3 GLU A 98 10.438 32.221 35.259 0.05 13.03 H ANISOU 1741 HB3 GLU A 98 2028 739 2185 -73 101 -144 H ATOM 1742 HG2 GLU A 98 11.619 30.357 35.011 0.05 13.86 H ANISOU 1742 HG2 GLU A 98 2171 732 2363 -50 150 -181 H ATOM 1743 HG3 GLU A 98 10.184 29.891 34.517 0.05 14.18 H ANISOU 1743 HG3 GLU A 98 2210 781 2395 -120 152 -234 H ATOM 1744 N ASP A 99 8.077 34.127 34.703 0.05 12.74 N ANISOU 1744 N ASP A 99 1939 808 2092 -135 40 -134 N ATOM 1745 CA ASP A 99 7.836 35.574 34.854 0.05 12.37 C ANISOU 1745 CA ASP A 99 1873 809 2016 -117 8 -100 C ATOM 1746 C ASP A 99 9.143 36.315 34.791 0.05 12.05 C ANISOU 1746 C ASP A 99 1848 779 1952 -85 6 -83 C ATOM 1747 O ASP A 99 10.134 35.965 35.346 0.05 11.97 O ANISOU 1747 O ASP A 99 1850 741 1957 -61 27 -77 O ATOM 1748 CB ASP A 99 7.254 35.805 36.247 0.05 12.21 C ANISOU 1748 CB ASP A 99 1843 776 2021 -101 18 -63 C ATOM 1749 CG ASP A 99 5.822 35.384 36.437 0.05 12.57 C ANISOU 1749 CG ASP A 99 1859 824 2095 -136 24 -75 C ATOM 1750 OD1 ASP A 99 5.009 35.411 35.510 0.05 12.88 O ANISOU 1750 OD1 ASP A 99 1868 895 2130 -166 -2 -104 O ATOM 1751 OD2 ASP A 99 5.493 35.069 37.627 0.05 12.64 O ANISOU 1751 OD2 ASP A 99 1870 805 2126 -134 57 -51 O ATOM 1752 H ASP A 99 7.693 33.663 35.299 0.05 12.84 H ANISOU 1752 H ASP A 99 1953 794 2131 -140 54 -126 H ATOM 1753 HA ASP A 99 7.227 35.897 34.180 0.05 12.51 H ANISOU 1753 HA ASP A 99 1878 859 2018 -135 -16 -112 H ATOM 1754 HB2 ASP A 99 7.811 35.372 36.908 0.05 12.17 H ANISOU 1754 HB2 ASP A 99 1855 739 2027 -86 38 -50 H ATOM 1755 HB3 ASP A 99 7.267 36.777 36.386 0.05 11.99 H ANISOU 1755 HB3 ASP A 99 1806 771 1977 -83 0 -45 H ATOM 1756 N PHE A 100 9.061 37.479 34.139 0.05 11.97 N ANISOU 1756 N PHE A 100 1833 810 1904 -86 -23 -72 N ATOM 1757 CA PHE A 100 10.156 38.452 34.126 0.05 11.74 C ANISOU 1757 CA PHE A 100 1813 791 1855 -67 -24 -50 C ATOM 1758 C PHE A 100 9.749 39.665 34.969 0.05 11.48 C ANISOU 1758 C PHE A 100 1773 761 1827 -45 -45 -12 C ATOM 1759 O PHE A 100 8.754 40.315 34.689 0.05 11.58 O ANISOU 1759 O PHE A 100 1776 793 1832 -47 -73 -1 O ATOM 1760 CB PHE A 100 10.466 38.899 32.701 0.05 12.00 C ANISOU 1760 CB PHE A 100 1860 860 1838 -90 -32 -61 C ATOM 1761 CG PHE A 100 11.558 39.948 32.639 0.05 11.88 C ANISOU 1761 CG PHE A 100 1855 854 1807 -82 -25 -37 C ATOM 1762 CD1 PHE A 100 12.854 39.602 32.915 0.05 11.85 C ANISOU 1762 CD1 PHE A 100 1845 838 1821 -73 8 -51 C ATOM 1763 CD2 PHE A 100 11.269 41.299 32.368 0.05 11.91 C ANISOU 1763 CD2 PHE A 100 1870 871 1785 -84 -53 1 C ATOM 1764 CE1 PHE A 100 13.871 40.523 32.885 0.05 11.85 C ANISOU 1764 CE1 PHE A 100 1842 847 1813 -75 17 -36 C ATOM 1765 CE2 PHE A 100 12.302 42.230 32.328 0.05 11.91 C ANISOU 1765 CE2 PHE A 100 1881 869 1776 -88 -40 21 C ATOM 1766 CZ PHE A 100 13.565 41.837 32.582 0.05 11.88 C ANISOU 1766 CZ PHE A 100 1863 861 1790 -88 -4 0 C ATOM 1767 H PHE A 100 8.369 37.716 33.704 0.05 12.10 H ANISOU 1767 H PHE A 100 1841 848 1910 -99 -43 -75 H ATOM 1768 HA PHE A 100 10.952 38.064 34.516 0.05 11.67 H ANISOU 1768 HA PHE A 100 1809 765 1862 -54 -4 -54 H ATOM 1769 HB2 PHE A 100 10.791 38.135 32.206 0.05 12.21 H ANISOU 1769 HB2 PHE A 100 1893 885 1860 -103 -14 -92 H ATOM 1770 HB3 PHE A 100 9.665 39.254 32.294 0.05 12.13 H ANISOU 1770 HB3 PHE A 100 1875 896 1837 -99 -59 -54 H ATOM 1771 HD1 PHE A 100 13.067 38.716 33.102 0.05 11.91 H ANISOU 1771 HD1 PHE A 100 1846 829 1849 -65 24 -73 H ATOM 1772 HD2 PHE A 100 10.397 41.557 32.184 0.05 12.00 H ANISOU 1772 HD2 PHE A 100 1881 891 1788 -83 -80 11 H ATOM 1773 HE1 PHE A 100 14.741 40.255 33.055 0.05 11.91 H ANISOU 1773 HE1 PHE A 100 1835 852 1837 -69 38 -49 H ATOM 1774 HE2 PHE A 100 12.103 43.117 32.141 0.05 12.00 H ANISOU 1774 HE2 PHE A 100 1905 880 1774 -90 -56 48 H ATOM 1775 HZ PHE A 100 14.251 42.467 32.568 0.05 11.94 H ANISOU 1775 HZ PHE A 100 1871 869 1796 -96 6 10 H ATOM 1776 N HIS A 101 10.539 39.906 35.997 0.05 11.25 N ANISOU 1776 N HIS A 101 1746 714 1812 -22 -33 2 N ATOM 1777 CA HIS A 101 10.264 41.026 36.923 0.05 11.08 C ANISOU 1777 CA HIS A 101 1724 691 1796 -2 -47 27 C ATOM 1778 C HIS A 101 11.308 42.128 36.777 0.05 11.03 C ANISOU 1778 C HIS A 101 1727 687 1777 -1 -54 37 C ATOM 1779 O HIS A 101 12.502 41.866 36.701 0.05 11.04 O ANISOU 1779 O HIS A 101 1727 690 1779 -4 -41 27 O ATOM 1780 CB HIS A 101 10.369 40.580 38.375 0.05 11.00 C ANISOU 1780 CB HIS A 101 1715 661 1801 18 -33 33 C ATOM 1781 CG HIS A 101 9.399 39.520 38.797 0.05 11.14 C ANISOU 1781 CG HIS A 101 1730 668 1835 12 -14 30 C ATOM 1782 ND1 HIS A 101 8.421 39.758 39.724 0.05 11.21 N ANISOU 1782 ND1 HIS A 101 1732 678 1851 18 -5 39 N ATOM 1783 CD2 HIS A 101 9.318 38.185 38.496 0.05 11.33 C ANISOU 1783 CD2 HIS A 101 1757 673 1875 -4 4 17 C ATOM 1784 CE1 HIS A 101 7.740 38.653 39.959 0.05 11.44 C ANISOU 1784 CE1 HIS A 101 1758 693 1896 0 20 37 C ATOM 1785 NE2 HIS A 101 8.275 37.691 39.220 0.05 11.51 N ANISOU 1785 NE2 HIS A 101 1776 685 1913 -14 24 24 N ATOM 1786 H HIS A 101 11.262 39.514 36.168 0.05 11.24 H ANISOU 1786 H HIS A 101 1748 704 1817 -16 -21 -4 H ATOM 1787 HA HIS A 101 9.378 41.369 36.758 0.05 11.15 H ANISOU 1787 HA HIS A 101 1726 707 1805 -3 -60 31 H ATOM 1788 HB2 HIS A 101 11.268 40.268 38.540 0.05 10.98 H ANISOU 1788 HB2 HIS A 101 1718 654 1800 25 -28 31 H ATOM 1789 HB3 HIS A 101 10.176 41.332 38.956 0.05 10.95 H ANISOU 1789 HB3 HIS A 101 1710 656 1793 30 -39 41 H ATOM 1790 HD2 HIS A 101 9.862 37.720 37.906 0.05 11.39 H ANISOU 1790 HD2 HIS A 101 1769 674 1883 -9 8 4 H ATOM 1791 HE1 HIS A 101 7.012 38.576 40.530 0.05 11.59 H ANISOU 1791 HE1 HIS A 101 1769 713 1922 -4 37 41 H ATOM 1792 N PHE A 102 10.834 43.390 36.818 0.05 11.07 N ANISOU 1792 N PHE A 102 1738 688 1780 6 -73 55 N ATOM 1793 CA PHE A 102 11.735 44.540 36.847 0.05 11.12 C ANISOU 1793 CA PHE A 102 1758 684 1784 0 -77 65 C ATOM 1794 C PHE A 102 10.991 45.642 37.552 0.05 11.19 C ANISOU 1794 C PHE A 102 1773 670 1807 21 -92 75 C ATOM 1795 O PHE A 102 9.797 45.702 37.601 0.05 11.26 O ANISOU 1795 O PHE A 102 1774 680 1825 40 -102 79 O ATOM 1796 CB PHE A 102 12.221 44.934 35.447 0.05 11.37 C ANISOU 1796 CB PHE A 102 1805 726 1788 -29 -76 77 C ATOM 1797 CG PHE A 102 11.160 45.458 34.538 0.05 11.63 C ANISOU 1797 CG PHE A 102 1853 763 1802 -28 -103 102 C ATOM 1798 CD1 PHE A 102 10.319 44.642 33.815 0.05 11.74 C ANISOU 1798 CD1 PHE A 102 1859 804 1798 -31 -115 94 C ATOM 1799 CD2 PHE A 102 11.068 46.847 34.312 0.05 11.91 C ANISOU 1799 CD2 PHE A 102 1914 773 1837 -24 -120 135 C ATOM 1800 CE1 PHE A 102 9.383 45.154 32.968 0.05 12.11 C ANISOU 1800 CE1 PHE A 102 1915 863 1823 -27 -152 118 C ATOM 1801 CE2 PHE A 102 10.134 47.351 33.466 0.05 12.28 C ANISOU 1801 CE2 PHE A 102 1976 822 1867 -14 -154 166 C ATOM 1802 CZ PHE A 102 9.289 46.525 32.787 0.05 12.39 C ANISOU 1802 CZ PHE A 102 1975 874 1859 -13 -174 159 C ATOM 1803 H PHE A 102 10.012 43.606 36.871 0.05 11.12 H ANISOU 1803 H PHE A 102 1740 695 1791 13 -83 60 H ATOM 1804 HA PHE A 102 12.507 44.315 37.381 0.05 11.05 H ANISOU 1804 HA PHE A 102 1744 675 1781 0 -68 55 H ATOM 1805 HB2 PHE A 102 12.880 45.631 35.574 0.05 11.45 H ANISOU 1805 HB2 PHE A 102 1822 725 1802 -38 -72 83 H ATOM 1806 HB3 PHE A 102 12.658 44.194 35.009 0.05 11.39 H ANISOU 1806 HB3 PHE A 102 1802 744 1781 -41 -61 63 H ATOM 1807 HD1 PHE A 102 10.377 43.723 33.946 0.05 11.62 H ANISOU 1807 HD1 PHE A 102 1831 797 1787 -36 -101 71 H ATOM 1808 HD2 PHE A 102 11.631 47.403 34.781 0.05 11.89 H ANISOU 1808 HD2 PHE A 102 1918 750 1850 -28 -111 135 H ATOM 1809 HE1 PHE A 102 8.806 44.595 32.502 0.05 12.25 H ANISOU 1809 HE1 PHE A 102 1922 903 1828 -32 -165 108 H ATOM 1810 HE2 PHE A 102 10.069 48.270 33.358 0.05 12.53 H ANISOU 1810 HE2 PHE A 102 2028 828 1904 -6 -166 191 H ATOM 1811 HZ PHE A 102 8.650 46.888 32.214 0.05 12.72 H ANISOU 1811 HZ PHE A 102 2024 922 1888 -4 -205 180 H ATOM 1812 N TYR A 103 11.800 46.562 38.100 0.05 11.25 N ANISOU 1812 N TYR A 103 1794 660 1823 17 -92 72 N ATOM 1813 CA TYR A 103 11.299 47.808 38.671 0.05 11.46 C ANISOU 1813 CA TYR A 103 1834 652 1866 34 -103 73 C ATOM 1814 C TYR A 103 11.678 48.952 37.740 0.05 11.79 C ANISOU 1814 C TYR A 103 1903 665 1910 14 -111 99 C ATOM 1815 O TYR A 103 12.773 49.017 37.242 0.05 11.86 O ANISOU 1815 O TYR A 103 1919 680 1909 -22 -100 103 O ATOM 1816 CB TYR A 103 11.856 48.007 40.082 0.05 11.44 C ANISOU 1816 CB TYR A 103 1834 645 1869 40 -97 44 C ATOM 1817 CG TYR A 103 10.888 48.815 40.967 0.05 11.66 C ANISOU 1817 CG TYR A 103 1871 648 1913 70 -97 30 C ATOM 1818 CD1 TYR A 103 9.938 48.234 41.735 0.05 11.63 C ANISOU 1818 CD1 TYR A 103 1853 660 1905 96 -83 19 C ATOM 1819 CD2 TYR A 103 10.877 50.219 40.930 0.05 12.03 C ANISOU 1819 CD2 TYR A 103 1943 647 1983 72 -104 27 C ATOM 1820 CE1 TYR A 103 8.994 48.940 42.467 0.05 11.94 C ANISOU 1820 CE1 TYR A 103 1894 681 1961 126 -72 -1 C ATOM 1821 CE2 TYR A 103 9.963 50.923 41.657 0.05 12.34 C ANISOU 1821 CE2 TYR A 103 1988 659 2043 107 -98 6 C ATOM 1822 CZ TYR A 103 9.010 50.302 42.379 0.05 12.29 C ANISOU 1822 CZ TYR A 103 1960 680 2031 136 -81 -9 C ATOM 1823 OH TYR A 103 8.101 51.053 43.069 0.05 12.71 O ANISOU 1823 OH TYR A 103 2013 708 2108 172 -67 -36 O ATOM 1824 H TYR A 103 12.639 46.498 38.136 0.05 11.25 H ANISOU 1824 H TYR A 103 1791 663 1820 3 -86 65 H ATOM 1825 HA TYR A 103 10.334 47.765 38.709 0.05 11.49 H ANISOU 1825 HA TYR A 103 1832 657 1877 55 -107 77 H ATOM 1826 HB2 TYR A 103 11.995 47.153 40.510 0.05 11.28 H ANISOU 1826 HB2 TYR A 103 1802 646 1839 44 -91 37 H ATOM 1827 HB3 TYR A 103 12.694 48.481 40.013 0.05 11.55 H ANISOU 1827 HB3 TYR A 103 1854 650 1886 20 -99 40 H ATOM 1828 HD1 TYR A 103 9.923 47.299 41.746 0.05 11.45 H ANISOU 1828 HD1 TYR A 103 1819 660 1870 92 -76 24 H ATOM 1829 HD2 TYR A 103 11.500 50.649 40.401 0.05 12.13 H ANISOU 1829 HD2 TYR A 103 1967 645 1999 49 -109 37 H ATOM 1830 HE1 TYR A 103 8.354 48.507 42.979 0.05 11.97 H ANISOU 1830 HE1 TYR A 103 1886 701 1961 140 -55 -9 H ATOM 1831 HE2 TYR A 103 9.969 51.849 41.608 0.05 12.65 H ANISOU 1831 HE2 TYR A 103 2046 658 2102 110 -103 3 H ATOM 1832 HH TYR A 103 7.324 50.870 42.811 0.05 12.77 H ANISOU 1832 HH TYR A 103 2000 721 2131 191 -67 -25 H ATOM 1833 N THR A 104 10.685 49.764 37.445 0.05 12.08 N ANISOU 1833 N THR A 104 1954 674 1961 40 -129 119 N ATOM 1834 CA THR A 104 10.909 50.987 36.641 0.05 12.55 C ANISOU 1834 CA THR A 104 2053 691 2025 26 -139 154 C ATOM 1835 C THR A 104 10.799 52.198 37.570 0.05 12.87 C ANISOU 1835 C THR A 104 2113 671 2107 45 -140 139 C ATOM 1836 O THR A 104 9.934 52.287 38.404 0.05 12.89 O ANISOU 1836 O THR A 104 2100 666 2132 87 -142 116 O ATOM 1837 CB THR A 104 9.918 51.128 35.447 0.05 12.89 C ANISOU 1837 CB THR A 104 2108 737 2053 44 -168 199 C ATOM 1838 OG1 THR A 104 10.132 52.415 34.818 0.05 13.48 O ANISOU 1838 OG1 THR A 104 2233 755 2136 37 -177 241 O ATOM 1839 CG2 THR A 104 8.434 51.038 35.853 0.05 12.97 C ANISOU 1839 CG2 THR A 104 2086 753 2088 100 -193 193 C ATOM 1840 H THR A 104 9.885 49.657 37.695 0.05 12.08 H ANISOU 1840 H THR A 104 1942 678 1971 65 -135 116 H ATOM 1841 HA THR A 104 11.801 50.960 36.296 0.05 12.56 H ANISOU 1841 HA THR A 104 2062 697 2014 -9 -125 157 H ATOM 1842 HB THR A 104 10.103 50.454 34.776 0.05 12.80 H ANISOU 1842 HB THR A 104 2093 761 2009 23 -166 206 H ATOM 1843 HG1 THR A 104 10.716 52.331 34.221 0.05 13.76 H ANISOU 1843 HG1 THR A 104 2276 788 2163 55 -200 270 H ATOM 1844 HG21 THR A 104 7.863 51.043 35.073 0.05 13.24 H ANISOU 1844 HG21 THR A 104 2122 797 2110 111 -219 221 H ATOM 1845 HG22 THR A 104 8.283 50.221 36.357 0.05 12.63 H ANISOU 1845 HG22 THR A 104 2014 742 2044 101 -181 165 H ATOM 1846 HG23 THR A 104 8.205 51.790 36.420 0.05 13.17 H ANISOU 1846 HG23 THR A 104 2117 740 2145 124 -192 186 H ATOM 1847 N AILE A 105 11.742 53.114 37.399 0.03 13.21 N ANISOU 1847 N AILE A 105 2188 671 2160 7 -130 146 N ATOM 1848 N BILE A 105 11.749 53.113 37.397 0.02 13.22 N ANISOU 1848 N BILE A 105 2191 672 2162 8 -131 148 N ATOM 1849 CA AILE A 105 11.694 54.425 38.018 0.03 13.72 C ANISOU 1849 CA AILE A 105 2286 661 2268 14 -130 134 C ATOM 1850 CA BILE A 105 11.753 54.423 38.028 0.02 13.72 C ANISOU 1850 CA BILE A 105 2286 661 2268 14 -131 134 C ATOM 1851 C AILE A 105 11.795 55.458 36.909 0.03 14.38 C ANISOU 1851 C AILE A 105 2421 683 2360 -1 -138 194 C ATOM 1852 C BILE A 105 11.790 55.456 36.907 0.02 14.38 C ANISOU 1852 C BILE A 105 2421 683 2360 0 -138 194 C ATOM 1853 O AILE A 105 12.643 55.399 36.064 0.03 14.49 O ANISOU 1853 O AILE A 105 2451 708 2347 -53 -124 224 O ATOM 1854 O BILE A 105 12.631 55.395 36.043 0.02 14.49 O ANISOU 1854 O BILE A 105 2451 708 2347 -53 -124 224 O ATOM 1855 CB AILE A 105 12.776 54.564 39.048 0.03 13.71 C ANISOU 1855 CB AILE A 105 2278 656 2274 -29 -113 82 C ATOM 1856 CB BILE A 105 12.985 54.619 38.898 0.02 13.72 C ANISOU 1856 CB BILE A 105 2282 657 2276 -32 -113 86 C ATOM 1857 CG1AILE A 105 12.503 53.583 40.204 0.03 13.19 C ANISOU 1857 CG1AILE A 105 2172 652 2188 -9 -112 35 C ATOM 1858 CG1BILE A 105 13.118 53.527 39.965 0.02 13.18 C ANISOU 1858 CG1BILE A 105 2171 654 2185 -20 -111 39 C ATOM 1859 CG2AILE A 105 12.881 56.017 39.514 0.03 14.37 C ANISOU 1859 CG2AILE A 105 2404 654 2405 -34 -111 61 C ATOM 1860 CG2BILE A 105 12.961 56.015 39.513 0.02 14.37 C ANISOU 1860 CG2BILE A 105 2403 653 2404 -32 -111 62 C ATOM 1861 CD1AILE A 105 13.613 53.407 41.056 0.03 13.28 C ANISOU 1861 CD1AILE A 105 2175 673 2199 -42 -110 -17 C ATOM 1862 CD1BILE A 105 12.027 53.489 40.999 0.02 13.22 C ANISOU 1862 CD1BILE A 105 2174 651 2199 26 -111 -2 C ATOM 1863 H AILE A 105 12.425 53.011 36.904 0.05 13.21 H ANISOU 1863 H AILE A 105 2191 683 2144 -27 -121 155 H ATOM 1864 H BILE A 105 12.419 53.004 36.886 0.05 13.25 H ANISOU 1864 H BILE A 105 2199 685 2149 -26 -122 160 H ATOM 1865 HA AILE A 105 10.834 54.520 38.450 0.05 13.76 H ANISOU 1865 HA AILE A 105 2283 655 2289 56 -137 120 H ATOM 1866 HA BILE A 105 10.949 54.528 38.553 0.05 13.75 H ANISOU 1866 HA BILE A 105 2282 655 2289 56 -137 119 H ATOM 1867 HB AILE A 105 13.627 54.341 38.647 0.05 13.71 H ANISOU 1867 HB AILE A 105 2276 671 2262 -71 -104 94 H ATOM 1868 HB BILE A 105 13.763 54.566 38.324 0.05 13.78 H ANISOU 1868 HB BILE A 105 2290 673 2272 -74 -104 101 H ATOM 1869 HG12AILE A 105 11.769 53.888 40.754 0.05 13.20 H ANISOU 1869 HG12AILE A 105 2173 646 2197 29 -114 24 H ATOM 1870 HG12BILE A 105 13.124 52.692 39.490 0.05 12.86 H ANISOU 1870 HG12BILE A 105 2112 652 2124 -11 -112 57 H ATOM 1871 HG13AILE A 105 12.265 52.730 39.812 0.05 12.86 H ANISOU 1871 HG13AILE A 105 2110 653 2124 -13 -111 50 H ATOM 1872 HG13BILE A 105 13.952 53.645 40.435 0.05 13.20 H ANISOU 1872 HG13BILE A 105 2164 669 2184 -53 -107 17 H ATOM 1873 HG21AILE A 105 13.572 56.115 40.176 0.05 14.44 H ANISOU 1873 HG21AILE A 105 2408 664 2417 -68 -104 26 H ATOM 1874 HG21BILE A 105 12.904 56.662 38.799 0.05 14.76 H ANISOU 1874 HG21BILE A 105 2483 658 2466 -44 -112 100 H ATOM 1875 HG22AILE A 105 13.098 56.540 38.737 0.05 14.74 H ANISOU 1875 HG22AILE A 105 2480 659 2462 -46 -111 101 H ATOM 1876 HG22BILE A 105 12.180 56.083 40.075 0.05 14.40 H ANISOU 1876 HG22BILE A 105 2404 646 2419 13 -117 46 H ATOM 1877 HG23AILE A 105 12.021 56.279 39.874 0.05 14.43 H ANISOU 1877 HG23AILE A 105 2411 646 2425 10 -116 45 H ATOM 1878 HG23BILE A 105 13.764 56.162 40.026 0.05 14.44 H ANISOU 1878 HG23BILE A 105 2406 663 2416 -66 -105 26 H ATOM 1879 HD11AILE A 105 14.042 54.266 41.208 0.05 13.63 H ANISOU 1879 HD11AILE A 105 2239 676 2262 -38 -111 -42 H ATOM 1880 HD11BILE A 105 12.041 52.618 41.429 0.05 12.94 H ANISOU 1880 HD11BILE A 105 2118 659 2140 27 -109 -22 H ATOM 1881 HD12AILE A 105 13.312 53.034 41.901 0.05 12.98 H ANISOU 1881 HD12AILE A 105 2115 679 2139 -29 -112 -33 H ATOM 1882 HD12BILE A 105 12.174 54.169 41.668 0.05 13.59 H ANISOU 1882 HD12BILE A 105 2241 658 2265 17 -110 -27 H ATOM 1883 HD13AILE A 105 14.240 52.801 40.630 0.05 13.38 H ANISOU 1883 HD13AILE A 105 2182 688 2213 -83 -106 -11 H ATOM 1884 HD13BILE A 105 11.170 53.611 40.564 0.05 13.23 H ANISOU 1884 HD13BILE A 105 2174 646 2208 61 -114 15 H ATOM 1885 N TRP A 106 10.894 56.445 36.958 0.05 14.94 N ANISOU 1885 N TRP A 106 2521 684 2471 48 -156 212 N ATOM 1886 CA TRP A 106 10.854 57.486 35.938 0.05 15.73 C ANISOU 1886 CA TRP A 106 2682 713 2582 43 -168 280 C ATOM 1887 C TRP A 106 10.810 58.864 36.642 0.05 16.45 C ANISOU 1887 C TRP A 106 2815 693 2741 58 -162 261 C ATOM 1888 O TRP A 106 10.314 59.004 37.744 0.05 16.39 O ANISOU 1888 O TRP A 106 2786 672 2770 99 -159 200 O ATOM 1889 CB TRP A 106 9.664 57.303 34.991 0.05 15.96 C ANISOU 1889 CB TRP A 106 2711 761 2591 99 -211 340 C ATOM 1890 CG TRP A 106 8.340 57.381 35.665 0.05 16.04 C ANISOU 1890 CG TRP A 106 2684 766 2645 184 -237 316 C ATOM 1891 CD1 TRP A 106 7.681 58.516 36.049 0.05 16.87 C ANISOU 1891 CD1 TRP A 106 2813 788 2809 250 -261 338 C ATOM 1892 CD2 TRP A 106 7.485 56.302 36.031 0.05 15.42 C ANISOU 1892 CD2 TRP A 106 2535 763 2562 214 -236 267 C ATOM 1893 NE1 TRP A 106 6.488 58.196 36.634 0.05 16.79 N ANISOU 1893 NE1 TRP A 106 2741 806 2832 319 -272 297 N ATOM 1894 CE2 TRP A 106 6.348 56.833 36.632 0.05 15.91 C ANISOU 1894 CE2 TRP A 106 2573 793 2678 292 -255 256 C ATOM 1895 CE3 TRP A 106 7.563 54.923 35.880 0.05 14.61 C ANISOU 1895 CE3 TRP A 106 2387 747 2416 182 -218 232 C ATOM 1896 CZ2 TRP A 106 5.300 56.043 37.095 0.05 15.60 C ANISOU 1896 CZ2 TRP A 106 2464 814 2651 330 -249 211 C ATOM 1897 CZ3 TRP A 106 6.525 54.145 36.344 0.05 14.32 C ANISOU 1897 CZ3 TRP A 106 2294 757 2391 219 -216 194 C ATOM 1898 CH2 TRP A 106 5.412 54.706 36.942 0.05 14.81 C ANISOU 1898 CH2 TRP A 106 2329 794 2504 288 -229 184 C ATOM 1899 H ATRP A 106 10.299 56.522 37.564 0.05 14.93 H ANISOU 1899 H ATRP A 106 2507 676 2492 86 -161 187 H ATOM 1900 H BTRP A 106 10.301 56.526 37.565 0.05 14.93 H ANISOU 1900 H BTRP A 106 2507 676 2492 86 -160 186 H ATOM 1901 HA TRP A 106 11.661 57.433 35.415 0.05 15.77 H ANISOU 1901 HA TRP A 106 2703 726 2563 -10 -152 299 H ATOM 1902 HB2 TRP A 106 9.698 57.985 34.308 0.05 16.56 H ANISOU 1902 HB2 TRP A 106 2834 789 2668 95 -221 392 H ATOM 1903 HB3 TRP A 106 9.722 56.434 34.565 0.05 15.57 H ANISOU 1903 HB3 TRP A 106 2639 778 2498 82 -213 345 H ATOM 1904 HD1 TRP A 106 8.020 59.375 35.948 0.05 17.46 H ANISOU 1904 HD1 TRP A 106 2938 794 2902 247 -266 373 H ATOM 1905 HE1 TRP A 106 5.916 58.743 36.959 0.05 17.27 H ANISOU 1905 HE1 TRP A 106 2798 829 2934 371 -285 299 H ATOM 1906 HE3 TRP A 106 8.310 54.538 35.483 0.05 14.33 H ANISOU 1906 HE3 TRP A 106 2361 735 2350 136 -204 235 H ATOM 1907 HZ2 TRP A 106 4.549 56.418 37.490 0.05 15.99 H ANISOU 1907 HZ2 TRP A 106 2491 845 2741 382 -257 200 H ATOM 1908 HZ3 TRP A 106 6.578 53.221 36.262 0.05 13.85 H ANISOU 1908 HZ3 TRP A 106 2210 747 2307 198 -203 175 H ATOM 1909 HH2 TRP A 106 4.733 54.148 37.248 0.05 14.65 H ANISOU 1909 HH2 TRP A 106 2266 810 2491 305 -220 156 H ATOM 1910 N TRP A 107 11.329 59.879 35.946 0.05 17.23 N ANISOU 1910 N TRP A 107 2980 710 2855 20 -156 313 N ATOM 1911 CA TRP A 107 11.434 61.232 36.525 0.05 18.05 C ANISOU 1911 CA TRP A 107 3135 693 3031 21 -145 293 C ATOM 1912 C TRP A 107 11.587 62.235 35.391 0.05 19.06 C ANISOU 1912 C TRP A 107 3345 727 3169 -2 -147 385 C ATOM 1913 O TRP A 107 11.996 61.928 34.296 0.05 19.10 O ANISOU 1913 O TRP A 107 3370 770 3118 -42 -146 453 O ATOM 1914 CB TRP A 107 12.585 61.319 37.536 0.05 17.89 C ANISOU 1914 CB TRP A 107 3100 672 3025 -51 -110 211 C ATOM 1915 CG TRP A 107 13.940 61.155 36.949 0.05 17.89 C ANISOU 1915 CG TRP A 107 3103 699 2996 -151 -82 229 C ATOM 1916 CD1 TRP A 107 14.818 62.135 36.605 0.05 18.73 C ANISOU 1916 CD1 TRP A 107 3261 723 3133 -227 -54 250 C ATOM 1917 CD2 TRP A 107 14.618 59.915 36.624 0.05 17.12 C ANISOU 1917 CD2 TRP A 107 2950 718 2838 -190 -71 225 C ATOM 1918 NE1 TRP A 107 15.972 61.623 36.120 0.05 18.56 N ANISOU 1918 NE1 TRP A 107 3212 764 3074 -311 -24 255 N ATOM 1919 CE2 TRP A 107 15.873 60.240 36.114 0.05 17.56 C ANISOU 1919 CE2 TRP A 107 3018 761 2892 -284 -35 238 C ATOM 1920 CE3 TRP A 107 14.272 58.538 36.715 0.05 16.19 C ANISOU 1920 CE3 TRP A 107 2771 709 2671 -154 -84 208 C ATOM 1921 CZ2 TRP A 107 16.782 59.291 35.666 0.05 17.14 C ANISOU 1921 CZ2 TRP A 107 2916 802 2794 -336 -12 234 C ATOM 1922 CZ3 TRP A 107 15.198 57.595 36.272 0.05 15.77 C ANISOU 1922 CZ3 TRP A 107 2678 739 2575 -205 -64 206 C ATOM 1923 CH2 TRP A 107 16.415 57.944 35.776 0.05 16.22 C ANISOU 1923 CH2 TRP A 107 2743 787 2633 -288 -29 216 C ATOM 1924 H TRP A 107 11.619 59.839 35.144 0.05 17.37 H ANISOU 1924 H TRP A 107 3019 737 2845 -7 -156 360 H ATOM 1925 HA TRP A 107 10.613 61.408 37.001 0.05 18.16 H ANISOU 1925 HA TRP A 107 3138 686 3076 83 -159 273 H ATOM 1926 HB2 TRP A 107 12.551 62.185 37.971 0.05 18.46 H ANISOU 1926 HB2 TRP A 107 3205 664 3147 -47 -104 188 H ATOM 1927 HB3 TRP A 107 12.459 60.639 38.213 0.05 17.30 H ANISOU 1927 HB3 TRP A 107 2979 660 2935 -34 -112 162 H ATOM 1928 HD1 TRP A 107 14.654 63.041 36.726 0.05 19.40 H ANISOU 1928 HD1 TRP A 107 3392 716 3263 -222 -53 254 H ATOM 1929 HE1 TRP A 107 16.652 62.053 35.842 0.05 19.03 H ANISOU 1929 HE1 TRP A 107 3291 793 3146 -371 0 266 H ATOM 1930 HE3 TRP A 107 13.445 58.297 37.048 0.05 15.95 H ANISOU 1930 HE3 TRP A 107 2727 689 2643 -98 -103 199 H ATOM 1931 HZ2 TRP A 107 17.612 59.527 35.331 0.05 17.51 H ANISOU 1931 HZ2 TRP A 107 2965 844 2844 -399 17 240 H ATOM 1932 HZ3 TRP A 107 14.969 56.699 36.335 0.05 15.23 H ANISOU 1932 HZ3 TRP A 107 2574 732 2480 -180 -72 195 H ATOM 1933 HH2 TRP A 107 17.018 57.300 35.493 0.05 15.99 H ANISOU 1933 HH2 TRP A 107 2681 815 2580 -317 -13 209 H ATOM 1934 N ASP A 108 11.302 63.519 35.730 0.05 20.01 N ANISOU 1934 N ASP A 108 3523 716 3366 19 -145 384 N ATOM 1935 CA ASP A 108 11.317 64.631 34.776 0.05 21.17 C ANISOU 1935 CA ASP A 108 3762 751 3533 2 -147 478 C ATOM 1936 C ASP A 108 11.556 65.847 35.626 0.05 22.06 C ANISOU 1936 C ASP A 108 3923 720 3739 -1 -127 431 C ATOM 1937 O ASP A 108 11.566 65.844 36.798 0.05 21.80 O ANISOU 1937 O ASP A 108 3854 686 3744 13 -115 331 O ATOM 1938 CB ASP A 108 9.944 64.725 34.111 0.05 21.56 C ANISOU 1938 CB ASP A 108 3826 797 3570 102 -205 563 C ATOM 1939 CG ASP A 108 8.819 64.910 35.142 0.05 22.08 C ANISOU 1939 CG ASP A 108 3886 783 3722 210 -231 530 C ATOM 1940 OD1 ASP A 108 8.024 63.957 35.394 0.05 21.46 O ANISOU 1940 OD1 ASP A 108 3730 773 3652 275 -244 464 O ATOM 1941 OD2 ASP A 108 8.798 65.968 35.771 0.05 23.27 O ANISOU 1941 OD2 ASP A 108 4115 792 3936 228 -233 572 O ATOM 1942 H ASP A 108 11.083 63.764 36.518 0.05 20.07 H ANISOU 1942 H ASP A 108 3520 693 3412 42 -141 330 H ATOM 1943 HA ASP A 108 12.018 64.536 34.118 0.05 21.20 H ANISOU 1943 HA ASP A 108 3783 774 3499 -69 -126 510 H ATOM 1944 HB2 ASP A 108 9.927 65.474 33.497 0.05 22.24 H ANISOU 1944 HB2 ASP A 108 3973 836 3642 83 -210 641 H ATOM 1945 HB3 ASP A 108 9.780 63.908 33.631 0.05 20.87 H ANISOU 1945 HB3 ASP A 108 3688 810 3433 116 -221 559 H ATOM 1946 N LYS A 109 11.665 66.986 34.953 0.05 21.98 N ANISOU 1946 N LYS A 109 4392 977 2984 -6 188 146 N ATOM 1947 CA LYS A 109 11.617 68.281 35.669 0.05 21.67 C ANISOU 1947 CA LYS A 109 4360 869 3006 6 178 286 C ATOM 1948 C LYS A 109 10.302 68.534 36.422 0.05 20.39 C ANISOU 1948 C LYS A 109 4039 715 2993 123 -31 315 C ATOM 1949 O LYS A 109 10.326 69.001 37.548 0.05 19.24 O ANISOU 1949 O LYS A 109 3764 530 3015 123 15 304 O ATOM 1950 CB LYS A 109 11.892 69.389 34.673 0.05 24.28 C ANISOU 1950 CB LYS A 109 5047 1122 3055 -14 181 433 C ATOM 1951 CG LYS A 109 13.288 69.327 34.067 0.05 26.25 C ANISOU 1951 CG LYS A 109 5465 1319 3189 -206 526 455 C ATOM 1952 CD LYS A 109 13.453 70.281 32.867 0.05 29.77 C ANISOU 1952 CD LYS A 109 6394 1671 3245 -269 559 631 C ATOM 1953 CE LYS A 109 12.771 69.753 31.589 0.05 31.75 C ANISOU 1953 CE LYS A 109 6885 2042 3136 -271 519 562 C ATOM 1954 NZ LYS A 109 13.705 69.210 30.543 0.05 33.49 N ANISOU 1954 NZ LYS A 109 7135 2341 3246 -440 962 397 N ATOM 1955 H LYS A 109 11.771 67.042 34.106 0.05 23.47 H ANISOU 1955 H LYS A 109 4753 1171 2993 -40 244 134 H ATOM 1956 HA LYS A 109 12.327 68.288 36.328 0.05 21.33 H ANISOU 1956 HA LYS A 109 4219 807 3077 -54 318 262 H ATOM 1957 HB2 LYS A 109 11.251 69.323 33.953 0.05 25.31 H ANISOU 1957 HB2 LYS A 109 5295 1306 3015 13 63 426 H ATOM 1958 HB3 LYS A 109 11.801 70.241 35.131 0.05 24.38 H ANISOU 1958 HB3 LYS A 109 5093 1055 3114 61 77 527 H ATOM 1959 HG2 LYS A 109 13.948 69.548 34.743 0.05 25.83 H ANISOU 1959 HG2 LYS A 109 5315 1203 3295 -266 605 473 H ATOM 1960 HG3 LYS A 109 13.445 68.427 33.744 0.05 26.32 H ANISOU 1960 HG3 LYS A 109 5377 1413 3209 -245 667 332 H ATOM 1961 HD2 LYS A 109 13.043 71.138 33.079 0.05 30.08 H ANISOU 1961 HD2 LYS A 109 6545 1614 3270 -162 353 758 H ATOM 1962 HD3 LYS A 109 14.393 70.414 32.682 0.05 31.14 H ANISOU 1962 HD3 LYS A 109 6646 1791 3394 -431 817 660 H ATOM 1963 HE2 LYS A 109 12.147 69.055 31.827 0.05 30.31 H ANISOU 1963 HE2 LYS A 109 6534 1936 3045 -175 323 466 H ATOM 1964 HE3 LYS A 109 12.289 70.490 31.179 0.05 33.98 H ANISOU 1964 HE3 LYS A 109 7491 2268 3153 -259 396 710 H ATOM 1965 HZ1 LYS A 109 13.794 68.331 30.635 0.05 33.42 H ANISOU 1965 HZ1 LYS A 109 7107 2402 3189 -395 924 262 H ATOM 1966 HZ2 LYS A 109 13.375 69.383 29.734 0.05 36.06 H ANISOU 1966 HZ2 LYS A 109 7759 2634 3310 -546 1104 483 H ATOM 1967 HZ3 LYS A 109 14.502 69.597 30.612 0.05 32.50 H ANISOU 1967 HZ3 LYS A 109 6756 2225 3369 -480 1132 342 H ATOM 1968 N GLU A 110 9.170 68.164 35.848 0.05 21.30 N ANISOU 1968 N GLU A 110 4150 904 3038 201 -252 330 N ATOM 1969 CA GLU A 110 7.871 68.368 36.503 0.05 21.32 C ANISOU 1969 CA GLU A 110 3939 960 3200 327 -405 348 C ATOM 1970 C GLU A 110 7.719 67.610 37.858 0.05 19.70 C ANISOU 1970 C GLU A 110 3484 819 3181 259 -337 251 C ATOM 1971 O GLU A 110 7.202 68.147 38.844 0.05 19.59 O ANISOU 1971 O GLU A 110 3335 815 3295 330 -293 249 O ATOM 1972 CB GLU A 110 6.779 67.998 35.501 0.05 23.93 C ANISOU 1972 CB GLU A 110 4244 1403 3444 427 -704 393 C ATOM 1973 CG GLU A 110 5.368 68.015 36.008 0.05 24.68 C ANISOU 1973 CG GLU A 110 4184 1662 3532 286 -865 274 C ATOM 1974 CD GLU A 110 4.523 66.951 35.303 0.05 28.17 C ANISOU 1974 CD GLU A 110 4497 2269 3939 379 -1239 313 C ATOM 1975 OE1 GLU A 110 4.887 66.513 34.189 0.05 30.49 O ANISOU 1975 OE1 GLU A 110 5035 2602 3946 322 -1459 321 O ATOM 1976 OE2 GLU A 110 3.490 66.555 35.866 0.05 29.29 O ANISOU 1976 OE2 GLU A 110 4279 2518 4331 521 -1320 326 O ATOM 1977 H GLU A 110 9.119 67.796 35.075 0.05 22.37 H ANISOU 1977 H GLU A 110 4389 1076 3035 177 -314 319 H ATOM 1978 HA GLU A 110 7.769 69.314 36.692 0.05 21.50 H ANISOU 1978 HA GLU A 110 4012 892 3265 405 -360 404 H ATOM 1979 HB2 GLU A 110 6.837 68.616 34.756 0.05 24.66 H ANISOU 1979 HB2 GLU A 110 4200 1507 3664 570 -768 429 H ATOM 1980 HB3 GLU A 110 6.943 67.106 35.174 0.05 25.21 H ANISOU 1980 HB3 GLU A 110 4646 1513 3421 443 -750 469 H ATOM 1981 HG2 GLU A 110 5.344 67.847 36.958 0.05 24.63 H ANISOU 1981 HG2 GLU A 110 4355 1625 3379 177 -820 222 H ATOM 1982 HG3 GLU A 110 4.980 68.882 35.815 0.05 23.64 H ANISOU 1982 HG3 GLU A 110 3857 1561 3565 229 -785 214 H ATOM 1983 N SER A 111 8.196 66.364 37.894 0.05 19.09 N ANISOU 1983 N SER A 111 3403 756 3095 127 -306 172 N ATOM 1984 CA SER A 111 8.224 65.547 39.107 0.05 18.25 C ANISOU 1984 CA SER A 111 3166 650 3118 46 -246 134 C ATOM 1985 C SER A 111 9.236 65.987 40.188 0.05 17.02 C ANISOU 1985 C SER A 111 3027 429 3009 68 -123 161 C ATOM 1986 O SER A 111 8.960 65.884 41.364 0.05 16.93 O ANISOU 1986 O SER A 111 2960 435 3037 40 -85 170 O ATOM 1987 CB SER A 111 8.419 64.037 38.758 0.05 18.77 C ANISOU 1987 CB SER A 111 3305 654 3174 -80 -263 57 C ATOM 1988 OG SER A 111 9.723 63.720 38.323 0.05 18.53 O ANISOU 1988 OG SER A 111 3409 518 3112 -34 -163 17 O ATOM 1989 H SER A 111 8.526 65.966 37.226 0.05 19.53 H ANISOU 1989 H SER A 111 3565 797 3059 88 -310 143 H ATOM 1990 HA SER A 111 7.346 65.622 39.514 0.05 18.88 H ANISOU 1990 HA SER A 111 3114 804 3256 47 -282 139 H ATOM 1991 HB2 SER A 111 8.205 63.500 39.533 0.05 18.77 H ANISOU 1991 HB2 SER A 111 3255 632 3245 -146 -239 65 H ATOM 1992 HB3 SER A 111 7.807 63.829 38.042 0.05 19.92 H ANISOU 1992 HB3 SER A 111 3461 846 3263 -125 -365 18 H ATOM 1993 HG SER A 111 10.236 63.628 38.969 0.05 18.00 H ANISOU 1993 HG SER A 111 3311 412 3115 -9 -118 40 H ATOM 1994 N ATHR A 112 10.424 66.397 39.772 0.02 16.76 N ANISOU 1994 N ATHR A 112 3074 341 2952 82 -62 163 N ATOM 1995 N BTHR A 112 10.427 66.391 39.789 0.03 16.76 N ANISOU 1995 N BTHR A 112 3074 341 2952 81 -63 162 N ATOM 1996 CA ATHR A 112 11.453 66.889 40.688 0.02 16.43 C ANISOU 1996 CA ATHR A 112 3007 271 2966 58 -15 166 C ATOM 1997 CA BTHR A 112 11.388 66.890 40.765 0.03 16.44 C ANISOU 1997 CA BTHR A 112 3009 272 2965 58 -14 166 C ATOM 1998 C ATHR A 112 11.022 68.229 41.312 0.02 16.66 C ANISOU 1998 C ATHR A 112 3088 265 2977 72 3 175 C ATOM 1999 C BTHR A 112 10.906 68.214 41.340 0.03 16.66 C ANISOU 1999 C BTHR A 112 3088 266 2977 72 3 176 C ATOM 2000 O ATHR A 112 11.022 68.373 42.528 0.02 16.78 O ANISOU 2000 O ATHR A 112 3110 280 2986 35 0 148 O ATOM 2001 O BTHR A 112 10.807 68.349 42.546 0.03 16.78 O ANISOU 2001 O BTHR A 112 3109 280 2986 35 0 148 O ATOM 2002 CB ATHR A 112 12.840 66.935 39.981 0.02 17.10 C ANISOU 2002 CB ATHR A 112 3068 347 3083 26 75 139 C ATOM 2003 CB BTHR A 112 12.802 67.056 40.219 0.03 17.11 C ANISOU 2003 CB BTHR A 112 3078 346 3076 26 77 141 C ATOM 2004 OG1ATHR A 112 13.150 65.634 39.467 0.02 17.58 O ANISOU 2004 OG1ATHR A 112 3111 403 3166 75 101 86 O ATOM 2005 OG1BTHR A 112 13.002 68.445 39.874 0.03 17.87 O ANISOU 2005 OG1BTHR A 112 3319 417 3054 11 151 170 O ATOM 2006 CG2ATHR A 112 13.962 67.335 40.934 0.02 17.64 C ANISOU 2006 CG2ATHR A 112 3011 437 3254 -32 48 122 C ATOM 2007 CG2BTHR A 112 13.110 66.091 39.069 0.03 17.61 C ANISOU 2007 CG2BTHR A 112 3080 409 3203 79 93 86 C ATOM 2008 H ATHR A 112 10.667 66.399 38.953 0.05 17.17 H ANISOU 2008 H ATHR A 112 3189 385 2951 82 -44 154 H ATOM 2009 H BTHR A 112 10.689 66.400 38.978 0.05 17.17 H ANISOU 2009 H BTHR A 112 3188 386 2952 82 -45 153 H ATOM 2010 HA ATHR A 112 11.522 66.244 41.410 0.05 16.32 H ANISOU 2010 HA ATHR A 112 2958 261 2980 46 -49 166 H ATOM 2011 HA BTHR A 112 11.426 66.255 41.497 0.05 16.32 H ANISOU 2011 HA BTHR A 112 2959 261 2982 47 -48 165 H ATOM 2012 HB ATHR A 112 12.807 67.556 39.237 0.05 17.57 H ANISOU 2012 HB ATHR A 112 3209 385 3080 2 135 157 H ATOM 2013 HB BTHR A 112 13.422 66.828 40.914 0.05 17.39 H ANISOU 2013 HB BTHR A 112 3059 384 3165 -21 83 135 H ATOM 2014 HG1ATHR A 112 13.902 65.645 39.100 0.05 18.35 H ANISOU 2014 HG1ATHR A 112 3174 512 3287 72 192 54 H ATOM 2015 HG1BTHR A 112 13.596 68.506 39.280 0.05 18.48 H ANISOU 2015 HG1BTHR A 112 3410 473 3139 -48 230 178 H ATOM 2016 HG21ATHR A 112 14.022 66.695 41.656 0.05 17.54 H ANISOU 2016 HG21ATHR A 112 2962 435 3268 6 -43 130 H ATOM 2017 HG21BTHR A 112 13.279 66.592 38.256 0.05 18.29 H ANISOU 2017 HG21BTHR A 112 3220 494 3237 80 184 49 H ATOM 2018 HG22ATHR A 112 14.811 67.364 40.465 0.05 18.58 H ANISOU 2018 HG22ATHR A 112 3037 584 3439 -57 121 92 H ATOM 2019 HG22BTHR A 112 13.898 65.573 39.287 0.05 18.13 H ANISOU 2019 HG22BTHR A 112 3033 489 3368 94 88 75 H ATOM 2020 HG23ATHR A 112 13.776 68.217 41.304 0.05 17.70 H ANISOU 2020 HG23ATHR A 112 3077 416 3232 -89 43 127 H ATOM 2021 HG23BTHR A 112 12.380 65.482 38.931 0.05 17.29 H ANISOU 2021 HG23BTHR A 112 3072 341 3156 97 22 93 H ATOM 2022 N LEU A 113 10.627 69.169 40.468 0.05 17.37 N ANISOU 2022 N LEU A 113 3270 301 3031 142 11 212 N ATOM 2023 CA LEU A 113 10.078 70.440 40.929 0.05 18.40 C ANISOU 2023 CA LEU A 113 3498 318 3173 222 40 209 C ATOM 2024 C LEU A 113 8.814 70.232 41.736 0.05 18.74 C ANISOU 2024 C LEU A 113 3417 441 3261 321 57 154 C ATOM 2025 O LEU A 113 8.595 70.900 42.735 0.05 19.50 O ANISOU 2025 O LEU A 113 3585 476 3347 329 148 76 O ATOM 2026 CB LEU A 113 9.797 71.383 39.748 0.05 19.97 C ANISOU 2026 CB LEU A 113 3866 394 3327 338 3 305 C ATOM 2027 CG LEU A 113 11.021 72.010 39.077 0.05 20.73 C ANISOU 2027 CG LEU A 113 4168 360 3349 175 95 363 C ATOM 2028 CD1 LEU A 113 10.637 72.808 37.818 0.05 22.84 C ANISOU 2028 CD1 LEU A 113 4689 505 3486 285 32 514 C ATOM 2029 CD2 LEU A 113 11.834 72.875 40.085 0.05 21.59 C ANISOU 2029 CD2 LEU A 113 4390 295 3518 30 192 300 C ATOM 2030 H ALEU A 113 10.677 69.100 39.611 0.05 17.68 H ANISOU 2030 H ALEU A 113 3347 346 3026 158 -8 241 H ATOM 2031 H BLEU A 113 10.757 69.116 39.618 0.05 17.68 H ANISOU 2031 H BLEU A 113 3348 345 3026 158 -8 241 H ATOM 2032 HA LEU A 113 10.731 70.853 41.512 0.05 18.52 H ANISOU 2032 HA LEU A 113 3573 273 3192 131 83 174 H ATOM 2033 HB2 LEU A 113 9.312 70.893 39.065 0.05 20.12 H ANISOU 2033 HB2 LEU A 113 3829 500 3314 398 -84 341 H ATOM 2034 HB3 LEU A 113 9.249 72.112 40.077 0.05 21.04 H ANISOU 2034 HB3 LEU A 113 4056 433 3504 454 11 297 H ATOM 2035 HG LEU A 113 11.597 71.279 38.797 0.05 19.98 H ANISOU 2035 HG LEU A 113 3985 368 3240 75 130 339 H ATOM 2036 HD11 LEU A 113 11.414 73.293 37.498 0.05 23.89 H ANISOU 2036 HD11 LEU A 113 5000 520 3557 152 136 565 H ATOM 2037 HD12 LEU A 113 10.339 72.182 37.138 0.05 22.67 H ANISOU 2037 HD12 LEU A 113 4619 608 3387 315 -44 534 H ATOM 2038 HD13 LEU A 113 9.921 73.419 38.045 0.05 23.86 H ANISOU 2038 HD13 LEU A 113 4862 541 3663 456 -38 539 H ATOM 2039 HD21 LEU A 113 12.716 72.496 40.208 0.05 22.46 H ANISOU 2039 HD21 LEU A 113 4586 346 3602 -124 271 336 H ATOM 2040 HD22 LEU A 113 11.914 73.769 39.720 0.05 22.74 H ANISOU 2040 HD22 LEU A 113 4674 291 3674 148 181 311 H ATOM 2041 HD23 LEU A 113 11.374 72.904 40.937 0.05 20.72 H ANISOU 2041 HD23 LEU A 113 4148 273 3453 -32 184 213 H ATOM 2042 N ASN A 114 7.988 69.256 41.368 0.05 18.76 N ANISOU 2042 N ASN A 114 3238 590 3299 348 -3 169 N ATOM 2043 CA ASN A 114 6.785 69.047 42.162 0.05 19.93 C ANISOU 2043 CA ASN A 114 3198 857 3517 388 79 113 C ATOM 2044 C ASN A 114 7.156 68.523 43.567 0.05 19.53 C ANISOU 2044 C ASN A 114 3217 822 3381 233 208 72 C ATOM 2045 O ASN A 114 6.502 68.859 44.552 0.05 21.08 O ANISOU 2045 O ASN A 114 3402 1053 3555 262 378 -3 O ATOM 2046 CB ASN A 114 5.764 68.151 41.428 0.05 20.77 C ANISOU 2046 CB ASN A 114 3067 1128 3698 351 -28 127 C ATOM 2047 CG ASN A 114 4.910 68.917 40.334 0.05 22.59 C ANISOU 2047 CG ASN A 114 3211 1389 3984 554 -216 170 C ATOM 2048 OD1 ASN A 114 5.265 70.011 39.787 0.05 23.52 O ANISOU 2048 OD1 ASN A 114 3464 1367 4107 769 -227 209 O ATOM 2049 ND2 ASN A 114 3.759 68.324 40.023 0.05 23.87 N ANISOU 2049 ND2 ASN A 114 3183 1708 4178 486 -397 167 N ATOM 2050 H ASN A 114 8.093 68.745 40.689 0.05 18.53 H ANISOU 2050 H ASN A 114 3195 595 3252 324 -74 199 H ATOM 2051 HA ASN A 114 6.362 69.915 42.287 0.05 21.22 H ANISOU 2051 HA ASN A 114 3358 978 3729 536 123 86 H ATOM 2052 HB2 ASN A 114 6.231 67.414 41.006 0.05 19.76 H ANISOU 2052 HB2 ASN A 114 3003 986 3517 229 -83 145 H ATOM 2053 HB3 ASN A 114 5.144 67.802 42.088 0.05 21.79 H ANISOU 2053 HB3 ASN A 114 3043 1352 3884 310 69 87 H ATOM 2054 HD21 ASN A 114 3.648 67.486 40.191 0.05 23.25 H ANISOU 2054 HD21 ASN A 114 3105 1659 4070 314 -396 142 H ATOM 2055 HD22 ASN A 114 3.130 68.776 39.649 0.05 25.66 H ANISOU 2055 HD22 ASN A 114 3294 2001 4455 611 -533 187 H ATOM 2056 N PHE A 115 8.207 67.682 43.655 0.05 18.16 N ANISOU 2056 N PHE A 115 3134 620 3145 94 128 121 N ATOM 2057 CA PHE A 115 8.713 67.241 44.946 0.05 18.44 C ANISOU 2057 CA PHE A 115 3302 647 3058 -21 154 130 C ATOM 2058 C PHE A 115 9.193 68.415 45.856 0.05 19.31 C ANISOU 2058 C PHE A 115 3573 700 3065 -8 201 43 C ATOM 2059 O PHE A 115 8.912 68.457 47.037 0.05 20.84 O ANISOU 2059 O PHE A 115 3891 922 3104 -64 309 -5 O ATOM 2060 CB PHE A 115 9.799 66.129 44.742 0.05 17.66 C ANISOU 2060 CB PHE A 115 3244 496 2968 -73 1 205 C ATOM 2061 CG PHE A 115 10.709 65.966 45.918 0.05 18.60 C ANISOU 2061 CG PHE A 115 3506 598 2962 -128 -95 241 C ATOM 2062 CD1 PHE A 115 10.297 65.152 46.969 0.05 20.07 C ANISOU 2062 CD1 PHE A 115 3849 783 2994 -218 -69 321 C ATOM 2063 CD2 PHE A 115 11.961 66.544 45.992 0.05 18.84 C ANISOU 2063 CD2 PHE A 115 3527 625 3008 -127 -230 209 C ATOM 2064 CE1 PHE A 115 11.077 64.987 48.062 0.05 21.73 C ANISOU 2064 CE1 PHE A 115 4259 981 3017 -260 -219 386 C ATOM 2065 CE2 PHE A 115 12.740 66.410 47.093 0.05 20.56 C ANISOU 2065 CE2 PHE A 115 3855 865 3091 -182 -407 240 C ATOM 2066 CZ PHE A 115 12.318 65.590 48.125 0.05 22.00 C ANISOU 2066 CZ PHE A 115 4248 1038 3073 -224 -431 343 C ATOM 2067 H PHE A 115 8.653 67.389 42.983 0.05 17.47 H ANISOU 2067 H PHE A 115 3048 513 3079 87 54 148 H ATOM 2068 HA PHE A 115 7.972 66.827 45.415 0.05 19.35 H ANISOU 2068 HA PHE A 115 3392 817 3142 -75 244 135 H ATOM 2069 HB2 PHE A 115 9.298 65.316 44.640 0.05 17.83 H ANISOU 2069 HB2 PHE A 115 3243 519 3014 -110 8 238 H ATOM 2070 HB3 PHE A 115 10.324 66.279 43.949 0.05 17.01 H ANISOU 2070 HB3 PHE A 115 3121 391 2952 -29 -44 193 H ATOM 2071 HD1 PHE A 115 9.460 64.766 46.923 0.05 20.35 H ANISOU 2071 HD1 PHE A 115 3862 831 3040 -266 47 335 H ATOM 2072 HD2 PHE A 115 12.252 67.091 45.301 0.05 18.29 H ANISOU 2072 HD2 PHE A 115 3376 545 3029 -110 -211 167 H ATOM 2073 HE1 PHE A 115 10.784 64.459 48.765 0.05 23.13 H ANISOU 2073 HE1 PHE A 115 4602 1141 3046 -332 -193 464 H ATOM 2074 HE2 PHE A 115 13.581 66.801 47.122 0.05 21.18 H ANISOU 2074 HE2 PHE A 115 3872 968 3206 -205 -525 205 H ATOM 2075 HZ PHE A 115 12.854 65.474 48.875 0.05 23.61 H ANISOU 2075 HZ PHE A 115 4570 1256 3143 -253 -590 386 H ATOM 2076 N LEU A 116 9.983 69.289 45.249 0.05 18.88 N ANISOU 2076 N LEU A 116 3558 547 3066 16 130 20 N ATOM 2077 CA LEU A 116 10.467 70.476 45.976 0.05 20.31 C ANISOU 2077 CA LEU A 116 3936 622 3158 -40 151 -91 C ATOM 2078 C LEU A 116 9.344 71.421 46.442 0.05 22.14 C ANISOU 2078 C LEU A 116 4277 765 3372 101 347 -210 C ATOM 2079 O LEU A 116 9.362 71.848 47.587 0.05 24.02 O ANISOU 2079 O LEU A 116 4719 962 3447 42 432 -342 O ATOM 2080 CB LEU A 116 11.447 71.226 45.091 0.05 20.19 C ANISOU 2080 CB LEU A 116 3937 497 3236 -116 73 -83 C ATOM 2081 CG LEU A 116 12.730 70.511 44.676 0.05 19.66 C ANISOU 2081 CG LEU A 116 3712 542 3216 -238 -82 -28 C ATOM 2082 CD1 LEU A 116 13.615 71.299 43.703 0.05 19.99 C ANISOU 2082 CD1 LEU A 116 3688 525 3383 -327 -49 -15 C ATOM 2083 CD2 LEU A 116 13.523 70.094 45.896 0.05 21.27 C ANISOU 2083 CD2 LEU A 116 3971 812 3298 -375 -253 -82 C ATOM 2084 H LEU A 116 10.249 69.234 44.435 0.05 18.17 H ANISOU 2084 H LEU A 116 3414 441 3051 36 86 57 H ATOM 2085 HA LEU A 116 10.929 70.187 46.777 0.05 20.89 H ANISOU 2085 HA LEU A 116 4082 740 3114 -139 91 -106 H ATOM 2086 HB2 LEU A 116 10.978 71.428 44.272 0.05 19.72 H ANISOU 2086 HB2 LEU A 116 3840 399 3254 -27 112 -31 H ATOM 2087 HB3 LEU A 116 11.705 72.044 45.539 0.05 21.51 H ANISOU 2087 HB3 LEU A 116 4253 558 3362 -181 90 -169 H ATOM 2088 HG LEU A 116 12.466 69.704 44.212 0.05 18.70 H ANISOU 2088 HG LEU A 116 3497 490 3119 -167 -92 37 H ATOM 2089 HD11 LEU A 116 14.448 70.821 43.571 0.05 20.38 H ANISOU 2089 HD11 LEU A 116 3588 663 3493 -398 -126 -14 H ATOM 2090 HD12 LEU A 116 13.150 71.385 42.855 0.05 19.20 H ANISOU 2090 HD12 LEU A 116 3573 412 3311 -238 19 43 H ATOM 2091 HD13 LEU A 116 13.793 72.176 44.077 0.05 21.15 H ANISOU 2091 HD13 LEU A 116 3968 552 3514 -411 -14 -69 H ATOM 2092 HD21 LEU A 116 13.626 69.129 45.870 0.05 21.21 H ANISOU 2092 HD21 LEU A 116 4014 858 3189 -330 -267 -47 H ATOM 2093 HD22 LEU A 116 14.396 70.514 45.872 0.05 21.66 H ANISOU 2093 HD22 LEU A 116 3872 923 3433 -430 -370 -61 H ATOM 2094 HD23 LEU A 116 13.054 70.342 46.704 0.05 22.51 H ANISOU 2094 HD23 LEU A 116 4277 889 3387 -458 -233 -179 H ATOM 2095 N THR A 117 8.332 71.575 45.608 0.05 22.17 N ANISOU 2095 N THR A 117 4121 773 3529 301 407 -168 N ATOM 2096 CA THR A 117 7.193 72.432 45.956 0.05 24.70 C ANISOU 2096 CA THR A 117 4440 1027 3920 535 591 -278 C ATOM 2097 C THR A 117 6.479 71.852 47.178 0.05 26.22 C ANISOU 2097 C THR A 117 4566 1394 4002 491 814 -377 C ATOM 2098 O THR A 117 6.060 72.550 48.077 0.05 28.89 O ANISOU 2098 O THR A 117 5064 1664 4247 559 1037 -550 O ATOM 2099 CB THR A 117 6.204 72.631 44.755 0.05 25.06 C ANISOU 2099 CB THR A 117 4247 1103 4171 775 507 -177 C ATOM 2100 OG1 THR A 117 6.784 73.530 43.786 0.05 24.12 O ANISOU 2100 OG1 THR A 117 4294 815 4055 757 332 -56 O ATOM 2101 CG2 THR A 117 4.881 73.214 45.235 0.05 28.61 C ANISOU 2101 CG2 THR A 117 4616 1484 4770 1112 664 -285 C ATOM 2102 H THR A 117 8.286 71.228 44.827 0.05 21.17 H ANISOU 2102 H THR A 117 3882 688 3474 322 330 -85 H ATOM 2103 HA THR A 117 7.537 73.301 46.204 0.05 25.85 H ANISOU 2103 HA THR A 117 4796 989 4036 557 622 -356 H ATOM 2104 HB THR A 117 6.020 71.783 44.327 0.05 24.29 H ANISOU 2104 HB THR A 117 3944 1184 4101 720 469 -126 H ATOM 2105 HG1 THR A 117 7.474 73.183 43.456 0.05 22.65 H ANISOU 2105 HG1 THR A 117 4144 659 3803 585 287 -28 H ATOM 2106 HG21 THR A 117 4.493 73.780 44.545 0.05 29.57 H ANISOU 2106 HG21 THR A 117 4879 1404 4951 1265 590 -249 H ATOM 2107 HG22 THR A 117 4.256 72.504 45.443 0.05 29.37 H ANISOU 2107 HG22 THR A 117 4415 1759 4983 1205 660 -263 H ATOM 2108 HG23 THR A 117 5.024 73.752 46.030 0.05 29.83 H ANISOU 2108 HG23 THR A 117 4876 1607 4851 1094 851 -421 H ATOM 2109 N ARG A 118 6.395 70.518 47.235 0.05 25.03 N ANISOU 2109 N ARG A 118 4238 1445 3826 336 785 -270 N ATOM 2110 CA ARG A 118 5.751 69.845 48.361 0.05 26.97 C ANISOU 2110 CA ARG A 118 4477 1847 3923 206 1028 -312 C ATOM 2111 C ARG A 118 6.457 69.932 49.713 0.05 28.06 C ANISOU 2111 C ARG A 118 5016 1934 3712 28 1069 -372 C ATOM 2112 O ARG A 118 5.792 70.117 50.720 0.05 31.14 O ANISOU 2112 O ARG A 118 5541 2377 3914 4 1369 -503 O ATOM 2113 CB ARG A 118 5.499 68.382 48.008 0.05 25.94 C ANISOU 2113 CB ARG A 118 4161 1854 3839 24 958 -156 C ATOM 2114 CG ARG A 118 4.346 68.244 47.061 0.05 26.72 C ANISOU 2114 CG ARG A 118 3840 2088 4226 129 974 -158 C ATOM 2115 CD ARG A 118 4.014 66.794 46.809 0.05 26.66 C ANISOU 2115 CD ARG A 118 3700 2178 4250 -132 934 -49 C ATOM 2116 NE ARG A 118 5.091 66.154 46.061 0.05 23.75 N ANISOU 2116 NE ARG A 118 3508 1670 3845 -198 640 65 N ATOM 2117 CZ ARG A 118 5.028 65.021 45.364 0.05 23.36 C ANISOU 2117 CZ ARG A 118 3386 1613 3878 -338 504 127 C ATOM 2118 NH1 ARG A 118 3.937 64.242 45.306 0.05 25.66 N ANISOU 2118 NH1 ARG A 118 3420 2034 4294 -516 586 107 N ATOM 2119 NH2 ARG A 118 6.118 64.639 44.739 0.05 21.29 N ANISOU 2119 NH2 ARG A 118 3308 1202 3579 -323 302 185 N ATOM 2120 H ARG A 118 6.716 69.990 46.641 0.05 23.46 H ANISOU 2120 H ARG A 118 3958 1274 3682 289 642 -173 H ATOM 2121 HA ARG A 118 4.879 70.237 48.485 0.05 29.06 H ANISOU 2121 HA ARG A 118 4604 2163 4274 336 1229 -408 H ATOM 2122 HB2 ARG A 118 6.293 68.019 47.591 0.05 23.97 H ANISOU 2122 HB2 ARG A 118 3990 1538 3579 -28 748 -69 H ATOM 2123 HB3 ARG A 118 5.292 67.894 48.820 0.05 27.34 H ANISOU 2123 HB3 ARG A 118 4431 2092 3865 -120 1108 -149 H ATOM 2124 HG2 ARG A 118 3.561 68.665 47.446 0.05 29.11 H ANISOU 2124 HG2 ARG A 118 3999 2472 4589 221 1186 -256 H ATOM 2125 HG3 ARG A 118 4.574 68.657 46.214 0.05 25.55 H ANISOU 2125 HG3 ARG A 118 3650 1875 4182 263 796 -136 H ATOM 2126 HD2 ARG A 118 3.909 66.340 47.660 0.05 27.97 H ANISOU 2126 HD2 ARG A 118 3977 2372 4278 -293 1109 -36 H ATOM 2127 HD3 ARG A 118 3.198 66.741 46.284 0.05 27.85 H ANISOU 2127 HD3 ARG A 118 3553 2447 4582 -99 935 -77 H ATOM 2128 HE ARG A 118 5.870 66.513 46.140 0.05 22.69 H ANISOU 2128 HE ARG A 118 3567 1445 3609 -173 578 83 H ATOM 2129 HH11 ARG A 118 3.211 64.480 45.703 0.05 27.49 H ANISOU 2129 HH11 ARG A 118 3471 2391 4581 -522 746 57 H ATOM 2130 HH12 ARG A 118 3.956 63.519 44.844 0.05 25.62 H ANISOU 2130 HH12 ARG A 118 3415 1991 4328 -629 483 129 H ATOM 2131 HH21 ARG A 118 6.826 65.122 44.781 0.05 20.24 H ANISOU 2131 HH21 ARG A 118 3289 1009 3391 -239 255 193 H ATOM 2132 HH22 ARG A 118 6.121 63.904 44.293 0.05 21.32 H ANISOU 2132 HH22 ARG A 118 3309 1170 3623 -403 230 202 H ATOM 2133 N LEU A 119 7.780 69.826 49.758 0.05 26.30 N ANISOU 2133 N LEU A 119 4973 1631 3389 -94 768 -290 N ATOM 2134 CA LEU A 119 8.473 70.021 51.027 0.05 28.11 C ANISOU 2134 CA LEU A 119 5571 1837 3271 -265 692 -345 C ATOM 2135 C LEU A 119 8.147 71.440 51.479 0.05 30.72 C ANISOU 2135 C LEU A 119 6130 2045 3497 -197 889 -602 C ATOM 2136 O LEU A 119 7.887 71.690 52.644 0.05 33.83 O ANISOU 2136 O LEU A 119 6849 2460 3546 -303 1039 -733 O ATOM 2137 CB LEU A 119 10.000 69.953 50.946 0.05 26.73 C ANISOU 2137 CB LEU A 119 5432 1616 3107 -363 296 -264 C ATOM 2138 CG LEU A 119 10.835 68.828 50.371 0.05 25.07 C ANISOU 2138 CG LEU A 119 5071 1467 2988 -389 47 -46 C ATOM 2139 CD1 LEU A 119 12.219 69.371 50.103 0.05 24.43 C ANISOU 2139 CD1 LEU A 119 4883 1353 3048 -415 -237 -58 C ATOM 2140 CD2 LEU A 119 10.902 67.674 51.364 0.05 27.40 C ANISOU 2140 CD2 LEU A 119 5638 1819 2955 -511 -35 72 C ATOM 2141 H LEU A 119 8.286 69.650 49.083 0.05 24.52 H ANISOU 2141 H LEU A 119 4649 1378 3289 -80 601 -213 H ATOM 2142 HA LEU A 119 8.157 69.385 51.687 0.05 29.34 H ANISOU 2142 HA LEU A 119 5826 2077 3244 -363 774 -289 H ATOM 2143 HB2 LEU A 119 10.280 70.747 50.463 0.05 25.81 H ANISOU 2143 HB2 LEU A 119 5227 1416 3165 -303 265 -313 H ATOM 2144 HB3 LEU A 119 10.314 70.040 51.859 0.05 28.59 H ANISOU 2144 HB3 LEU A 119 5902 1848 3111 -472 218 -329 H ATOM 2145 HG LEU A 119 10.446 68.507 49.540 0.05 23.66 H ANISOU 2145 HG LEU A 119 4712 1296 2980 -317 129 13 H ATOM 2146 HD11 LEU A 119 12.178 70.008 49.374 0.05 22.96 H ANISOU 2146 HD11 LEU A 119 4540 1123 3062 -347 -171 -73 H ATOM 2147 HD12 LEU A 119 12.553 69.798 50.905 0.05 26.02 H ANISOU 2147 HD12 LEU A 119 5236 1532 3118 -506 -292 -166 H ATOM 2148 HD13 LEU A 119 12.799 68.635 49.859 0.05 24.47 H ANISOU 2148 HD13 LEU A 119 4830 1400 3068 -416 -419 53 H ATOM 2149 HD21 LEU A 119 11.316 66.909 50.935 0.05 26.71 H ANISOU 2149 HD21 LEU A 119 5472 1722 2953 -487 -155 219 H ATOM 2150 HD22 LEU A 119 11.428 67.946 52.132 0.05 28.93 H ANISOU 2150 HD22 LEU A 119 5994 2019 2977 -581 -213 31 H ATOM 2151 HD23 LEU A 119 10.001 67.452 51.644 0.05 28.59 H ANISOU 2151 HD23 LEU A 119 5892 1998 2973 -546 212 41 H ATOM 2152 N GLU A 120 8.205 72.380 50.535 0.05 30.00 N ANISOU 2152 N GLU A 120 5933 1787 3679 -20 887 -673 N ATOM 2153 CA GLU A 120 8.017 73.784 50.879 0.05 32.97 C ANISOU 2153 CA GLU A 120 6585 1940 4002 75 1059 -923 C ATOM 2154 C GLU A 120 6.609 74.019 51.418 0.05 36.08 C ANISOU 2154 C GLU A 120 6916 2369 4422 320 1492 -1084 C ATOM 2155 O GLU A 120 6.407 74.877 52.278 0.05 39.86 O ANISOU 2155 O GLU A 120 7719 2701 4726 375 1739 -1351 O ATOM 2156 CB GLU A 120 8.278 74.694 49.676 0.05 32.02 C ANISOU 2156 CB GLU A 120 6446 1563 4158 181 919 -901 C ATOM 2157 CG GLU A 120 8.586 76.156 50.030 0.05 35.69 C ANISOU 2157 CG GLU A 120 7301 1674 4585 252 1061 -1158 C ATOM 2158 CD GLU A 120 9.797 76.302 50.954 0.05 38.25 C ANISOU 2158 CD GLU A 120 8046 1954 4533 -67 1004 -1373 C ATOM 2159 OE1 GLU A 120 9.911 77.351 51.640 0.05 42.18 O ANISOU 2159 OE1 GLU A 120 8944 2158 4923 -36 1176 -1655 O ATOM 2160 OE2 GLU A 120 10.628 75.358 50.991 0.05 36.93 O ANISOU 2160 OE2 GLU A 120 7834 2026 4171 -336 753 -1266 O ATOM 2161 H GLU A 120 8.353 72.234 49.701 0.05 28.20 H ANISOU 2161 H GLU A 120 5521 1547 3648 46 790 -577 H ATOM 2162 HA GLU A 120 8.644 74.017 51.580 0.05 34.33 H ANISOU 2162 HA GLU A 120 7026 2093 3926 -102 993 -1010 H ATOM 2163 HB2 GLU A 120 9.021 74.328 49.169 0.05 30.46 H ANISOU 2163 HB2 GLU A 120 6234 1381 3957 6 695 -810 H ATOM 2164 HB3 GLU A 120 7.480 74.696 49.132 0.05 31.13 H ANISOU 2164 HB3 GLU A 120 6099 1477 4251 371 958 -808 H ATOM 2165 HG2 GLU A 120 8.770 76.643 49.213 0.05 35.22 H ANISOU 2165 HG2 GLU A 120 7274 1431 4678 257 949 -1102 H ATOM 2166 HG3 GLU A 120 7.815 76.540 50.476 0.05 37.54 H ANISOU 2166 HG3 GLU A 120 7512 1873 4881 494 1300 -1253 H ATOM 2167 N GLN A 121 5.642 73.258 50.907 0.05 35.18 N ANISOU 2167 N GLN A 121 6365 2454 4546 462 1596 -954 N ATOM 2168 CA GLN A 121 4.259 73.358 51.379 0.05 38.86 C ANISOU 2168 CA GLN A 121 6612 3045 5107 677 2028 -1104 C ATOM 2169 C GLN A 121 4.061 72.544 52.658 0.05 41.23 C ANISOU 2169 C GLN A 121 7089 3553 5024 408 2327 -1159 C ATOM 2170 O GLN A 121 3.184 72.857 53.473 0.05 45.79 O ANISOU 2170 O GLN A 121 7808 4144 5446 491 2766 -1409 O ATOM 2171 CB GLN A 121 3.276 72.824 50.331 0.05 37.91 C ANISOU 2171 CB GLN A 121 5908 3118 5380 843 1981 -950 C ATOM 2172 CG GLN A 121 3.191 73.587 49.025 0.05 36.92 C ANISOU 2172 CG GLN A 121 5633 2810 5585 1155 1709 -874 C ATOM 2173 CD GLN A 121 2.702 72.695 47.858 0.05 34.92 C ANISOU 2173 CD GLN A 121 4927 2768 5573 1155 1457 -659 C ATOM 2174 OE1 GLN A 121 3.309 71.669 47.524 0.05 31.29 O ANISOU 2174 OE1 GLN A 121 4517 2350 5022 896 1197 -487 O ATOM 2175 NE2 GLN A 121 1.587 73.092 47.248 0.05 38.03 N ANISOU 2175 NE2 GLN A 121 4868 3299 6285 1461 1520 -695 N ATOM 2176 H GLN A 121 5.759 72.683 50.280 0.05 32.88 H ANISOU 2176 H GLN A 121 5882 2236 4375 429 1427 -796 H ATOM 2177 HA GLN A 121 4.042 74.285 51.561 0.05 41.19 H ANISOU 2177 HA GLN A 121 7029 3168 5453 879 2165 -1277 H ATOM 2178 HB2 GLN A 121 3.527 71.912 50.114 0.05 35.66 H ANISOU 2178 HB2 GLN A 121 5550 2953 5047 632 1832 -792 H ATOM 2179 HB3 GLN A 121 2.387 72.829 50.721 0.05 40.85 H ANISOU 2179 HB3 GLN A 121 6068 3623 5829 948 2275 -1055 H ATOM 2180 HG2 GLN A 121 2.554 74.310 49.129 0.05 39.93 H ANISOU 2180 HG2 GLN A 121 5944 3118 6109 1435 1880 -1004 H ATOM 2181 HG3 GLN A 121 4.064 73.946 48.805 0.05 35.29 H ANISOU 2181 HG3 GLN A 121 5708 2412 5287 1081 1527 -840 H ATOM 2182 HE21 GLN A 121 1.215 73.834 47.475 0.05 40.86 H ANISOU 2182 HE21 GLN A 121 5193 3598 6734 1694 1696 -821 H ATOM 2183 HE22 GLN A 121 1.241 72.612 46.624 0.05 37.57 H ANISOU 2183 HE22 GLN A 121 4541 3387 6349 1436 1373 -600 H ATOM 2184 N ASP A 122 4.857 71.488 52.819 0.05 38.77 N ANISOU 2184 N ASP A 122 6816 3373 4542 100 2106 -922 N ATOM 2185 CA ASP A 122 4.681 70.571 53.953 0.05 41.30 C ANISOU 2185 CA ASP A 122 7344 3869 4480 -188 2350 -872 C ATOM 2186 C ASP A 122 4.746 71.321 55.290 0.05 45.65 C ANISOU 2186 C ASP A 122 8446 4363 4535 -272 2607 -1114 C ATOM 2187 O ASP A 122 5.744 71.271 56.010 0.05 45.71 O ANISOU 2187 O ASP A 122 8926 4294 4146 -478 2314 -1080 O ATOM 2188 CB ASP A 122 5.724 69.441 53.928 0.05 38.45 C ANISOU 2188 CB ASP A 122 7113 3520 3977 -451 1951 -565 C ATOM 2189 CG ASP A 122 5.312 68.250 53.055 0.05 36.62 C ANISOU 2189 CG ASP A 122 6454 3394 4066 -504 1923 -360 C ATOM 2190 OD1 ASP A 122 4.127 68.109 52.675 0.05 39.42 O ANISOU 2190 OD1 ASP A 122 6704 3899 4376 -677 2271 -324 O ATOM 2191 OD2 ASP A 122 6.202 67.432 52.786 0.05 32.93 O ANISOU 2191 OD2 ASP A 122 5782 2853 3876 -415 1570 -250 O ATOM 2192 H ASP A 122 5.505 71.280 52.294 0.05 36.00 H ANISOU 2192 H ASP A 122 6402 2992 4286 59 1821 -781 H ATOM 2193 HA ASP A 122 3.799 70.171 53.895 0.05 42.82 H ANISOU 2193 HA ASP A 122 7250 4206 4815 -166 2625 -879 H ATOM 2194 HB2 ASP A 122 6.562 69.785 53.583 0.05 36.20 H ANISOU 2194 HB2 ASP A 122 6882 3125 3748 -407 1628 -537 H ATOM 2195 HB3 ASP A 122 5.851 69.107 54.829 0.05 40.57 H ANISOU 2195 HB3 ASP A 122 7703 3823 3890 -633 2022 -532 H TER 2196 ASP A 122 HETATM 2197 N MSE B 2 27.176 57.260 25.395 0.05 22.22 N ANISOU 2197 N MSE B 2 3074 2285 3084 -228 428 1178 N HETATM 2198 CA MSE B 2 26.452 57.024 26.605 0.05 21.02 C ANISOU 2198 CA MSE B 2 2975 2071 2939 -204 344 1049 C HETATM 2199 C MSE B 2 26.027 55.532 26.666 0.05 20.31 C ANISOU 2199 C MSE B 2 2905 2077 2736 -127 357 941 C HETATM 2200 O MSE B 2 25.688 54.915 25.642 0.05 20.52 O ANISOU 2200 O MSE B 2 2982 2167 2648 -65 364 939 O HETATM 2201 CB MSE B 2 25.282 58.023 26.761 0.05 21.15 C ANISOU 2201 CB MSE B 2 3063 2016 2956 -189 289 1078 C HETATM 2202 CG MSE B 2 24.328 57.623 27.909 0.05 20.42 C ANISOU 2202 CG MSE B 2 2999 1793 2966 -214 201 1002 C HETATM 2203 SE MSE B 2 23.038 58.908 28.568 0.02 20.01 SE ANISOU 2203 SE MSE B 2 3033 1703 2868 -139 127 957 SE HETATM 2204 CE MSE B 2 22.164 57.932 29.920 0.05 18.91 C ANISOU 2204 CE MSE B 2 2906 1463 2816 -143 52 821 C HETATM 2205 HA MSE B 2 27.058 57.182 27.345 0.05 20.67 H ANISOU 2205 HA MSE B 2 2907 1967 2978 -246 313 1014 H HETATM 2206 HB2 MSE B 2 25.645 58.899 26.964 0.05 21.99 H ANISOU 2206 HB2 MSE B 2 3163 2108 3083 -215 312 1179 H HETATM 2207 HB3 MSE B 2 24.775 58.062 25.938 0.05 21.01 H ANISOU 2207 HB3 MSE B 2 3081 2050 2850 -135 286 1053 H HETATM 2208 HG2 MSE B 2 23.824 56.849 27.618 0.05 19.76 H ANISOU 2208 HG2 MSE B 2 2896 1709 2901 -219 188 923 H HETATM 2209 HG3 MSE B 2 24.872 57.386 28.672 0.05 20.94 H ANISOU 2209 HG3 MSE B 2 3055 1792 3109 -262 195 1059 H HETATM 2210 HE1 MSE B 2 22.746 57.860 30.683 0.05 19.01 H ANISOU 2210 HE1 MSE B 2 2902 1418 2903 -189 46 823 H HETATM 2211 HE2 MSE B 2 21.345 58.385 30.159 0.05 18.97 H ANISOU 2211 HE2 MSE B 2 2947 1434 2828 -114 19 823 H HETATM 2212 HE3 MSE B 2 21.959 57.053 29.566 0.05 18.27 H ANISOU 2212 HE3 MSE B 2 2815 1431 2698 -123 52 751 H ATOM 2213 N ASN B 3 26.112 54.969 27.869 0.05 19.62 N ANISOU 2213 N ASN B 3 2780 1999 2677 -130 355 852 N ATOM 2214 CA ASN B 3 25.893 53.548 28.113 0.05 18.85 C ANISOU 2214 CA ASN B 3 2715 1947 2500 -67 340 735 C ATOM 2215 C ASN B 3 24.498 53.339 28.644 0.05 18.13 C ANISOU 2215 C ASN B 3 2680 1781 2427 -63 256 675 C ATOM 2216 O ASN B 3 24.151 53.807 29.708 0.05 17.75 O ANISOU 2216 O ASN B 3 2623 1643 2477 -108 210 662 O ATOM 2217 CB ASN B 3 26.908 53.072 29.143 0.05 18.26 C ANISOU 2217 CB ASN B 3 2591 1879 2467 -71 346 656 C ATOM 2218 CG ASN B 3 27.562 51.783 28.762 0.05 18.55 C ANISOU 2218 CG ASN B 3 2621 2018 2408 -4 411 625 C ATOM 2219 OD1 ASN B 3 27.627 50.857 29.567 0.05 18.10 O ANISOU 2219 OD1 ASN B 3 2613 1979 2285 49 389 533 O ATOM 2220 ND2 ASN B 3 27.993 51.678 27.526 0.05 19.41 N ANISOU 2220 ND2 ASN B 3 2665 2190 2519 -6 491 701 N ATOM 2221 H ASN B 3 26.297 55.400 28.589 0.05 19.64 H ANISOU 2221 H ASN B 3 2738 1980 2744 -169 360 860 H ATOM 2222 HA ASN B 3 26.001 53.043 27.295 0.05 19.26 H ANISOU 2222 HA ASN B 3 2787 2066 2464 -23 374 747 H ATOM 2223 HB2 ASN B 3 27.606 53.740 29.232 0.05 18.50 H ANISOU 2223 HB2 ASN B 3 2573 1888 2567 -116 358 698 H ATOM 2224 HB3 ASN B 3 26.460 52.939 29.992 0.05 17.54 H ANISOU 2224 HB3 ASN B 3 2522 1746 2397 -70 297 586 H ATOM 2225 HD21 ASN B 3 28.240 52.383 27.097 0.05 19.47 H ANISOU 2225 HD21 ASN B 3 2621 2178 2597 -47 494 729 H ATOM 2226 HD22 ASN B 3 28.028 50.908 27.149 0.05 19.95 H ANISOU 2226 HD22 ASN B 3 2742 2322 2517 33 538 725 H ATOM 2227 N AILE B 4 23.698 52.659 27.822 0.03 18.09 N ANISOU 2227 N AILE B 4 2729 1821 2324 -6 238 640 N ATOM 2228 N BILE B 4 23.665 52.624 27.928 0.02 18.08 N ANISOU 2228 N BILE B 4 2729 1814 2328 -8 234 642 N ATOM 2229 CA AILE B 4 22.338 52.197 28.122 0.03 17.56 C ANISOU 2229 CA AILE B 4 2707 1714 2252 14 164 585 C ATOM 2230 CA BILE B 4 22.353 52.412 28.483 0.02 17.45 C ANISOU 2230 CA BILE B 4 2687 1677 2267 2 157 584 C ATOM 2231 C AILE B 4 22.272 51.130 29.225 0.03 16.62 C ANISOU 2231 C AILE B 4 2582 1580 2152 21 131 469 C ATOM 2232 C BILE B 4 22.173 51.060 29.190 0.02 16.58 C ANISOU 2232 C BILE B 4 2577 1572 2151 20 129 466 C ATOM 2233 O AILE B 4 21.430 51.177 30.098 0.03 16.01 O ANISOU 2233 O AILE B 4 2513 1446 2126 13 77 422 O ATOM 2234 O BILE B 4 21.119 50.849 29.760 0.02 15.97 O ANISOU 2234 O BILE B 4 2509 1442 2115 17 74 413 O ATOM 2235 CB AILE B 4 21.684 51.643 26.803 0.03 18.15 C ANISOU 2235 CB AILE B 4 2832 1862 2203 70 157 601 C ATOM 2236 CB BILE B 4 21.285 52.695 27.455 0.02 17.97 C ANISOU 2236 CB BILE B 4 2803 1769 2255 42 129 624 C ATOM 2237 CG1AILE B 4 21.450 52.800 25.832 0.03 19.04 C ANISOU 2237 CG1AILE B 4 2958 1966 2312 63 170 725 C ATOM 2238 CG1BILE B 4 21.194 51.537 26.476 0.02 18.31 C ANISOU 2238 CG1BILE B 4 2877 1913 2165 98 143 588 C ATOM 2239 CG2AILE B 4 20.390 50.841 27.068 0.03 17.61 C ANISOU 2239 CG2AILE B 4 2797 1787 2108 100 82 514 C ATOM 2240 CG2BILE B 4 21.558 54.068 26.747 0.02 18.88 C ANISOU 2240 CG2BILE B 4 2921 1858 2394 21 151 754 C ATOM 2241 CD1AILE B 4 20.970 52.367 24.479 0.03 19.83 C ANISOU 2241 CD1AILE B 4 3107 2148 2282 119 167 762 C ATOM 2242 CD1BILE B 4 20.137 51.736 25.479 0.02 18.54 C ANISOU 2242 CD1BILE B 4 2954 1965 2124 138 80 578 C ATOM 2243 H AILE B 4 23.930 52.470 27.016 0.05 18.47 H ANISOU 2243 H AILE B 4 2786 1932 2301 25 270 649 H ATOM 2244 H BILE B 4 23.811 52.294 27.149 0.05 18.47 H ANISOU 2244 H BILE B 4 2792 1923 2302 24 261 653 H ATOM 2245 HA AILE B 4 21.798 52.954 28.400 0.05 17.56 H ANISOU 2245 HA AILE B 4 2707 1653 2312 -10 140 615 H ATOM 2246 HA BILE B 4 22.175 53.076 29.167 0.05 17.31 H ANISOU 2246 HA BILE B 4 2659 1593 2326 -31 137 599 H ATOM 2247 HB AILE B 4 22.319 51.041 26.388 0.05 18.44 H ANISOU 2247 HB AILE B 4 2868 1959 2177 92 196 593 H ATOM 2248 HB BILE B 4 20.440 52.760 27.916 0.05 17.55 H ANISOU 2248 HB BILE B 4 2762 1678 2229 47 80 585 H ATOM 2249 HG12AILE B 4 20.791 53.402 26.208 0.05 18.84 H ANISOU 2249 HG12AILE B 4 2935 1873 2350 46 133 734 H ATOM 2250 HG12BILE B 4 22.040 51.430 26.021 0.05 18.94 H ANISOU 2250 HG12BILE B 4 2954 2040 2201 105 194 644 H ATOM 2251 HG13AILE B 4 22.288 53.271 25.713 0.05 19.43 H ANISOU 2251 HG13AILE B 4 2979 2022 2380 40 220 780 H ATOM 2252 HG13BILE B 4 20.965 50.727 26.955 0.05 17.84 H ANISOU 2252 HG13BILE B 4 2810 1862 2106 102 141 516 H ATOM 2253 HG21AILE B 4 19.871 51.267 27.765 0.05 17.32 H ANISOU 2253 HG21AILE B 4 2756 1693 2133 84 47 516 H ATOM 2254 HG21BILE B 4 20.856 54.236 26.103 0.05 18.80 H ANISOU 2254 HG21BILE B 4 2928 1794 2421 21 109 761 H ATOM 2255 HG22AILE B 4 19.874 50.796 26.253 0.05 18.10 H ANISOU 2255 HG22AILE B 4 2888 1895 2093 131 72 529 H ATOM 2256 HG22BILE B 4 21.568 54.775 27.412 0.05 18.98 H ANISOU 2256 HG22BILE B 4 2902 1845 2466 -18 180 785 H ATOM 2257 HG23AILE B 4 20.642 49.944 27.338 0.05 17.18 H ANISOU 2257 HG23AILE B 4 2736 1741 2051 103 79 443 H ATOM 2258 HG23BILE B 4 22.412 54.035 26.291 0.05 19.49 H ANISOU 2258 HG23BILE B 4 3016 1998 2393 48 176 799 H ATOM 2259 HD11AILE B 4 21.229 53.036 23.826 0.05 20.45 H ANISOU 2259 HD11AILE B 4 3190 2216 2363 112 180 851 H ATOM 2260 HD11BILE B 4 19.911 50.877 25.090 0.05 18.21 H ANISOU 2260 HD11BILE B 4 2922 1940 2055 153 53 501 H ATOM 2261 HD12AILE B 4 21.378 51.516 24.261 0.05 20.10 H ANISOU 2261 HD12AILE B 4 3144 2249 2245 142 205 747 H ATOM 2262 HD12BILE B 4 19.364 52.116 25.923 0.05 18.37 H ANISOU 2262 HD12BILE B 4 2930 1890 2159 125 46 596 H ATOM 2263 HD13AILE B 4 20.005 52.281 24.499 0.05 19.54 H ANISOU 2263 HD13AILE B 4 3092 2104 2228 139 112 712 H ATOM 2264 HD13BILE B 4 20.464 52.338 24.794 0.05 19.27 H ANISOU 2264 HD13BILE B 4 3067 2110 2143 161 102 631 H ATOM 2265 N ILE B 5 23.166 50.157 29.168 0.05 16.63 N ANISOU 2265 N ILE B 5 2572 1639 2106 43 169 428 N ATOM 2266 CA ILE B 5 23.096 48.947 30.030 0.05 15.89 C ANISOU 2266 CA ILE B 5 2472 1534 2031 50 150 329 C ATOM 2267 C ILE B 5 24.313 48.791 30.891 0.05 15.71 C ANISOU 2267 C ILE B 5 2393 1490 2084 16 181 338 C ATOM 2268 O ILE B 5 25.443 49.003 30.446 0.05 16.32 O ANISOU 2268 O ILE B 5 2435 1603 2162 7 238 402 O ATOM 2269 CB ILE B 5 22.857 47.622 29.237 0.05 16.11 C ANISOU 2269 CB ILE B 5 2533 1628 1962 104 163 266 C ATOM 2270 CG1 ILE B 5 22.677 46.430 30.206 0.05 15.36 C ANISOU 2270 CG1 ILE B 5 2438 1496 1903 104 124 169 C ATOM 2271 CG2 ILE B 5 23.999 47.352 28.252 0.05 16.83 C ANISOU 2271 CG2 ILE B 5 2605 1789 2001 133 245 297 C ATOM 2272 CD1 ILE B 5 21.912 45.175 29.664 0.05 15.62 C ANISOU 2272 CD1 ILE B 5 2514 1565 1855 151 117 89 C ATOM 2273 H AILE B 5 23.840 50.163 28.637 0.05 17.13 H ANISOU 2273 H AILE B 5 2633 1750 2124 58 210 460 H ATOM 2274 H BILE B 5 23.872 50.215 28.683 0.05 17.13 H ANISOU 2274 H BILE B 5 2635 1751 2125 58 210 461 H ATOM 2275 HA ILE B 5 22.353 49.031 30.641 0.05 15.43 H ANISOU 2275 HA ILE B 5 2424 1437 2003 43 104 295 H ATOM 2276 HB ILE B 5 22.042 47.730 28.723 0.05 16.40 H ANISOU 2276 HB ILE B 5 2603 1684 1943 123 140 269 H ATOM 2277 HG12 ILE B 5 23.562 46.108 30.443 0.05 15.15 H ANISOU 2277 HG12 ILE B 5 2379 1456 1922 90 146 168 H ATOM 2278 HG13 ILE B 5 22.220 46.729 31.006 0.05 14.99 H ANISOU 2278 HG13 ILE B 5 2395 1411 1889 87 80 157 H ATOM 2279 HG21 ILE B 5 24.821 47.220 28.751 0.05 16.56 H ANISOU 2279 HG21 ILE B 5 2539 1743 2012 125 261 276 H ATOM 2280 HG22 ILE B 5 23.806 46.550 27.742 0.05 17.18 H ANISOU 2280 HG22 ILE B 5 2684 1875 1967 174 251 266 H ATOM 2281 HG23 ILE B 5 24.091 48.112 27.659 0.05 17.28 H ANISOU 2281 HG23 ILE B 5 2645 1860 2059 120 275 372 H ATOM 2282 HD11 ILE B 5 21.965 44.465 30.321 0.05 15.23 H ANISOU 2282 HD11 ILE B 5 2454 1488 1843 147 109 44 H ATOM 2283 HD12 ILE B 5 20.988 45.420 29.507 0.05 15.70 H ANISOU 2283 HD12 ILE B 5 2554 1577 1833 157 74 71 H ATOM 2284 HD13 ILE B 5 22.324 44.886 28.832 0.05 16.16 H ANISOU 2284 HD13 ILE B 5 2590 1680 1871 180 161 104 H ATOM 2285 N ARG B 6 24.078 48.407 32.133 0.05 14.96 N ANISOU 2285 N ARG B 6 2286 1345 2054 -3 144 278 N ATOM 2286 CA ARG B 6 25.131 47.914 32.997 0.05 14.76 C ANISOU 2286 CA ARG B 6 2213 1315 2081 -20 163 260 C ATOM 2287 C ARG B 6 24.753 46.500 33.438 0.05 14.24 C ANISOU 2287 C ARG B 6 2162 1252 1996 12 146 173 C ATOM 2288 O ARG B 6 23.865 46.316 34.271 0.05 13.67 O ANISOU 2288 O ARG B 6 2108 1137 1948 6 99 127 O ATOM 2289 CB ARG B 6 25.337 48.793 34.224 0.05 14.49 C ANISOU 2289 CB ARG B 6 2154 1211 2139 -72 128 271 C ATOM 2290 CG ARG B 6 26.484 48.274 35.107 0.05 14.37 C ANISOU 2290 CG ARG B 6 2087 1198 2174 -90 136 254 C ATOM 2291 CD ARG B 6 26.531 48.926 36.480 0.05 14.24 C ANISOU 2291 CD ARG B 6 2057 1115 2239 -142 90 256 C ATOM 2292 NE ARG B 6 26.879 50.330 36.430 0.05 14.96 N ANISOU 2292 NE ARG B 6 2126 1189 2370 -188 101 336 N ATOM 2293 CZ ARG B 6 26.596 51.205 37.406 0.05 15.16 C ANISOU 2293 CZ ARG B 6 2153 1141 2466 -239 58 351 C ATOM 2294 NH1 ARG B 6 27.007 52.421 37.295 0.05 15.96 N ANISOU 2294 NH1 ARG B 6 2233 1220 2612 -287 69 433 N ATOM 2295 NH2 ARG B 6 25.954 50.850 38.506 0.05 14.68 N ANISOU 2295 NH2 ARG B 6 2117 1030 2433 -243 5 286 N ATOM 2296 H ARG B 6 23.306 48.409 32.493 0.05 14.61 H ANISOU 2296 H ARG B 6 2260 1271 2021 -3 107 249 H ATOM 2297 HA ARG B 6 25.965 47.864 32.509 0.05 15.23 H ANISOU 2297 HA ARG B 6 2247 1412 2126 -15 207 296 H ATOM 2298 HB2 ARG B 6 25.544 49.695 33.935 0.05 14.89 H ANISOU 2298 HB2 ARG B 6 2199 1249 2208 -96 134 326 H ATOM 2299 HB3 ARG B 6 24.519 48.793 34.741 0.05 14.07 H ANISOU 2299 HB3 ARG B 6 2126 1126 2094 -69 91 234 H ATOM 2300 HG2 ARG B 6 26.376 47.325 35.251 0.05 14.00 H ANISOU 2300 HG2 ARG B 6 2048 1158 2112 -66 129 203 H ATOM 2301 HG3 ARG B 6 27.324 48.436 34.652 0.05 14.83 H ANISOU 2301 HG3 ARG B 6 2113 1294 2227 -91 175 293 H ATOM 2302 HD2 ARG B 6 25.671 48.840 36.917 0.05 13.91 H ANISOU 2302 HD2 ARG B 6 2050 1038 2198 -137 58 227 H ATOM 2303 HD3 ARG B 6 27.213 48.482 37.007 0.05 14.13 H ANISOU 2303 HD3 ARG B 6 2015 1105 2250 -149 85 236 H ATOM 2304 HE ARG B 6 27.362 50.595 35.771 0.05 15.36 H ANISOU 2304 HE ARG B 6 2149 1278 2408 -187 139 375 H ATOM 2305 HH11 ARG B 6 27.419 52.668 36.586 0.05 16.33 H ANISOU 2305 HH11 ARG B 6 2263 1306 2636 -282 109 481 H ATOM 2306 HH12 ARG B 6 26.816 52.992 37.907 0.05 16.16 H ANISOU 2306 HH12 ARG B 6 2263 1190 2687 -322 37 439 H ATOM 2307 HH21 ARG B 6 25.691 50.043 38.614 0.05 14.23 H ANISOU 2307 HH21 ARG B 6 2070 987 2350 -215 1 241 H ATOM 2308 HH22 ARG B 6 25.790 51.436 39.106 0.05 14.88 H ANISOU 2308 HH22 ARG B 6 2149 1006 2500 -272 -24 289 H ATOM 2309 N LYS B 7 25.477 45.537 32.899 0.05 14.54 N ANISOU 2309 N LYS B 7 2190 1339 1997 48 190 157 N ATOM 2310 CA LYS B 7 25.375 44.135 33.338 0.05 14.20 C ANISOU 2310 CA LYS B 7 2157 1286 1951 78 178 81 C ATOM 2311 C LYS B 7 25.861 44.044 34.755 0.05 13.68 C ANISOU 2311 C LYS B 7 2052 1179 1968 47 156 71 C ATOM 2312 O LYS B 7 26.957 44.503 35.111 0.05 13.88 O ANISOU 2312 O LYS B 7 2026 1211 2038 22 175 116 O ATOM 2313 CB LYS B 7 26.190 43.184 32.436 0.05 14.83 C ANISOU 2313 CB LYS B 7 2231 1424 1980 131 239 75 C ATOM 2314 CG LYS B 7 25.739 43.101 30.948 0.05 15.51 C ANISOU 2314 CG LYS B 7 2368 1563 1962 177 264 71 C ATOM 2315 CD LYS B 7 25.881 41.670 30.355 0.05 15.68 C ANISOU 2315 CD LYS B 7 2444 1583 1930 233 254 -20 C ATOM 2316 CE LYS B 7 24.689 40.756 30.735 0.05 14.92 C ANISOU 2316 CE LYS B 7 2367 1412 1891 209 184 -88 C ATOM 2317 NZ LYS B 7 24.762 39.406 30.082 0.05 15.23 N ANISOU 2317 NZ LYS B 7 2440 1435 1911 260 189 -163 N ATOM 2318 H LYS B 7 26.047 45.660 32.273 0.05 15.02 H ANISOU 2318 H LYS B 7 2238 1436 2032 60 229 191 H ATOM 2319 HA LYS B 7 24.442 43.881 33.323 0.05 14.00 H ANISOU 2319 HA LYS B 7 2168 1245 1905 85 146 45 H ATOM 2320 HB2 LYS B 7 27.116 43.470 32.448 0.05 15.10 H ANISOU 2320 HB2 LYS B 7 2220 1479 2038 121 273 122 H ATOM 2321 HB3 LYS B 7 26.134 42.291 32.811 0.05 14.65 H ANISOU 2321 HB3 LYS B 7 2212 1387 1969 149 232 31 H ATOM 2322 HG2 LYS B 7 24.802 43.350 30.881 0.05 15.43 H ANISOU 2322 HG2 LYS B 7 2382 1543 1936 160 234 82 H ATOM 2323 HG3 LYS B 7 26.280 43.703 30.417 0.05 16.04 H ANISOU 2323 HG3 LYS B 7 2412 1675 2008 192 315 115 H ATOM 2324 HD2 LYS B 7 25.905 41.737 29.391 0.05 16.06 H ANISOU 2324 HD2 LYS B 7 2535 1657 1911 254 250 -31 H ATOM 2325 HD3 LYS B 7 26.694 41.268 30.684 0.05 15.99 H ANISOU 2325 HD3 LYS B 7 2466 1645 1966 265 296 -23 H ATOM 2326 HE2 LYS B 7 24.678 40.636 31.698 0.05 14.51 H ANISOU 2326 HE2 LYS B 7 2277 1336 1900 182 180 -70 H ATOM 2327 HE3 LYS B 7 23.859 41.167 30.446 0.05 14.72 H ANISOU 2327 HE3 LYS B 7 2364 1369 1861 189 142 -98 H ATOM 2328 HZ1 LYS B 7 24.355 38.806 30.599 0.05 14.84 H ANISOU 2328 HZ1 LYS B 7 2391 1343 1906 242 157 -188 H ATOM 2329 HZ2 LYS B 7 24.343 39.433 29.295 0.05 15.61 H ANISOU 2329 HZ2 LYS B 7 2532 1496 1904 282 180 -194 H ATOM 2330 HZ3 LYS B 7 25.606 39.161 29.952 0.05 15.48 H ANISOU 2330 HZ3 LYS B 7 2448 1489 1945 285 232 -150 H HETATM 2331 N MSE B 8 25.068 43.407 35.607 0.05 13.13 N ANISOU 2331 N MSE B 8 2001 1069 1918 47 115 17 N HETATM 2332 CA MSE B 8 25.506 43.226 36.979 0.05 12.82 C ANISOU 2332 CA MSE B 8 1926 1006 1940 30 102 11 C HETATM 2333 C MSE B 8 26.721 42.318 37.060 0.05 13.21 C ANISOU 2333 C MSE B 8 1941 1090 1988 64 144 12 C HETATM 2334 O MSE B 8 26.688 41.192 36.545 0.05 13.51 O ANISOU 2334 O MSE B 8 2003 1147 1982 114 171 -18 O HETATM 2335 CB MSE B 8 24.388 42.650 37.858 0.05 12.26 C ANISOU 2335 CB MSE B 8 1875 892 1892 27 59 -35 C HETATM 2336 CG MSE B 8 24.875 42.122 39.172 0.05 12.02 C ANISOU 2336 CG MSE B 8 1813 843 1913 12 41 -35 C HETATM 2337 SE MSE B 8 25.508 43.614 40.304 0.05 11.97 SE ANISOU 2337 SE MSE B 8 1792 815 1942 -34 11 -9 SE HETATM 2338 CE MSE B 8 23.685 44.012 41.062 0.05 11.48 C ANISOU 2338 CE MSE B 8 1779 716 1867 -28 -22 -45 C HETATM 2339 H MSE B 8 24.282 43.113 35.423 0.05 12.99 H ANISOU 2339 H MSE B 8 2013 1040 1883 54 94 -10 H HETATM 2340 HA MSE B 8 25.754 44.080 37.360 0.05 12.84 H ANISOU 2340 HA MSE B 8 1906 1000 1971 1 95 41 H HETATM 2341 HB2 MSE B 8 23.787 43.369 38.092 0.05 12.08 H ANISOU 2341 HB2 MSE B 8 1872 853 1866 14 37 -38 H HETATM 2342 HB3 MSE B 8 23.905 41.975 37.373 0.05 12.31 H ANISOU 2342 HB3 MSE B 8 1897 900 1880 51 64 -62 H HETATM 2343 HG2 MSE B 8 24.109 41.739 39.620 0.05 11.77 H ANISOU 2343 HG2 MSE B 8 1798 792 1884 17 23 -59 H HETATM 2344 HG3 MSE B 8 25.561 41.453 39.060 0.05 12.24 H ANISOU 2344 HG3 MSE B 8 1814 888 1947 25 59 -28 H HETATM 2345 HE1 MSE B 8 23.799 44.480 41.908 0.05 11.48 H ANISOU 2345 HE1 MSE B 8 1785 699 1879 -43 -37 -38 H HETATM 2346 HE2 MSE B 8 23.189 44.579 40.449 0.05 11.49 H ANISOU 2346 HE2 MSE B 8 1797 724 1847 -18 -16 -50 H HETATM 2347 HE3 MSE B 8 23.207 43.181 41.225 0.05 11.32 H ANISOU 2347 HE3 MSE B 8 1758 691 1852 -20 -29 -62 H ATOM 2348 N ASP B 9 27.746 42.747 37.759 0.05 13.30 N ANISOU 2348 N ASP B 9 1897 1108 2050 42 146 45 N ATOM 2349 CA ASP B 9 28.940 41.924 37.993 0.05 13.67 C ANISOU 2349 CA ASP B 9 1895 1184 2113 74 176 51 C ATOM 2350 C ASP B 9 28.890 41.576 39.455 0.05 13.26 C ANISOU 2350 C ASP B 9 1833 1098 2106 61 129 30 C ATOM 2351 O ASP B 9 29.296 42.319 40.311 0.05 13.23 O ANISOU 2351 O ASP B 9 1796 1087 2143 19 98 53 O ATOM 2352 CB ASP B 9 30.241 42.658 37.653 0.05 14.32 C ANISOU 2352 CB ASP B 9 1905 1314 2220 57 213 118 C ATOM 2353 CG ASP B 9 31.447 41.766 37.777 0.05 14.82 C ANISOU 2353 CG ASP B 9 1909 1420 2302 100 250 130 C ATOM 2354 OD1 ASP B 9 31.262 40.604 38.183 0.05 14.62 O ANISOU 2354 OD1 ASP B 9 1905 1376 2273 144 240 84 O ATOM 2355 OD2 ASP B 9 32.551 42.186 37.443 0.05 15.50 O ANISOU 2355 OD2 ASP B 9 1924 1558 2407 95 291 189 O ATOM 2356 H ASP B 9 27.777 43.513 38.147 0.05 13.22 H ANISOU 2356 H ASP B 9 1874 1082 2066 8 126 63 H ATOM 2357 HA ASP B 9 28.891 41.112 37.471 0.05 13.82 H ANISOU 2357 HA ASP B 9 1936 1214 2101 117 199 26 H ATOM 2358 HB2 ASP B 9 30.201 42.994 36.743 0.05 14.60 H ANISOU 2358 HB2 ASP B 9 1952 1373 2223 63 244 138 H ATOM 2359 HB3 ASP B 9 30.348 43.395 38.275 0.05 14.22 H ANISOU 2359 HB3 ASP B 9 1873 1283 2246 11 183 137 H ATOM 2360 N TRP B 10 28.412 40.365 39.745 0.05 13.05 N ANISOU 2360 N TRP B 10 1840 1049 2069 98 122 -12 N ATOM 2361 CA TRP B 10 28.306 39.888 41.111 0.05 12.74 C ANISOU 2361 CA TRP B 10 1799 982 2062 93 83 -25 C ATOM 2362 C TRP B 10 29.679 39.662 41.741 0.05 13.14 C ANISOU 2362 C TRP B 10 1783 1061 2148 106 86 5 C ATOM 2363 O TRP B 10 29.745 39.468 42.952 0.05 12.99 O ANISOU 2363 O TRP B 10 1757 1029 2152 97 47 5 O ATOM 2364 CB TRP B 10 27.526 38.534 41.171 0.05 12.61 C ANISOU 2364 CB TRP B 10 1831 929 2032 129 80 -66 C ATOM 2365 CG TRP B 10 26.115 38.611 40.650 0.05 12.33 C ANISOU 2365 CG TRP B 10 1850 867 1969 114 67 -95 C ATOM 2366 CD1 TRP B 10 25.674 38.008 39.546 0.05 12.58 C ANISOU 2366 CD1 TRP B 10 1920 896 1965 139 83 -125 C ATOM 2367 CD2 TRP B 10 24.984 39.312 41.215 0.05 11.88 C ANISOU 2367 CD2 TRP B 10 1812 786 1915 75 32 -98 C ATOM 2368 NE1 TRP B 10 24.344 38.282 39.343 0.05 12.31 N ANISOU 2368 NE1 TRP B 10 1922 837 1916 113 53 -144 N ATOM 2369 CE2 TRP B 10 23.891 39.090 40.359 0.05 11.87 C ANISOU 2369 CE2 TRP B 10 1851 771 1887 76 26 -124 C ATOM 2370 CE3 TRP B 10 24.811 40.135 42.333 0.05 11.59 C ANISOU 2370 CE3 TRP B 10 1763 743 1898 46 5 -83 C ATOM 2371 CZ2 TRP B 10 22.631 39.635 40.594 0.05 11.57 C ANISOU 2371 CZ2 TRP B 10 1830 717 1851 48 -2 -127 C ATOM 2372 CZ3 TRP B 10 23.559 40.678 42.569 0.05 11.31 C ANISOU 2372 CZ3 TRP B 10 1752 688 1856 27 -16 -92 C ATOM 2373 CH2 TRP B 10 22.497 40.447 41.702 0.05 11.29 C ANISOU 2373 CH2 TRP B 10 1778 675 1837 28 -17 -110 C ATOM 2374 H TRP B 10 28.132 39.806 39.162 0.05 13.15 H ANISOU 2374 H TRP B 10 1879 1061 2055 126 139 -33 H ATOM 2375 HA TRP B 10 27.827 40.529 41.645 0.05 12.46 H ANISOU 2375 HA TRP B 10 1773 930 2033 60 55 -24 H ATOM 2376 HB2 TRP B 10 28.011 37.889 40.649 0.05 12.96 H ANISOU 2376 HB2 TRP B 10 1871 983 2069 166 107 -72 H ATOM 2377 HB3 TRP B 10 27.471 38.252 42.089 0.05 12.46 H ANISOU 2377 HB3 TRP B 10 1809 894 2033 125 58 -65 H ATOM 2378 HD1 TRP B 10 26.199 37.477 38.997 0.05 12.95 H ANISOU 2378 HD1 TRP B 10 1968 955 1997 173 109 -133 H ATOM 2379 HE1 TRP B 10 23.879 37.984 38.685 0.05 12.45 H ANISOU 2379 HE1 TRP B 10 1968 852 1912 120 50 -166 H ATOM 2380 HE3 TRP B 10 25.526 40.294 42.897 0.05 11.66 H ANISOU 2380 HE3 TRP B 10 1748 761 1922 43 0 -70 H ATOM 2381 HZ2 TRP B 10 21.923 39.480 40.014 0.05 11.63 H ANISOU 2381 HZ2 TRP B 10 1858 719 1843 47 -12 -143 H ATOM 2382 HZ3 TRP B 10 23.430 41.229 43.310 0.05 11.18 H ANISOU 2382 HZ3 TRP B 10 1733 668 1848 15 -30 -87 H ATOM 2383 HH2 TRP B 10 21.672 40.835 41.911 0.05 11.15 H ANISOU 2383 HH2 TRP B 10 1767 650 1819 17 -31 -111 H ATOM 2384 N ASP B 11 30.745 39.676 40.959 0.05 13.72 N ANISOU 2384 N ASP B 11 1808 1180 2224 128 131 34 N ATOM 2385 CA ASP B 11 32.102 39.596 41.471 0.05 14.24 C ANISOU 2385 CA ASP B 11 1793 1286 2333 138 133 72 C ATOM 2386 C ASP B 11 32.716 40.922 41.893 0.05 14.44 C ANISOU 2386 C ASP B 11 1761 1329 2397 68 103 115 C ATOM 2387 O ASP B 11 33.815 40.936 42.375 0.05 14.96 O ANISOU 2387 O ASP B 11 1749 1429 2504 63 92 150 O ATOM 2388 CB ASP B 11 32.994 38.952 40.369 0.05 14.95 C ANISOU 2388 CB ASP B 11 1848 1424 2409 203 206 89 C ATOM 2389 CG ASP B 11 34.452 38.806 40.762 0.05 15.66 C ANISOU 2389 CG ASP B 11 1837 1566 2547 223 217 137 C ATOM 2390 OD1 ASP B 11 35.344 39.408 40.133 0.05 16.30 O ANISOU 2390 OD1 ASP B 11 1845 1705 2643 214 257 189 O ATOM 2391 OD2 ASP B 11 34.719 38.022 41.687 0.05 15.67 O ANISOU 2391 OD2 ASP B 11 1827 1555 2572 251 187 130 O ATOM 2392 H ASP B 11 30.709 39.746 40.116 0.05 13.88 H ANISOU 2392 H ASP B 11 1838 1214 2222 140 161 34 H ATOM 2393 HA ASP B 11 32.115 39.024 42.252 0.05 14.15 H ANISOU 2393 HA ASP B 11 1783 1259 2333 152 108 62 H ATOM 2394 HB2 ASP B 11 32.629 38.083 40.182 0.05 14.89 H ANISOU 2394 HB2 ASP B 11 1883 1396 2380 246 217 54 H ATOM 2395 HB3 ASP B 11 32.951 39.499 39.576 0.05 15.09 H ANISOU 2395 HB3 ASP B 11 1866 1461 2407 191 233 102 H ATOM 2396 N SER B 12 32.026 42.036 41.690 0.05 14.12 N ANISOU 2396 N SER B 12 1758 1260 2346 16 85 111 N ATOM 2397 CA SER B 12 32.670 43.301 42.074 0.05 14.42 C ANISOU 2397 CA SER B 12 1756 1297 2426 -55 54 148 C ATOM 2398 C SER B 12 31.735 44.073 42.993 0.05 14.01 C ANISOU 2398 C SER B 12 1749 1192 2382 -98 -18 115 C ATOM 2399 O SER B 12 31.725 45.336 42.961 0.05 14.32 O ANISOU 2399 O SER B 12 1772 1212 2458 -161 -50 136 O ATOM 2400 CB SER B 12 33.130 44.131 40.860 0.05 14.62 C ANISOU 2400 CB SER B 12 1792 1327 2434 -74 97 180 C ATOM 2401 OG SER B 12 32.020 44.638 40.122 0.05 14.02 O ANISOU 2401 OG SER B 12 1801 1207 2318 -74 86 144 O ATOM 2402 H SER B 12 31.248 42.097 41.346 0.05 13.79 H ANISOU 2402 H SER B 12 1766 1197 2277 21 88 89 H ATOM 2403 HA SER B 12 33.461 43.107 42.594 0.05 14.89 H ANISOU 2403 HA SER B 12 1753 1386 2518 -60 53 178 H ATOM 2404 HB2 SER B 12 33.655 44.883 41.176 0.05 14.97 H ANISOU 2404 HB2 SER B 12 1801 1371 2516 -121 82 215 H ATOM 2405 HB3 SER B 12 33.670 43.567 40.276 0.05 14.89 H ANISOU 2405 HB3 SER B 12 1810 1399 2450 -37 147 195 H ATOM 2406 HG SER B 12 32.146 44.532 39.298 0.05 14.18 H ANISOU 2406 HG SER B 12 1828 1236 2324 -77 111 164 H HETATM 2407 N MSE B 13 31.018 43.428 43.866 0.05 13.45 N ANISOU 2407 N MSE B 13 1735 1095 2282 -71 -40 69 N HETATM 2408 CA MSE B 13 30.270 44.106 44.932 0.05 13.19 C ANISOU 2408 CA MSE B 13 1744 1022 2245 -98 -100 37 C HETATM 2409 C MSE B 13 31.278 44.739 45.882 0.05 13.79 C ANISOU 2409 C MSE B 13 1768 1107 2364 -143 -158 52 C HETATM 2410 O MSE B 13 32.405 44.325 46.030 0.05 14.27 O ANISOU 2410 O MSE B 13 1759 1210 2455 -141 -159 83 O HETATM 2411 CB MSE B 13 29.405 43.153 45.754 0.05 12.68 C ANISOU 2411 CB MSE B 13 1733 943 2144 -57 -110 -2 C HETATM 2412 CG MSE B 13 28.556 42.123 44.977 0.05 12.12 C ANISOU 2412 CG MSE B 13 1720 851 2035 -17 -71 -26 C HETATM 2413 SE MSE B 13 27.440 42.959 43.610 0.03 12.15 SE ANISOU 2413 SE MSE B 13 1731 852 2032 -35 -36 -13 SE HETATM 2414 CE MSE B 13 25.756 43.187 44.680 0.05 11.64 C ANISOU 2414 CE MSE B 13 1735 745 1942 -40 -57 -46 C HETATM 2415 H MSE B 13 30.944 42.571 43.876 0.05 13.27 H ANISOU 2415 H MSE B 13 1729 1075 2238 -35 -19 56 H HETATM 2416 HA MSE B 13 29.702 44.796 44.568 0.05 13.07 H ANISOU 2416 HA MSE B 13 1758 982 2226 -118 -100 32 H HETATM 2417 HB2 MSE B 13 30.000 42.679 46.346 0.05 12.85 H ANISOU 2417 HB2 MSE B 13 1728 985 2171 -37 -114 7 H HETATM 2418 HB3 MSE B 13 28.777 43.659 46.288 0.05 12.64 H ANISOU 2418 HB3 MSE B 13 1751 919 2132 -73 -143 -18 H HETATM 2419 HG2 MSE B 13 29.137 41.479 44.547 0.05 12.17 H ANISOU 2419 HG2 MSE B 13 1718 867 2040 12 -53 -23 H HETATM 2420 HG3 MSE B 13 27.926 41.703 45.580 0.05 11.89 H ANISOU 2420 HG3 MSE B 13 1723 804 1990 -17 -85 -43 H HETATM 2421 HE1 MSE B 13 25.165 43.778 44.183 0.05 11.53 H ANISOU 2421 HE1 MSE B 13 1737 730 1912 -28 -39 -51 H HETATM 2422 HE2 MSE B 13 25.306 42.338 44.820 0.05 11.51 H ANISOU 2422 HE2 MSE B 13 1728 724 1922 -29 -70 -59 H HETATM 2423 HE3 MSE B 13 25.972 43.584 45.541 0.05 11.71 H ANISOU 2423 HE3 MSE B 13 1750 741 1960 -62 -71 -42 H ATOM 2424 N VAL B 14 30.852 45.821 46.527 0.05 13.86 N ANISOU 2424 N VAL B 14 1813 1075 2380 -185 -211 28 N ATOM 2425 CA VAL B 14 31.657 46.535 47.491 0.05 14.50 C ANISOU 2425 CA VAL B 14 1864 1151 2496 -233 -284 25 C ATOM 2426 C VAL B 14 31.012 46.440 48.850 0.05 14.35 C ANISOU 2426 C VAL B 14 1905 1116 2431 -213 -335 -29 C ATOM 2427 O VAL B 14 29.852 46.762 49.038 0.05 13.96 O ANISOU 2427 O VAL B 14 1928 1031 2346 -197 -330 -65 O ATOM 2428 CB VAL B 14 31.787 48.029 47.065 0.05 14.98 C ANISOU 2428 CB VAL B 14 1925 1162 2604 -303 -309 37 C ATOM 2429 CG1 VAL B 14 32.522 48.791 48.100 0.05 15.75 C ANISOU 2429 CG1 VAL B 14 2003 1242 2740 -360 -399 22 C ATOM 2430 CG2 VAL B 14 32.528 48.109 45.770 0.05 15.27 C ANISOU 2430 CG2 VAL B 14 1896 1226 2679 -321 -250 105 C ATOM 2431 H VAL B 14 30.075 46.150 46.417 0.05 13.60 H ANISOU 2431 H VAL B 14 1824 1013 2330 -184 -208 9 H ATOM 2432 HA VAL B 14 32.550 46.179 47.539 0.05 14.85 H ANISOU 2432 HA VAL B 14 1849 1232 2563 -235 -288 51 H ATOM 2433 HB VAL B 14 30.902 48.404 46.957 0.05 14.67 H ANISOU 2433 HB VAL B 14 1944 1086 2544 -296 -304 13 H ATOM 2434 HG11 VAL B 14 32.587 49.713 47.802 0.05 16.06 H ANISOU 2434 HG11 VAL B 14 2055 1236 2810 -403 -417 25 H ATOM 2435 HG12 VAL B 14 32.041 48.751 48.934 0.05 15.64 H ANISOU 2435 HG12 VAL B 14 2030 1221 2690 -340 -434 -21 H ATOM 2436 HG13 VAL B 14 33.412 48.424 48.209 0.05 16.15 H ANISOU 2436 HG13 VAL B 14 1985 1331 2820 -373 -406 54 H ATOM 2437 HG21 VAL B 14 32.537 49.037 45.481 0.05 15.61 H ANISOU 2437 HG21 VAL B 14 1941 1236 2756 -367 -265 121 H ATOM 2438 HG22 VAL B 14 33.438 47.813 45.906 0.05 15.63 H ANISOU 2438 HG22 VAL B 14 1879 1313 2748 -325 -252 131 H ATOM 2439 HG23 VAL B 14 32.075 47.571 45.109 0.05 14.83 H ANISOU 2439 HG23 VAL B 14 1862 1182 2592 -283 -199 107 H ATOM 2440 N HIS B 15 31.770 45.961 49.822 0.05 14.75 N ANISOU 2440 N HIS B 15 1924 1202 2478 -207 -383 -30 N ATOM 2441 CA HIS B 15 31.286 45.812 51.184 0.05 14.77 C ANISOU 2441 CA HIS B 15 1982 1204 2425 -182 -431 -74 C ATOM 2442 C HIS B 15 31.199 47.190 51.820 0.05 15.28 C ANISOU 2442 C HIS B 15 2092 1223 2493 -228 -502 -121 C ATOM 2443 O HIS B 15 32.176 47.908 51.882 0.05 16.01 O ANISOU 2443 O HIS B 15 2141 1307 2635 -287 -561 -115 O ATOM 2444 CB HIS B 15 32.243 44.888 51.971 0.05 15.19 C ANISOU 2444 CB HIS B 15 1986 1315 2472 -159 -467 -54 C ATOM 2445 CG HIS B 15 31.734 44.453 53.301 0.05 15.16 C ANISOU 2445 CG HIS B 15 2042 1326 2394 -114 -493 -82 C ATOM 2446 ND1 HIS B 15 30.769 43.475 53.438 0.05 14.56 N ANISOU 2446 ND1 HIS B 15 2004 1251 2276 -57 -433 -75 N ATOM 2447 CD2 HIS B 15 32.154 44.744 54.552 0.05 15.78 C ANISOU 2447 CD2 HIS B 15 2144 1422 2430 -114 -571 -111 C ATOM 2448 CE1 HIS B 15 30.560 43.263 54.730 0.05 14.79 C ANISOU 2448 CE1 HIS B 15 2076 1302 2241 -25 -464 -89 C ATOM 2449 NE2 HIS B 15 31.398 44.006 55.426 0.05 15.52 N ANISOU 2449 NE2 HIS B 15 2164 1409 2325 -53 -548 -114 N ATOM 2450 H HIS B 15 32.585 45.746 49.714 0.05 15.08 H ANISOU 2450 H HIS B 15 1910 1271 2548 -217 -389 -3 H ATOM 2451 HA HIS B 15 30.393 45.459 51.183 0.05 14.29 H ANISOU 2451 HA HIS B 15 1966 1135 2329 -148 -396 -87 H ATOM 2452 HB2 HIS B 15 32.351 44.090 51.431 0.05 14.98 H ANISOU 2452 HB2 HIS B 15 1926 1308 2456 -133 -421 -22 H ATOM 2453 HB3 HIS B 15 33.100 45.316 52.085 0.05 15.76 H ANISOU 2453 HB3 HIS B 15 2017 1396 2576 -196 -515 -47 H ATOM 2454 HD2 HIS B 15 32.814 45.354 54.780 0.05 16.34 H ANISOU 2454 HD2 HIS B 15 2198 1493 2518 -150 -631 -124 H ATOM 2455 HE1 HIS B 15 29.935 42.668 55.078 0.05 14.54 H ANISOU 2455 HE1 HIS B 15 2072 1275 2176 11 -433 -81 H ATOM 2456 N AGLU B 16 30.037 47.465 52.387 0.03 15.02 N ANISOU 2456 N AGLU B 16 2143 1159 2404 -198 -499 -168 N ATOM 2457 N BGLU B 16 29.998 47.549 52.200 0.02 14.98 N ANISOU 2457 N BGLU B 16 2137 1150 2405 -201 -493 -166 N ATOM 2458 CA AGLU B 16 29.771 48.746 53.075 0.03 15.60 C ANISOU 2458 CA AGLU B 16 2280 1182 2465 -222 -566 -229 C ATOM 2459 CA BGLU B 16 29.743 48.931 52.582 0.02 15.49 C ANISOU 2459 CA BGLU B 16 2259 1153 2473 -234 -549 -218 C ATOM 2460 C AGLU B 16 28.500 48.542 53.886 0.03 15.29 C ANISOU 2460 C AGLU B 16 2324 1144 2344 -156 -541 -271 C ATOM 2461 C BGLU B 16 28.871 48.803 53.778 0.02 15.45 C ANISOU 2461 C BGLU B 16 2332 1156 2383 -175 -557 -269 C ATOM 2462 O AGLU B 16 27.600 47.805 53.447 0.03 14.58 O ANISOU 2462 O AGLU B 16 2237 1070 2232 -112 -467 -247 O ATOM 2463 O BGLU B 16 27.888 48.031 53.809 0.02 14.82 O ANISOU 2463 O BGLU B 16 2271 1101 2258 -119 -492 -258 O ATOM 2464 CB AGLU B 16 29.635 49.923 52.084 0.03 15.84 C ANISOU 2464 CB AGLU B 16 2316 1140 2564 -280 -573 -228 C ATOM 2465 CB BGLU B 16 29.144 49.828 51.437 0.02 15.31 C ANISOU 2465 CB BGLU B 16 2254 1066 2496 -261 -514 -208 C ATOM 2466 CG AGLU B 16 28.368 49.921 51.268 0.03 15.13 C ANISOU 2466 CG AGLU B 16 2228 1032 2487 -264 -488 -194 C ATOM 2467 CG BGLU B 16 30.211 50.544 50.509 0.02 15.67 C ANISOU 2467 CG BGLU B 16 2223 1102 2630 -331 -514 -151 C ATOM 2468 CD AGLU B 16 28.235 51.160 50.412 0.03 15.49 C ANISOU 2468 CD AGLU B 16 2290 1002 2591 -313 -498 -187 C ATOM 2469 CD BGLU B 16 29.606 51.403 49.349 0.02 15.72 C ANISOU 2469 CD BGLU B 16 2254 1039 2680 -362 -490 -133 C ATOM 2470 OE1AGLU B 16 28.509 52.302 50.900 0.03 16.28 O ANISOU 2470 OE1AGLU B 16 2422 1045 2720 -356 -572 -225 O ATOM 2471 OE1BGLU B 16 28.392 51.258 49.088 0.02 15.13 O ANISOU 2471 OE1BGLU B 16 2228 949 2570 -316 -439 -142 O ATOM 2472 OE2AGLU B 16 27.820 50.982 49.233 0.03 15.06 O ANISOU 2472 OE2AGLU B 16 2224 943 2555 -309 -435 -145 O ATOM 2473 OE2BGLU B 16 30.342 52.219 48.692 0.02 16.43 O ANISOU 2473 OE2BGLU B 16 2307 1092 2843 -434 -523 -102 O ATOM 2474 H AGLU B 16 29.373 46.948 52.413 0.05 14.58 H ANISOU 2474 H AGLU B 16 2111 1111 2318 -161 -460 -169 H ATOM 2475 H BGLU B 16 29.326 47.045 52.282 0.05 14.57 H ANISOU 2475 H BGLU B 16 2111 1107 2319 -163 -458 -169 H ATOM 2476 HA AGLU B 16 30.506 48.922 53.676 0.05 16.15 H ANISOU 2476 HA AGLU B 16 2335 1267 2534 -240 -625 -240 H ATOM 2477 HA BGLU B 16 30.580 49.318 52.873 0.05 16.09 H ANISOU 2477 HA BGLU B 16 2311 1228 2575 -272 -607 -222 H ATOM 2478 HB2AGLU B 16 29.682 50.755 52.585 0.05 16.20 H ANISOU 2478 HB2AGLU B 16 2417 1145 2595 -283 -612 -274 H ATOM 2479 HB2BGLU B 16 28.572 49.291 50.863 0.05 14.73 H ANISOU 2479 HB2BGLU B 16 2191 1001 2404 -227 -457 -195 H ATOM 2480 HB3AGLU B 16 30.376 49.894 51.457 0.05 16.25 H ANISOU 2480 HB3AGLU B 16 2313 1195 2666 -328 -600 -201 H ATOM 2481 HB3BGLU B 16 28.607 50.519 51.849 0.05 15.63 H ANISOU 2481 HB3BGLU B 16 2347 1062 2531 -267 -547 -249 H ATOM 2482 HG2AGLU B 16 28.367 49.165 50.663 0.05 14.89 H ANISOU 2482 HG2AGLU B 16 2145 1038 2474 -265 -453 -151 H ATOM 2483 HG2BGLU B 16 30.743 51.150 51.056 0.05 16.29 H ANISOU 2483 HG2BGLU B 16 2277 1178 2734 -370 -572 -156 H ATOM 2484 HG3AGLU B 16 27.595 49.864 51.847 0.05 14.73 H ANISOU 2484 HG3AGLU B 16 2220 985 2392 -218 -460 -213 H ATOM 2485 HG3BGLU B 16 30.786 49.880 50.116 0.05 15.34 H ANISOU 2485 HG3BGLU B 16 2136 1103 2589 -315 -469 -112 H ATOM 2486 N ATYR B 17 28.440 49.174 55.063 0.03 15.96 N ANISOU 2486 N ATYR B 17 2471 1213 2379 -146 -605 -333 N ATOM 2487 N BTYR B 17 29.223 49.657 54.729 0.02 16.26 N ANISOU 2487 N BTYR B 17 2481 1232 2465 -192 -638 -327 N ATOM 2488 CA ATYR B 17 27.338 49.033 56.014 0.03 15.90 C ANISOU 2488 CA ATYR B 17 2540 1217 2284 -76 -580 -372 C ATOM 2489 CA BTYR B 17 29.306 49.295 56.123 0.02 16.79 C ANISOU 2489 CA BTYR B 17 2576 1346 2457 -161 -694 -361 C ATOM 2490 C ATYR B 17 26.995 47.571 56.323 0.03 15.48 C ANISOU 2490 C ATYR B 17 2465 1238 2178 -23 -532 -329 C ATOM 2491 C BTYR B 17 29.356 47.768 56.350 0.02 16.35 C ANISOU 2491 C BTYR B 17 2476 1369 2366 -115 -651 -307 C ATOM 2492 O ATYR B 17 25.840 47.238 56.505 0.03 15.16 O ANISOU 2492 O ATYR B 17 2457 1214 2088 31 -473 -325 O ATOM 2493 O BTYR B 17 30.503 47.267 56.458 0.02 16.67 O ANISOU 2493 O BTYR B 17 2449 1449 2437 -139 -691 -273 O ATOM 2494 CB ATYR B 17 26.066 49.749 55.528 0.03 15.50 C ANISOU 2494 CB ATYR B 17 2530 1114 2245 -54 -522 -384 C ATOM 2495 CB BTYR B 17 28.315 50.091 56.972 0.02 17.23 C ANISOU 2495 CB BTYR B 17 2739 1374 2434 -116 -716 -439 C ATOM 2496 CG ATYR B 17 26.256 51.182 55.175 0.03 16.12 C ANISOU 2496 CG ATYR B 17 2654 1109 2364 -91 -574 -434 C ATOM 2497 CG BTYR B 17 28.967 51.301 57.610 0.02 18.31 C ANISOU 2497 CG BTYR B 17 2920 1447 2590 -166 -820 -510 C ATOM 2498 CD1ATYR B 17 25.788 52.169 56.016 0.03 16.79 C ANISOU 2498 CD1ATYR B 17 2827 1159 2392 -49 -604 -509 C ATOM 2499 CD1BTYR B 17 29.317 52.423 56.849 0.02 18.50 C ANISOU 2499 CD1BTYR B 17 2924 1392 2714 -239 -841 -505 C ATOM 2500 CD2ATYR B 17 26.869 51.555 53.992 0.03 16.17 C ANISOU 2500 CD2ATYR B 17 2616 1067 2462 -162 -590 -402 C ATOM 2501 CD2BTYR B 17 29.263 51.317 58.965 0.02 19.26 C ANISOU 2501 CD2BTYR B 17 3105 1585 2628 -143 -901 -580 C ATOM 2502 CE1ATYR B 17 25.952 53.491 55.711 0.03 17.49 C ANISOU 2502 CE1ATYR B 17 2968 1156 2523 -80 -658 -560 C ATOM 2503 CE1BTYR B 17 29.913 53.524 57.420 0.02 19.60 C ANISOU 2503 CE1BTYR B 17 3105 1458 2884 -293 -942 -567 C ATOM 2504 CE2ATYR B 17 27.053 52.844 53.687 0.03 16.87 C ANISOU 2504 CE2ATYR B 17 2748 1068 2595 -200 -642 -441 C ATOM 2505 CE2BTYR B 17 29.861 52.409 59.548 0.02 20.37 C ANISOU 2505 CE2BTYR B 17 3294 1658 2790 -192 -1007 -654 C ATOM 2506 CZ ATYR B 17 26.586 53.815 54.535 0.03 17.52 C ANISOU 2506 CZ ATYR B 17 2925 1104 2628 -160 -678 -522 C ATOM 2507 CZ BTYR B 17 30.189 53.520 58.779 0.02 20.55 C ANISOU 2507 CZ BTYR B 17 3294 1589 2925 -272 -1029 -647 C ATOM 2508 OH ATYR B 17 26.765 55.109 54.178 0.03 18.30 O ANISOU 2508 OH ATYR B 17 3072 1099 2781 -197 -732 -561 O ATOM 2509 OH BTYR B 17 30.792 54.620 59.388 0.02 21.80 O ANISOU 2509 OH BTYR B 17 3502 1664 3116 -330 -1142 -721 O ATOM 2510 H ATYR B 17 29.059 49.689 55.347 0.05 16.52 H ANISOU 2510 H ATYR B 17 2541 1272 2465 -179 -664 -353 H ATOM 2511 H BTYR B 17 29.439 50.468 54.562 0.05 16.58 H ANISOU 2511 H BTYR B 17 2542 1225 2535 -222 -665 -349 H ATOM 2512 HA ATYR B 17 27.607 49.437 56.848 0.05 16.53 H ANISOU 2512 HA ATYR B 17 2661 1291 2330 -73 -635 -418 H ATOM 2513 HA BTYR B 17 30.178 49.605 56.422 0.05 17.38 H ANISOU 2513 HA BTYR B 17 2626 1419 2561 -204 -759 -368 H ATOM 2514 HB2ATYR B 17 25.697 49.282 54.758 0.05 14.96 H ANISOU 2514 HB2ATYR B 17 2421 1047 2214 -65 -477 -342 H ATOM 2515 HB2BTYR B 17 27.619 50.434 56.402 0.05 16.82 H ANISOU 2515 HB2BTYR B 17 2712 1296 2385 -95 -663 -441 H ATOM 2516 HB3ATYR B 17 25.419 49.738 56.253 0.05 15.46 H ANISOU 2516 HB3ATYR B 17 2562 1128 2185 -4 -495 -400 H ATOM 2517 HB3BTYR B 17 27.950 49.520 57.670 0.05 17.33 H ANISOU 2517 HB3BTYR B 17 2770 1436 2380 -73 -717 -444 H ATOM 2518 HD1ATYR B 17 25.366 51.931 56.812 0.05 16.83 H ANISOU 2518 HD1ATYR B 17 2860 1203 2330 3 -587 -526 H ATOM 2519 HD1BTYR B 17 29.134 52.436 55.937 0.05 17.94 H ANISOU 2519 HD1BTYR B 17 2813 1314 2690 -251 -788 -457 H ATOM 2520 HD2ATYR B 17 27.198 50.905 53.419 0.05 15.82 H ANISOU 2520 HD2ATYR B 17 2513 1049 2448 -184 -566 -354 H ATOM 2521 HD2BTYR B 17 29.046 50.578 59.489 0.05 19.21 H ANISOU 2521 HD2BTYR B 17 3114 1636 2551 -93 -886 -577 H ATOM 2522 HE1ATYR B 17 25.636 54.145 56.286 0.05 18.00 H ANISOU 2522 HE1ATYR B 17 3097 1195 2548 -44 -677 -616 H ATOM 2523 HE1BTYR B 17 30.130 54.257 56.894 0.05 19.77 H ANISOU 2523 HE1BTYR B 17 3111 1423 2978 -344 -953 -555 H ATOM 2524 HE2ATYR B 17 27.472 53.078 52.890 0.05 16.97 H ANISOU 2524 HE2ATYR B 17 2729 1048 2672 -251 -650 -411 H ATOM 2525 HE2BTYR B 17 30.045 52.406 60.460 0.05 21.08 H ANISOU 2525 HE2BTYR B 17 3433 1760 2816 -174 -1065 -707 H ATOM 2526 HH ATYR B 17 27.343 55.164 53.571 0.05 18.29 H ANISOU 2526 HH ATYR B 17 3031 1077 2841 -249 -738 -523 H ATOM 2527 HH BTYR B 17 30.690 54.575 60.219 0.05 22.35 H ANISOU 2527 HH BTYR B 17 3600 1759 3131 -317 -1197 -762 H ATOM 2528 N AASP B 18 28.003 46.703 56.392 0.03 15.61 N ANISOU 2528 N AASP B 18 2422 1298 2211 -41 -560 -291 N ATOM 2529 N BASP B 18 28.181 47.079 56.330 0.02 15.71 N ANISOU 2529 N BASP B 18 2429 1306 2235 -53 -574 -294 N ATOM 2530 CA AASP B 18 27.802 45.320 56.791 0.03 15.35 C ANISOU 2530 CA AASP B 18 2365 1324 2142 5 -522 -241 C ATOM 2531 CA BASP B 18 27.984 45.640 56.734 0.02 15.43 C ANISOU 2531 CA BASP B 18 2373 1331 2158 -2 -533 -246 C ATOM 2532 C AASP B 18 26.910 44.599 55.786 0.03 14.47 C ANISOU 2532 C AASP B 18 2239 1206 2054 28 -428 -198 C ATOM 2533 C BASP B 18 27.104 44.678 55.812 0.02 14.54 C ANISOU 2533 C BASP B 18 2239 1217 2068 23 -437 -197 C ATOM 2534 O AASP B 18 26.069 43.747 56.139 0.03 14.28 O ANISOU 2534 O AASP B 18 2231 1209 1988 74 -383 -173 O ATOM 2535 O BASP B 18 26.459 43.728 56.275 0.02 14.39 O ANISOU 2535 O BASP B 18 2228 1231 2010 67 -400 -165 O ATOM 2536 CB AASP B 18 27.237 45.248 58.220 0.03 15.91 C ANISOU 2536 CB AASP B 18 2496 1438 2110 58 -547 -265 C ATOM 2537 CB BASP B 18 27.356 45.628 58.136 0.02 15.92 C ANISOU 2537 CB BASP B 18 2507 1427 2114 53 -549 -278 C ATOM 2538 CG AASP B 18 28.327 45.254 59.285 0.03 16.89 C ANISOU 2538 CG AASP B 18 2625 1586 2205 38 -654 -299 C ATOM 2539 CG BASP B 18 26.145 46.545 58.211 0.02 15.93 C ANISOU 2539 CG BASP B 18 2581 1390 2083 75 -524 -332 C ATOM 2540 OD1AASP B 18 27.984 45.202 60.482 0.03 17.53 O ANISOU 2540 OD1AASP B 18 2773 1698 2191 80 -687 -337 O ATOM 2541 OD1BASP B 18 25.522 46.721 57.151 0.02 15.32 O ANISOU 2541 OD1BASP B 18 2490 1270 2063 59 -474 -322 O ATOM 2542 OD2AASP B 18 29.508 45.297 58.917 0.03 17.11 O ANISOU 2542 OD2AASP B 18 2590 1607 2305 -18 -706 -287 O ATOM 2543 OD2BASP B 18 25.822 47.115 59.294 0.02 16.63 O ANISOU 2543 OD2BASP B 18 2740 1491 2089 113 -556 -387 O ATOM 2544 H AASP B 18 28.823 46.896 56.221 0.05 15.92 H ANISOU 2544 H AASP B 18 2431 1331 2287 -79 -602 -291 H ATOM 2545 H BASP B 18 27.441 47.452 56.093 0.05 15.50 H ANISOU 2545 H BASP B 18 2436 1252 2201 -40 -544 -311 H ATOM 2546 HA AASP B 18 28.656 44.867 56.763 0.05 15.49 H ANISOU 2546 HA AASP B 18 2334 1361 2191 -14 -547 -216 H ATOM 2547 HA BASP B 18 28.865 45.252 56.805 0.05 15.67 H ANISOU 2547 HA BASP B 18 2359 1385 2208 -17 -565 -224 H ATOM 2548 HB2AASP B 18 26.680 46.016 58.396 0.05 15.94 H ANISOU 2548 HB2AASP B 18 2550 1425 2081 77 -531 -299 H ATOM 2549 HB2BASP B 18 27.047 44.737 58.338 0.05 15.69 H ANISOU 2549 HB2BASP B 18 2471 1429 2060 87 -508 -241 H ATOM 2550 HB3AASP B 18 26.710 44.444 58.320 0.05 15.72 H ANISOU 2550 HB3AASP B 18 2459 1446 2067 89 -513 -224 H ATOM 2551 HB3BASP B 18 28.011 45.910 58.789 0.05 16.53 H ANISOU 2551 HB3BASP B 18 2590 1522 2169 45 -614 -299 H ATOM 2552 N LEU B 19 27.099 44.952 54.522 0.05 14.06 N ANISOU 2552 N LEU B 19 2155 1117 2070 -8 -402 -188 N ATOM 2553 CA LEU B 19 26.371 44.291 53.468 0.05 13.37 C ANISOU 2553 CA LEU B 19 2049 1022 2008 5 -328 -154 C ATOM 2554 C LEU B 19 27.257 44.407 52.232 0.05 13.24 C ANISOU 2554 C LEU B 19 1979 990 2061 -36 -321 -133 C ATOM 2555 O LEU B 19 28.249 45.114 52.228 0.05 13.68 O ANISOU 2555 O LEU B 19 2009 1041 2149 -76 -368 -138 O ATOM 2556 CB LEU B 19 24.982 44.931 53.262 0.05 13.06 C ANISOU 2556 CB LEU B 19 2057 958 1948 25 -288 -174 C ATOM 2557 CG LEU B 19 24.919 46.449 52.998 0.05 13.20 C ANISOU 2557 CG LEU B 19 2107 928 1979 4 -305 -214 C ATOM 2558 CD1 LEU B 19 25.450 46.823 51.620 0.05 13.02 C ANISOU 2558 CD1 LEU B 19 2051 871 2026 -44 -301 -198 C ATOM 2559 CD2 LEU B 19 23.438 46.985 53.112 0.05 13.01 C ANISOU 2559 CD2 LEU B 19 2124 898 1922 47 -260 -226 C ATOM 2560 H ALEU B 19 27.646 45.557 54.255 0.05 14.23 H ANISOU 2560 H ALEU B 19 2166 1118 2124 -41 -428 -200 H ATOM 2561 H BLEU B 19 27.577 45.589 54.202 0.05 14.21 H ANISOU 2561 H BLEU B 19 2168 1111 2118 -40 -425 -203 H ATOM 2562 HA LEU B 19 26.263 43.349 53.680 0.05 13.30 H ANISOU 2562 HA LEU B 19 2028 1038 1987 29 -312 -127 H ATOM 2563 HB2 LEU B 19 24.573 44.506 52.496 0.05 12.67 H ANISOU 2563 HB2 LEU B 19 1990 904 1918 28 -248 -151 H ATOM 2564 HB3 LEU B 19 24.446 44.755 54.048 0.05 13.22 H ANISOU 2564 HB3 LEU B 19 2104 997 1922 55 -285 -181 H ATOM 2565 HG LEU B 19 25.436 46.909 53.672 0.05 13.66 H ANISOU 2565 HG LEU B 19 2187 983 2021 -2 -350 -243 H ATOM 2566 HD11 LEU B 19 25.397 47.785 51.514 0.05 13.26 H ANISOU 2566 HD11 LEU B 19 2107 866 2065 -57 -322 -222 H ATOM 2567 HD12 LEU B 19 26.363 46.537 51.511 0.05 13.16 H ANISOU 2567 HD12 LEU B 19 2033 901 2067 -67 -319 -182 H ATOM 2568 HD13 LEU B 19 24.897 46.394 50.953 0.05 12.62 H ANISOU 2568 HD13 LEU B 19 1991 821 1984 -35 -260 -179 H ATOM 2569 HD21 LEU B 19 23.316 47.712 52.483 0.05 12.63 H ANISOU 2569 HD21 LEU B 19 2055 860 1885 54 -222 -198 H ATOM 2570 HD22 LEU B 19 22.831 46.256 52.905 0.05 13.30 H ANISOU 2570 HD22 LEU B 19 2188 955 1912 76 -267 -241 H ATOM 2571 HD23 LEU B 19 23.289 47.287 54.017 0.05 13.08 H ANISOU 2571 HD23 LEU B 19 2151 872 1948 38 -267 -247 H ATOM 2572 N ASP B 20 26.913 43.701 51.173 0.05 12.74 N ANISOU 2572 N ASP B 20 1898 923 2021 -26 -264 -107 N ATOM 2573 CA ASP B 20 27.673 43.750 49.934 0.05 12.71 C ANISOU 2573 CA ASP B 20 1846 917 2068 -52 -245 -83 C ATOM 2574 C ASP B 20 26.804 44.377 48.870 0.05 12.37 C ANISOU 2574 C ASP B 20 1829 841 2032 -63 -212 -90 C ATOM 2575 O ASP B 20 25.702 43.909 48.562 0.05 11.98 O ANISOU 2575 O ASP B 20 1809 783 1961 -38 -180 -96 O ATOM 2576 CB ASP B 20 28.121 42.335 49.563 0.05 12.62 C ANISOU 2576 CB ASP B 20 1799 930 2065 -19 -210 -51 C ATOM 2577 CG ASP B 20 29.108 41.836 50.549 0.05 13.08 C ANISOU 2577 CG ASP B 20 1825 1022 2121 -6 -249 -36 C ATOM 2578 OD1 ASP B 20 30.001 42.552 50.970 0.05 13.56 O ANISOU 2578 OD1 ASP B 20 1856 1098 2199 -36 -299 -37 O ATOM 2579 OD2 ASP B 20 29.056 40.613 50.941 0.05 13.05 O ANISOU 2579 OD2 ASP B 20 1824 1031 2105 37 -233 -16 O ATOM 2580 H ASP B 20 26.226 43.198 51.138 0.05 12.49 H ANISOU 2580 H ASP B 20 1881 890 1973 -5 -236 -103 H ATOM 2581 HA ASP B 20 28.483 44.262 50.043 0.05 13.08 H ANISOU 2581 HA ASP B 20 1866 967 2135 -79 -276 -80 H ATOM 2582 HB2 ASP B 20 27.342 41.777 49.548 0.05 12.33 H ANISOU 2582 HB2 ASP B 20 1789 885 2011 3 -186 -54 H ATOM 2583 HB3 ASP B 20 28.550 42.361 48.703 0.05 12.63 H ANISOU 2583 HB3 ASP B 20 1773 935 2093 -28 -189 -38 H ATOM 2584 N GLY B 21 27.281 45.501 48.305 0.05 12.63 N ANISOU 2584 N GLY B 21 1847 852 2099 -105 -225 -85 N ATOM 2585 CA GLY B 21 26.447 46.361 47.468 0.05 12.46 C ANISOU 2585 CA GLY B 21 1856 795 2083 -116 -206 -88 C ATOM 2586 C GLY B 21 27.059 46.683 46.131 0.05 12.60 C ANISOU 2586 C GLY B 21 1839 815 2135 -143 -178 -48 C ATOM 2587 O GLY B 21 28.245 46.553 45.878 0.05 12.96 O ANISOU 2587 O GLY B 21 1829 885 2209 -164 -178 -19 O ATOM 2588 H GLY B 21 28.087 45.773 48.372 0.05 12.95 H ANISOU 2588 H GLY B 21 1858 900 2163 -128 -246 -74 H ATOM 2589 HA2 GLY B 21 25.589 45.954 47.331 0.05 12.12 H ANISOU 2589 HA2 GLY B 21 1836 753 2018 -90 -182 -94 H ATOM 2590 HA3 GLY B 21 26.313 47.207 47.919 0.05 12.68 H ANISOU 2590 HA3 GLY B 21 1909 795 2113 -130 -236 -107 H ATOM 2591 N SER B 22 26.178 47.180 45.279 0.05 12.41 N ANISOU 2591 N SER B 22 1845 768 2104 -140 -155 -44 N ATOM 2592 CA SER B 22 26.616 47.791 44.027 0.05 12.66 C ANISOU 2592 CA SER B 22 1856 798 2156 -164 -128 -1 C ATOM 2593 C SER B 22 25.807 49.078 43.771 0.05 12.81 C ANISOU 2593 C SER B 22 1919 761 2187 -180 -146 -1 C ATOM 2594 O SER B 22 24.609 49.067 43.512 0.05 12.50 O ANISOU 2594 O SER B 22 1918 710 2120 -148 -136 -17 O ATOM 2595 CB SER B 22 26.500 46.825 42.873 0.05 12.38 C ANISOU 2595 CB SER B 22 1817 799 2087 -128 -75 13 C ATOM 2596 OG SER B 22 27.180 47.395 41.784 0.05 12.69 O ANISOU 2596 OG SER B 22 1848 846 2128 -142 -46 57 O ATOM 2597 H SER B 22 25.340 47.165 45.396 0.05 12.20 H ANISOU 2597 H SER B 22 1848 728 2058 -122 -153 -61 H ATOM 2598 HA SER B 22 27.545 48.037 44.107 0.05 13.02 H ANISOU 2598 HA SER B 22 1864 853 2230 -190 -134 22 H ATOM 2599 HB2 SER B 22 26.965 46.019 43.129 0.05 12.40 H ANISOU 2599 HB2 SER B 22 1793 831 2089 -117 -63 15 H ATOM 2600 HB3 SER B 22 25.575 46.640 42.658 0.05 12.06 H ANISOU 2600 HB3 SER B 22 1807 752 2023 -106 -74 -9 H ATOM 2601 HG SER B 22 27.003 48.217 41.746 0.05 12.90 H ANISOU 2601 HG SER B 22 1879 846 2176 -167 -62 69 H ATOM 2602 N ARG B 23 26.523 50.173 43.886 0.05 13.39 N ANISOU 2602 N ARG B 23 1982 799 2308 -229 -175 19 N ATOM 2603 CA ARG B 23 25.920 51.503 43.766 0.05 13.71 C ANISOU 2603 CA ARG B 23 2068 769 2372 -245 -198 19 C ATOM 2604 C ARG B 23 25.600 51.831 42.326 0.05 13.78 C ANISOU 2604 C ARG B 23 2078 781 2378 -243 -157 75 C ATOM 2605 O ARG B 23 26.334 51.537 41.411 0.05 13.97 O ANISOU 2605 O ARG B 23 2058 846 2404 -258 -121 126 O ATOM 2606 CB ARG B 23 26.892 52.531 44.321 0.05 14.46 C ANISOU 2606 CB ARG B 23 2155 812 2528 -306 -253 21 C ATOM 2607 CG ARG B 23 27.003 52.572 45.822 0.05 14.51 C ANISOU 2607 CG ARG B 23 2194 799 2521 -296 -308 -50 C ATOM 2608 CD ARG B 23 27.964 53.687 46.259 0.05 15.39 C ANISOU 2608 CD ARG B 23 2309 850 2689 -359 -380 -64 C ATOM 2609 NE ARG B 23 28.160 53.752 47.706 0.05 15.51 N ANISOU 2609 NE ARG B 23 2368 854 2669 -336 -434 -142 N ATOM 2610 CZ ARG B 23 27.669 54.707 48.501 0.05 16.05 C ANISOU 2610 CZ ARG B 23 2508 848 2741 -334 -488 -200 C ATOM 2611 NH1 ARG B 23 26.934 55.719 48.025 0.05 16.55 N ANISOU 2611 NH1 ARG B 23 2609 823 2854 -358 -500 -190 N ATOM 2612 NH2 ARG B 23 27.913 54.650 49.798 0.05 16.19 N ANISOU 2612 NH2 ARG B 23 2564 878 2708 -303 -529 -269 N ATOM 2613 H ARG B 23 27.359 50.190 44.044 0.05 13.68 H ANISOU 2613 H ARG B 23 1983 845 2368 -255 -185 33 H ATOM 2614 HA ARG B 23 25.100 51.538 44.281 0.05 13.48 H ANISOU 2614 HA ARG B 23 2077 724 2321 -214 -208 -17 H ATOM 2615 HB2 ARG B 23 27.776 52.341 43.972 0.05 14.70 H ANISOU 2615 HB2 ARG B 23 2135 870 2581 -336 -247 54 H ATOM 2616 HB3 ARG B 23 26.604 53.407 44.021 0.05 14.78 H ANISOU 2616 HB3 ARG B 23 2220 802 2592 -321 -262 35 H ATOM 2617 HG2 ARG B 23 26.134 52.790 46.195 0.05 14.34 H ANISOU 2617 HG2 ARG B 23 2220 753 2475 -261 -308 -80 H ATOM 2618 HG3 ARG B 23 27.309 51.714 46.161 0.05 14.23 H ANISOU 2618 HG3 ARG B 23 2135 813 2461 -279 -301 -59 H ATOM 2619 HD2 ARG B 23 28.830 53.557 45.846 0.05 15.66 H ANISOU 2619 HD2 ARG B 23 2287 908 2754 -397 -385 -31 H ATOM 2620 HD3 ARG B 23 27.610 54.534 45.958 0.05 15.72 H ANISOU 2620 HD3 ARG B 23 2378 833 2759 -374 -388 -55 H ATOM 2621 HE ARG B 23 28.765 53.243 48.035 0.05 15.12 H ANISOU 2621 HE ARG B 23 2311 853 2582 -304 -419 -154 H ATOM 2622 HH11 ARG B 23 26.761 55.776 47.186 0.05 16.51 H ANISOU 2622 HH11 ARG B 23 2580 814 2878 -376 -472 -140 H ATOM 2623 HH12 ARG B 23 26.638 56.319 48.564 0.05 16.96 H ANISOU 2623 HH12 ARG B 23 2713 822 2910 -352 -536 -233 H ATOM 2624 HH21 ARG B 23 28.390 54.015 50.121 0.05 15.92 H ANISOU 2624 HH21 ARG B 23 2506 899 2642 -288 -521 -270 H ATOM 2625 HH22 ARG B 23 27.608 55.264 50.320 0.05 16.61 H ANISOU 2625 HH22 ARG B 23 2669 884 2758 -297 -563 -313 H ATOM 2626 N LEU B 24 24.476 52.526 42.168 0.05 13.75 N ANISOU 2626 N LEU B 24 2126 732 2367 -218 -164 66 N ATOM 2627 CA LEU B 24 24.063 53.031 40.867 0.05 13.96 C ANISOU 2627 CA LEU B 24 2163 752 2387 -212 -138 121 C ATOM 2628 C LEU B 24 25.046 54.041 40.276 0.05 14.75 C ANISOU 2628 C LEU B 24 2243 818 2543 -272 -139 191 C ATOM 2629 O LEU B 24 25.380 53.988 39.110 0.05 15.00 O ANISOU 2629 O LEU B 24 2250 887 2562 -279 -97 256 O ATOM 2630 CB LEU B 24 22.682 53.661 41.029 0.05 13.89 C ANISOU 2630 CB LEU B 24 2211 697 2371 -170 -156 96 C ATOM 2631 CG LEU B 24 22.154 54.367 39.791 0.05 14.28 C ANISOU 2631 CG LEU B 24 2280 722 2423 -161 -144 155 C ATOM 2632 CD1 LEU B 24 21.988 53.404 38.643 0.05 13.97 C ANISOU 2632 CD1 LEU B 24 2224 760 2324 -132 -107 181 C ATOM 2633 CD2 LEU B 24 20.848 55.079 40.131 0.05 14.48 C ANISOU 2633 CD2 LEU B 24 2359 678 2465 -121 -173 130 C ATOM 2634 H LEU B 24 23.935 52.702 42.806 0.05 13.66 H ANISOU 2634 H LEU B 24 2143 697 2350 -200 -184 29 H ATOM 2635 HA LEU B 24 23.992 52.286 40.246 0.05 13.70 H ANISOU 2635 HA LEU B 24 2114 772 2318 -193 -107 133 H ATOM 2636 HB2 LEU B 24 22.047 52.960 41.233 0.05 13.45 H ANISOU 2636 HB2 LEU B 24 2154 676 2279 -136 -145 69 H ATOM 2637 HB3 LEU B 24 22.708 54.285 41.763 0.05 14.09 H ANISOU 2637 HB3 LEU B 24 2258 675 2422 -177 -186 66 H ATOM 2638 HG LEU B 24 22.796 55.041 39.523 0.05 14.74 H ANISOU 2638 HG LEU B 24 2331 756 2515 -199 -145 196 H ATOM 2639 HD11 LEU B 24 21.349 52.729 38.910 0.05 13.53 H ANISOU 2639 HD11 LEU B 24 2167 732 2241 -105 -107 141 H ATOM 2640 HD12 LEU B 24 21.657 53.885 37.870 0.05 14.23 H ANISOU 2640 HD12 LEU B 24 2275 779 2353 -119 -107 215 H ATOM 2641 HD13 LEU B 24 22.846 53.007 38.446 0.05 14.05 H ANISOU 2641 HD13 LEU B 24 2207 804 2329 -155 -86 206 H ATOM 2642 HD21 LEU B 24 20.578 55.618 39.370 0.05 14.81 H ANISOU 2642 HD21 LEU B 24 2412 701 2513 -117 -169 175 H ATOM 2643 HD22 LEU B 24 20.171 54.408 40.317 0.05 14.08 H ANISOU 2643 HD22 LEU B 24 2310 657 2383 -82 -168 97 H ATOM 2644 HD23 LEU B 24 20.977 55.649 40.906 0.05 14.76 H ANISOU 2644 HD23 LEU B 24 2412 660 2534 -137 -199 104 H ATOM 2645 N LEU B 25 25.518 54.934 41.139 0.05 15.25 N ANISOU 2645 N LEU B 25 2317 810 2667 -316 -188 174 N ATOM 2646 CA LEU B 25 26.398 56.043 40.745 0.05 16.18 C ANISOU 2646 CA LEU B 25 2422 868 2858 -383 -203 239 C ATOM 2647 C LEU B 25 27.788 55.733 41.207 0.05 16.59 C ANISOU 2647 C LEU B 25 2405 943 2956 -447 -218 255 C ATOM 2648 O LEU B 25 27.962 55.068 42.221 0.05 16.26 O ANISOU 2648 O LEU B 25 2347 931 2900 -440 -242 196 O ATOM 2649 CB LEU B 25 25.960 57.346 41.411 0.05 16.71 C ANISOU 2649 CB LEU B 25 2558 816 2975 -392 -261 208 C ATOM 2650 CG LEU B 25 24.518 57.696 41.120 0.05 16.44 C ANISOU 2650 CG LEU B 25 2586 756 2903 -320 -251 192 C ATOM 2651 CD1 LEU B 25 24.147 58.907 41.959 0.05 17.02 C ANISOU 2651 CD1 LEU B 25 2730 713 3023 -314 -308 142 C ATOM 2652 CD2 LEU B 25 24.266 57.980 39.610 0.05 16.67 C ANISOU 2652 CD2 LEU B 25 2611 802 2923 -313 -207 286 C ATOM 2653 H LEU B 25 25.338 54.926 41.975 0.05 15.13 H ANISOU 2653 H LEU B 25 2319 778 2654 -309 -216 125 H ATOM 2654 HA LEU B 25 26.370 56.138 39.784 0.05 16.29 H ANISOU 2654 HA LEU B 25 2428 903 2858 -377 -167 295 H ATOM 2655 HB2 LEU B 25 26.074 57.271 42.371 0.05 16.69 H ANISOU 2655 HB2 LEU B 25 2567 796 2979 -397 -298 150 H ATOM 2656 HB3 LEU B 25 26.515 58.067 41.068 0.05 17.39 H ANISOU 2656 HB3 LEU B 25 2636 856 3113 -440 -270 259 H ATOM 2657 HG LEU B 25 23.946 56.960 41.394 0.05 15.81 H ANISOU 2657 HG LEU B 25 2507 727 2773 -276 -237 152 H ATOM 2658 HD11 LEU B 25 23.194 59.061 41.866 0.05 16.76 H ANISOU 2658 HD11 LEU B 25 2731 679 2961 -257 -300 119 H ATOM 2659 HD12 LEU B 25 24.367 58.750 42.889 0.05 17.06 H ANISOU 2659 HD12 LEU B 25 2739 707 3036 -330 -340 90 H ATOM 2660 HD13 LEU B 25 24.646 59.675 41.636 0.05 17.68 H ANISOU 2660 HD13 LEU B 25 2822 736 3158 -352 -320 188 H ATOM 2661 HD21 LEU B 25 23.311 58.009 39.442 0.05 16.50 H ANISOU 2661 HD21 LEU B 25 2622 771 2875 -263 -205 274 H ATOM 2662 HD22 LEU B 25 24.664 58.845 39.399 0.05 17.37 H ANISOU 2662 HD22 LEU B 25 2701 832 3064 -356 -220 332 H ATOM 2663 HD23 LEU B 25 24.677 57.292 39.066 0.05 16.41 H ANISOU 2663 HD23 LEU B 25 2537 842 2855 -313 -171 312 H ATOM 2664 N PRO B 26 28.791 56.154 40.444 0.05 17.39 N ANISOU 2664 N PRO B 26 2457 1039 3112 -509 -200 344 N ATOM 2665 CA PRO B 26 28.737 56.954 39.219 0.05 17.85 C ANISOU 2665 CA PRO B 26 2536 1069 3178 -512 -166 427 C ATOM 2666 C PRO B 26 28.253 56.206 37.993 0.05 17.45 C ANISOU 2666 C PRO B 26 2464 1122 3045 -458 -86 472 C ATOM 2667 O PRO B 26 28.520 55.042 37.846 0.05 16.97 O ANISOU 2667 O PRO B 26 2362 1151 2935 -429 -52 450 O ATOM 2668 CB PRO B 26 30.211 57.344 38.996 0.05 19.05 C ANISOU 2668 CB PRO B 26 2634 1175 3427 -609 -180 512 C ATOM 2669 CG PRO B 26 31.015 56.377 39.801 0.05 19.04 C ANISOU 2669 CG PRO B 26 2551 1241 3441 -639 -184 497 C ATOM 2670 CD PRO B 26 30.156 56.024 40.973 0.05 18.07 C ANISOU 2670 CD PRO B 26 2462 1142 3264 -583 -218 380 C ATOM 2671 HA PRO B 26 28.186 57.734 39.355 0.05 17.83 H ANISOU 2671 HA PRO B 26 2591 1007 3176 -492 -189 404 H ATOM 2672 HB2 PRO B 26 30.424 57.236 38.057 0.05 19.38 H ANISOU 2672 HB2 PRO B 26 2658 1242 3464 -613 -134 589 H ATOM 2673 HB3 PRO B 26 30.367 58.257 39.282 0.05 19.47 H ANISOU 2673 HB3 PRO B 26 2725 1140 3535 -640 -232 495 H ATOM 2674 HG2 PRO B 26 31.221 55.600 39.261 0.05 19.00 H ANISOU 2674 HG2 PRO B 26 2499 1313 3406 -624 -126 544 H ATOM 2675 HG3 PRO B 26 31.827 56.819 40.097 0.05 19.76 H ANISOU 2675 HG3 PRO B 26 2615 1287 3606 -706 -223 518 H ATOM 2676 HD2 PRO B 26 30.330 55.117 41.264 0.05 17.75 H ANISOU 2676 HD2 PRO B 26 2377 1177 3192 -562 -188 379 H ATOM 2677 HD3 PRO B 26 30.285 56.660 41.691 0.05 18.33 H ANISOU 2677 HD3 PRO B 26 2508 1121 3333 -613 -278 337 H ATOM 2678 N TRP B 27 27.590 56.897 37.089 0.05 17.75 N ANISOU 2678 N TRP B 27 2538 1141 3065 -441 -63 530 N ATOM 2679 CA TRP B 27 27.209 56.369 35.785 0.05 17.59 C ANISOU 2679 CA TRP B 27 2519 1206 2959 -387 1 575 C ATOM 2680 C TRP B 27 27.282 57.545 34.830 0.05 18.60 C ANISOU 2680 C TRP B 27 2654 1293 3119 -421 18 687 C ATOM 2681 O TRP B 27 26.400 58.387 34.841 0.05 18.75 O ANISOU 2681 O TRP B 27 2735 1238 3152 -405 -13 694 O ATOM 2682 CB TRP B 27 25.804 55.779 35.873 0.05 16.78 C ANISOU 2682 CB TRP B 27 2478 1109 2789 -313 -15 504 C ATOM 2683 CG TRP B 27 25.337 55.028 34.641 0.05 16.61 C ANISOU 2683 CG TRP B 27 2462 1179 2669 -256 34 526 C ATOM 2684 CD1 TRP B 27 25.593 55.325 33.337 0.05 17.28 C ANISOU 2684 CD1 TRP B 27 2551 1299 2716 -249 74 617 C ATOM 2685 CD2 TRP B 27 24.544 53.841 34.635 0.05 15.83 C ANISOU 2685 CD2 TRP B 27 2374 1144 2497 -199 40 454 C ATOM 2686 NE1 TRP B 27 24.984 54.394 32.506 0.05 16.98 N ANISOU 2686 NE1 TRP B 27 2529 1348 2576 -187 102 597 N ATOM 2687 CE2 TRP B 27 24.329 53.489 33.293 0.05 16.10 C ANISOU 2687 CE2 TRP B 27 2420 1248 2448 -161 78 495 C ATOM 2688 CE3 TRP B 27 23.966 53.073 35.644 0.05 15.04 C ANISOU 2688 CE3 TRP B 27 2276 1046 2393 -180 14 361 C ATOM 2689 CZ2 TRP B 27 23.603 52.340 32.939 0.05 15.61 C ANISOU 2689 CZ2 TRP B 27 2373 1250 2306 -108 83 435 C ATOM 2690 CZ3 TRP B 27 23.214 51.970 35.299 0.05 14.55 C ANISOU 2690 CZ3 TRP B 27 2223 1044 2260 -131 26 315 C ATOM 2691 CH2 TRP B 27 23.019 51.624 33.954 0.05 14.84 C ANISOU 2691 CH2 TRP B 27 2274 1141 2222 -98 54 347 C ATOM 2692 H TRP B 27 27.337 57.711 37.214 0.05 18.14 H ANISOU 2692 H TRP B 27 2617 1121 3153 -459 -88 547 H ATOM 2693 HA TRP B 27 27.833 55.685 35.498 0.05 17.53 H ANISOU 2693 HA TRP B 27 2468 1269 2923 -382 38 584 H ATOM 2694 HB2 TRP B 27 25.793 55.146 36.606 0.05 16.24 H ANISOU 2694 HB2 TRP B 27 2407 1050 2715 -301 -32 437 H ATOM 2695 HB3 TRP B 27 25.164 56.480 36.046 0.05 16.95 H ANISOU 2695 HB3 TRP B 27 2539 1067 2835 -310 -44 506 H ATOM 2696 HD1 TRP B 27 26.103 56.045 33.043 0.05 17.93 H ANISOU 2696 HD1 TRP B 27 2627 1351 2836 -282 82 686 H ATOM 2697 HE1 TRP B 27 25.020 54.385 31.650 0.05 17.36 H ANISOU 2697 HE1 TRP B 27 2583 1434 2577 -170 127 642 H ATOM 2698 HE3 TRP B 27 24.076 53.294 36.538 0.05 14.91 H ANISOU 2698 HE3 TRP B 27 2255 990 2421 -200 -11 333 H ATOM 2699 HZ2 TRP B 27 23.464 52.135 32.043 0.05 15.87 H ANISOU 2699 HZ2 TRP B 27 2421 1329 2280 -82 101 457 H ATOM 2700 HZ3 TRP B 27 22.832 51.456 35.976 0.05 14.08 H ANISOU 2700 HZ3 TRP B 27 2163 984 2202 -120 11 261 H ATOM 2701 HH2 TRP B 27 22.522 50.871 33.747 0.05 14.57 H ANISOU 2701 HH2 TRP B 27 2250 1141 2144 -69 54 309 H ATOM 2702 N GLU B 28 28.300 57.598 33.983 0.05 19.35 N ANISOU 2702 N GLU B 28 2686 1440 3227 -460 72 781 N ATOM 2703 CA GLU B 28 28.425 58.775 33.120 0.05 20.47 C ANISOU 2703 CA GLU B 28 2829 1543 3405 -499 94 906 C ATOM 2704 C GLU B 28 27.242 58.904 32.173 0.05 20.39 C ANISOU 2704 C GLU B 28 2889 1544 3316 -431 106 931 C ATOM 2705 O GLU B 28 26.811 57.923 31.582 0.05 19.86 O ANISOU 2705 O GLU B 28 2832 1572 3141 -362 140 900 O ATOM 2706 CB GLU B 28 29.704 58.760 32.290 0.05 21.29 C ANISOU 2706 CB GLU B 28 2849 1739 3500 -529 173 1013 C ATOM 2707 CG GLU B 28 29.903 60.025 31.442 0.05 22.60 C ANISOU 2707 CG GLU B 28 3006 1867 3715 -580 201 1159 C ATOM 2708 CD GLU B 28 30.900 60.971 32.068 0.05 23.52 C ANISOU 2708 CD GLU B 28 3024 1978 3935 -675 212 1229 C ATOM 2709 OE1 GLU B 28 31.433 61.848 31.347 0.05 24.10 O ANISOU 2709 OE1 GLU B 28 3018 2165 3975 -674 297 1310 O ATOM 2710 OE2 GLU B 28 31.170 60.855 33.277 0.05 23.63 O ANISOU 2710 OE2 GLU B 28 3040 1880 4058 -744 132 1186 O ATOM 2711 H GLU B 28 28.919 57.013 33.897 0.05 19.32 H ANISOU 2711 H GLU B 28 2635 1491 3213 -465 97 781 H ATOM 2712 HA GLU B 28 28.447 59.562 33.684 0.05 20.86 H ANISOU 2712 HA GLU B 28 2889 1502 3536 -548 50 913 H ATOM 2713 HB2 GLU B 28 30.461 58.651 32.886 0.05 21.36 H ANISOU 2713 HB2 GLU B 28 2805 1749 3561 -570 163 998 H ATOM 2714 HB3 GLU B 28 29.662 58.003 31.684 0.05 20.98 H ANISOU 2714 HB3 GLU B 28 2810 1788 3376 -473 217 1004 H ATOM 2715 HG2 GLU B 28 30.215 59.772 30.561 0.05 22.83 H ANISOU 2715 HG2 GLU B 28 3039 1966 3669 -540 255 1212 H ATOM 2716 HG3 GLU B 28 29.072 60.512 31.367 0.05 22.72 H ANISOU 2716 HG3 GLU B 28 3072 1788 3774 -594 153 1156 H ATOM 2717 N GLY B 29 26.747 60.132 32.021 0.05 21.04 N ANISOU 2717 N GLY B 29 3019 1522 3454 -450 73 985 N ATOM 2718 CA GLY B 29 25.605 60.410 31.162 0.05 21.21 C ANISOU 2718 CA GLY B 29 3100 1550 3410 -388 81 1030 C ATOM 2719 C GLY B 29 24.258 60.296 31.854 0.05 20.39 C ANISOU 2719 C GLY B 29 3061 1407 3281 -320 25 930 C ATOM 2720 O GLY B 29 23.245 60.692 31.297 0.05 20.59 O ANISOU 2720 O GLY B 29 3132 1428 3262 -266 17 963 O ATOM 2721 H GLY B 29 27.061 60.830 32.412 0.05 21.44 H ANISOU 2721 H GLY B 29 3070 1495 3583 -498 43 996 H ATOM 2722 HA2 GLY B 29 25.692 61.316 30.818 0.05 22.03 H ANISOU 2722 HA2 GLY B 29 3215 1592 3564 -419 78 1110 H ATOM 2723 HA3 GLY B 29 25.612 59.805 30.405 0.05 21.22 H ANISOU 2723 HA3 GLY B 29 3087 1643 3332 -357 127 1058 H ATOM 2724 N LEU B 30 24.235 59.737 33.063 0.05 19.53 N ANISOU 2724 N LEU B 30 2949 1279 3193 -318 -12 811 N ATOM 2725 CA LEU B 30 22.988 59.511 33.799 0.05 18.79 C ANISOU 2725 CA LEU B 30 2902 1159 3078 -255 -56 714 C ATOM 2726 C LEU B 30 22.735 60.602 34.833 0.05 19.09 C ANISOU 2726 C LEU B 30 2980 1059 3215 -277 -114 676 C ATOM 2727 O LEU B 30 23.317 60.593 35.911 0.05 19.15 O ANISOU 2727 O LEU B 30 2969 1023 3284 -333 -137 637 O ATOM 2728 CB LEU B 30 22.994 58.139 34.484 0.05 17.69 C ANISOU 2728 CB LEU B 30 2738 1101 2884 -227 -52 609 C ATOM 2729 CG LEU B 30 21.818 57.796 35.400 0.05 16.99 C ANISOU 2729 CG LEU B 30 2683 983 2789 -175 -94 509 C ATOM 2730 CD1 LEU B 30 20.531 57.778 34.595 0.05 16.96 C ANISOU 2730 CD1 LEU B 30 2705 1016 2724 -108 -95 529 C ATOM 2731 CD2 LEU B 30 22.098 56.463 36.123 0.05 16.12 C ANISOU 2731 CD2 LEU B 30 2547 923 2656 -170 -95 417 C ATOM 2732 H LEU B 30 24.935 59.480 33.490 0.05 19.42 H ANISOU 2732 H LEU B 30 2902 1270 3207 -353 -11 787 H ATOM 2733 HA LEU B 30 22.242 59.539 33.181 0.05 18.89 H ANISOU 2733 HA LEU B 30 2940 1188 3051 -212 -54 743 H ATOM 2734 HB2 LEU B 30 23.026 57.458 33.797 0.05 17.55 H ANISOU 2734 HB2 LEU B 30 2709 1161 2800 -202 -22 625 H ATOM 2735 HB3 LEU B 30 23.795 58.070 35.022 0.05 17.64 H ANISOU 2735 HB3 LEU B 30 2701 1095 2908 -267 -49 593 H ATOM 2736 HG LEU B 30 21.731 58.482 36.080 0.05 17.27 H ANISOU 2736 HG LEU B 30 2743 937 2881 -185 -124 498 H ATOM 2737 HD11 LEU B 30 20.110 56.910 34.691 0.05 16.39 H ANISOU 2737 HD11 LEU B 30 2622 998 2607 -81 -94 478 H ATOM 2738 HD12 LEU B 30 19.932 58.462 34.936 0.05 17.18 H ANISOU 2738 HD12 LEU B 30 2762 980 2784 -88 -122 525 H ATOM 2739 HD13 LEU B 30 20.735 57.947 33.662 0.05 17.39 H ANISOU 2739 HD13 LEU B 30 2756 1100 2750 -113 -73 596 H ATOM 2740 HD21 LEU B 30 21.323 55.880 36.074 0.05 15.72 H ANISOU 2740 HD21 LEU B 30 2512 882 2580 -128 -108 373 H ATOM 2741 HD22 LEU B 30 22.860 56.031 35.711 0.05 15.98 H ANISOU 2741 HD22 LEU B 30 2500 971 2602 -176 -65 429 H ATOM 2742 HD23 LEU B 30 22.295 56.653 37.053 0.05 16.18 H ANISOU 2742 HD23 LEU B 30 2552 885 2712 -201 -114 391 H ATOM 2743 N ASN B 31 21.837 61.500 34.485 0.05 19.34 N ANISOU 2743 N ASN B 31 3065 1028 3253 -225 -141 681 N ATOM 2744 CA ASN B 31 21.380 62.489 35.437 0.05 19.76 C ANISOU 2744 CA ASN B 31 3171 946 3392 -226 -195 637 C ATOM 2745 C ASN B 31 20.139 62.062 36.205 0.05 19.11 C ANISOU 2745 C ASN B 31 3118 871 3272 -140 -215 544 C ATOM 2746 O ASN B 31 19.048 61.974 35.661 0.05 19.02 O ANISOU 2746 O ASN B 31 3118 896 3212 -71 -209 565 O ATOM 2747 CB ASN B 31 21.119 63.783 34.714 0.05 20.98 C ANISOU 2747 CB ASN B 31 3365 995 3611 -240 -206 742 C ATOM 2748 CG ASN B 31 21.221 65.013 35.630 0.05 21.74 C ANISOU 2748 CG ASN B 31 3524 919 3816 -256 -267 698 C ATOM 2749 OD1 ASN B 31 21.136 66.139 35.145 0.05 22.76 O ANISOU 2749 OD1 ASN B 31 3702 940 4004 -248 -285 767 O ATOM 2750 ND2 ASN B 31 21.400 64.808 36.934 0.05 21.36 N ANISOU 2750 ND2 ASN B 31 3481 844 3790 -274 -300 585 N ATOM 2751 H ASN B 31 21.490 61.577 33.705 0.05 19.32 H ANISOU 2751 H ASN B 31 3072 1061 3206 -184 -131 707 H ATOM 2752 HA ASN B 31 22.088 62.635 36.082 0.05 19.78 H ANISOU 2752 HA ASN B 31 3162 919 3435 -273 -210 602 H ATOM 2753 HB2 ASN B 31 21.763 63.886 33.996 0.05 21.39 H ANISOU 2753 HB2 ASN B 31 3388 1063 3677 -294 -182 813 H ATOM 2754 HB3 ASN B 31 20.225 63.762 34.343 0.05 21.00 H ANISOU 2754 HB3 ASN B 31 3385 1020 3575 -185 -198 771 H ATOM 2755 HD21 ASN B 31 22.161 64.553 37.235 0.05 21.30 H ANISOU 2755 HD21 ASN B 31 3442 854 3797 -328 -301 578 H ATOM 2756 HD22 ASN B 31 20.747 64.943 37.473 0.05 21.23 H ANISOU 2756 HD22 ASN B 31 3499 796 3772 -228 -321 522 H ATOM 2757 N THR B 32 20.336 61.861 37.482 0.05 18.76 N ANISOU 2757 N THR B 32 3081 796 3250 -148 -241 445 N ATOM 2758 CA THR B 32 19.263 61.466 38.358 0.05 18.18 C ANISOU 2758 CA THR B 32 3027 738 3143 -73 -253 352 C ATOM 2759 C THR B 32 19.091 62.387 39.587 0.05 18.69 C ANISOU 2759 C THR B 32 3152 683 3267 -58 -298 275 C ATOM 2760 O THR B 32 20.077 62.925 40.058 0.05 19.22 O ANISOU 2760 O THR B 32 3233 674 3394 -127 -329 265 O ATOM 2761 CB THR B 32 19.495 60.035 38.851 0.05 17.16 C ANISOU 2761 CB THR B 32 2848 722 2951 -79 -231 295 C ATOM 2762 OG1 THR B 32 18.416 59.737 39.687 0.05 16.75 O ANISOU 2762 OG1 THR B 32 2812 679 2874 -12 -239 214 O ATOM 2763 CG2 THR B 32 20.782 59.907 39.612 0.05 17.17 C ANISOU 2763 CG2 THR B 32 2823 717 2985 -160 -239 277 C ATOM 2764 H THR B 32 21.098 61.899 37.867 0.05 18.86 H ANISOU 2764 H THR B 32 3083 789 3293 -197 -251 432 H ATOM 2765 HA THR B 32 18.432 61.457 37.870 0.05 18.18 H ANISOU 2765 HA THR B 32 3033 758 3117 -22 -245 375 H ATOM 2766 HB THR B 32 19.518 59.432 38.093 0.05 16.90 H ANISOU 2766 HB THR B 32 2787 759 2876 -73 -205 333 H ATOM 2767 HG1 THR B 32 18.675 59.279 40.342 0.05 16.47 H ANISOU 2767 HG1 THR B 32 2768 657 2833 -26 -243 168 H ATOM 2768 HG21 THR B 32 20.823 60.534 40.342 0.05 17.46 H ANISOU 2768 HG21 THR B 32 2887 687 3058 -169 -271 232 H ATOM 2769 HG22 THR B 32 20.831 59.004 39.972 0.05 16.55 H ANISOU 2769 HG22 THR B 32 2712 712 2865 -157 -223 247 H ATOM 2770 HG23 THR B 32 21.540 60.038 39.021 0.05 17.55 H ANISOU 2770 HG23 THR B 32 2852 761 3054 -205 -229 340 H ATOM 2771 N PRO B 33 17.866 62.454 40.127 0.05 18.60 N ANISOU 2771 N PRO B 33 3170 662 3234 32 -302 219 N ATOM 2772 CA PRO B 33 17.661 63.230 41.365 0.05 19.17 C ANISOU 2772 CA PRO B 33 3308 629 3347 61 -339 133 C ATOM 2773 C PRO B 33 17.739 62.371 42.626 0.05 18.55 C ANISOU 2773 C PRO B 33 3220 606 3222 71 -340 30 C ATOM 2774 O PRO B 33 17.349 62.775 43.696 0.05 18.93 O ANISOU 2774 O PRO B 33 3321 601 3273 118 -361 -52 O ATOM 2775 CB PRO B 33 16.251 63.757 41.193 0.05 19.54 C ANISOU 2775 CB PRO B 33 3386 648 3391 168 -332 137 C ATOM 2776 CG PRO B 33 15.537 62.615 40.430 0.05 18.65 C ANISOU 2776 CG PRO B 33 3202 681 3204 202 -291 175 C ATOM 2777 CD PRO B 33 16.594 62.183 39.448 0.05 18.38 C ANISOU 2777 CD PRO B 33 3127 695 3162 113 -280 250 C ATOM 2778 HA PRO B 33 18.293 63.965 41.427 0.05 19.82 H ANISOU 2778 HA PRO B 33 3420 626 3486 15 -367 145 H ATOM 2779 HB2 PRO B 33 15.835 63.884 42.053 0.05 19.66 H ANISOU 2779 HB2 PRO B 33 3431 640 3401 215 -340 67 H ATOM 2780 HB3 PRO B 33 16.250 64.569 40.670 0.05 20.22 H ANISOU 2780 HB3 PRO B 33 3500 661 3521 167 -345 188 H ATOM 2781 HG2 PRO B 33 15.341 61.916 41.066 0.05 18.12 H ANISOU 2781 HG2 PRO B 33 3115 670 3101 218 -280 121 H ATOM 2782 HG3 PRO B 33 14.734 62.908 39.984 0.05 18.92 H ANISOU 2782 HG3 PRO B 33 3240 712 3239 257 -288 207 H ATOM 2783 HD2 PRO B 33 16.499 61.242 39.236 0.05 17.72 H ANISOU 2783 HD2 PRO B 33 3001 705 3028 112 -258 247 H ATOM 2784 HD3 PRO B 33 16.534 62.735 38.651 0.05 18.86 H ANISOU 2784 HD3 PRO B 33 3199 727 3242 113 -281 318 H ATOM 2785 N PHE B 34 18.194 61.112 42.462 0.05 17.62 N ANISOU 2785 N PHE B 34 3036 606 3054 33 -313 37 N ATOM 2786 CA PHE B 34 18.301 60.132 43.557 0.05 16.99 C ANISOU 2786 CA PHE B 34 2939 594 2924 41 -309 -42 C ATOM 2787 C PHE B 34 19.583 59.332 43.399 0.05 16.56 C ANISOU 2787 C PHE B 34 2832 596 2866 -44 -307 -21 C ATOM 2788 O PHE B 34 20.203 59.325 42.354 0.05 16.60 O ANISOU 2788 O PHE B 34 2802 615 2890 -95 -293 55 O ATOM 2789 CB PHE B 34 17.090 59.175 43.550 0.05 16.29 C ANISOU 2789 CB PHE B 34 2814 605 2770 114 -267 -51 C ATOM 2790 CG PHE B 34 16.896 58.429 42.226 0.05 15.77 C ANISOU 2790 CG PHE B 34 2691 620 2679 101 -237 24 C ATOM 2791 CD1 PHE B 34 17.628 57.289 41.926 0.05 15.12 C ANISOU 2791 CD1 PHE B 34 2559 618 2566 49 -219 37 C ATOM 2792 CD2 PHE B 34 16.028 58.898 41.274 0.05 16.06 C ANISOU 2792 CD2 PHE B 34 2730 651 2721 143 -231 79 C ATOM 2793 CE1 PHE B 34 17.450 56.651 40.726 0.05 14.80 C ANISOU 2793 CE1 PHE B 34 2481 647 2495 44 -196 93 C ATOM 2794 CE2 PHE B 34 15.878 58.296 40.071 0.05 15.75 C ANISOU 2794 CE2 PHE B 34 2651 685 2650 132 -213 141 C ATOM 2795 CZ PHE B 34 16.576 57.170 39.790 0.05 15.14 C ANISOU 2795 CZ PHE B 34 2532 684 2536 83 -196 144 C ATOM 2796 H PHE B 34 18.470 60.827 41.708 0.05 17.42 H ANISOU 2796 H PHE B 34 2978 619 3023 5 -297 90 H ATOM 2797 HA PHE B 34 18.322 60.579 44.417 0.05 17.39 H ANISOU 2797 HA PHE B 34 3032 592 2985 55 -334 -98 H ATOM 2798 HB2 PHE B 34 17.252 58.522 44.244 0.05 15.92 H ANISOU 2798 HB2 PHE B 34 2755 601 2694 111 -262 -93 H ATOM 2799 HB3 PHE B 34 16.272 59.655 43.743 0.05 16.61 H ANISOU 2799 HB3 PHE B 34 2881 617 2814 173 -266 -66 H ATOM 2800 HD1 PHE B 34 18.221 56.936 42.548 0.05 14.95 H ANISOU 2800 HD1 PHE B 34 2532 605 2542 23 -224 5 H ATOM 2801 HD2 PHE B 34 15.548 59.676 41.454 0.05 16.56 H ANISOU 2801 HD2 PHE B 34 2826 657 2807 183 -241 73 H ATOM 2802 HE1 PHE B 34 17.943 55.890 40.532 0.05 14.44 H ANISOU 2802 HE1 PHE B 34 2407 651 2428 16 -183 97 H ATOM 2803 HE2 PHE B 34 15.272 58.635 39.454 0.05 16.02 H ANISOU 2803 HE2 PHE B 34 2687 716 2684 163 -215 178 H ATOM 2804 HZ PHE B 34 16.450 56.743 38.976 0.05 15.00 H ANISOU 2804 HZ PHE B 34 2493 715 2491 81 -185 178 H ATOM 2805 N GLY B 35 19.958 58.646 44.463 0.05 16.25 N ANISOU 2805 N GLY B 35 2784 593 2796 -52 -318 -86 N ATOM 2806 CA GLY B 35 21.030 57.655 44.429 0.05 15.74 C ANISOU 2806 CA GLY B 35 2660 604 2717 -110 -309 -72 C ATOM 2807 C GLY B 35 20.393 56.294 44.624 0.05 14.86 C ANISOU 2807 C GLY B 35 2514 596 2536 -64 -270 -92 C ATOM 2808 O GLY B 35 19.232 56.173 44.980 0.05 14.71 O ANISOU 2808 O GLY B 35 2514 591 2485 4 -254 -121 O ATOM 2809 H GLY B 35 19.592 58.735 45.229 0.05 16.37 H ANISOU 2809 H GLY B 35 2830 593 2799 -19 -329 -138 H ATOM 2810 HA2 GLY B 35 21.505 57.664 43.590 0.05 15.77 H ANISOU 2810 HA2 GLY B 35 2635 617 2740 -147 -297 -15 H ATOM 2811 HA3 GLY B 35 21.655 57.808 45.153 0.05 16.01 H ANISOU 2811 HA3 GLY B 35 2703 614 2765 -139 -342 -107 H ATOM 2812 N GLY B 36 21.180 55.255 44.361 0.05 14.38 N ANISOU 2812 N GLY B 36 2399 606 2459 -101 -252 -71 N ATOM 2813 CA GLY B 36 20.666 53.895 44.494 0.05 13.64 C ANISOU 2813 CA GLY B 36 2274 599 2310 -66 -218 -84 C ATOM 2814 C GLY B 36 21.762 52.913 44.719 0.05 13.37 C ANISOU 2814 C GLY B 36 2197 616 2268 -104 -216 -84 C ATOM 2815 O GLY B 36 22.919 53.121 44.458 0.05 13.66 O ANISOU 2815 O GLY B 36 2209 644 2338 -157 -230 -58 O ATOM 2816 H GLY B 36 21.998 55.289 44.124 0.05 14.52 H ANISOU 2816 H GLY B 36 2397 623 2499 -144 -259 -49 H ATOM 2817 HA2 GLY B 36 20.085 53.898 45.260 0.05 13.63 H ANISOU 2817 HA2 GLY B 36 2294 595 2290 -30 -222 -122 H ATOM 2818 HA3 GLY B 36 20.167 53.633 43.707 0.05 13.43 H ANISOU 2818 HA3 GLY B 36 2233 598 2272 -53 -195 -53 H ATOM 2819 N ALA B 37 21.331 51.748 45.197 0.05 12.86 N ANISOU 2819 N ALA B 37 2116 609 2160 -72 -197 -107 N ATOM 2820 CA ALA B 37 22.247 50.621 45.353 0.05 12.57 C ANISOU 2820 CA ALA B 37 2038 626 2113 -93 -188 -102 C ATOM 2821 C ALA B 37 21.482 49.309 45.430 0.05 12.04 C ANISOU 2821 C ALA B 37 1957 612 2006 -55 -158 -108 C ATOM 2822 O ALA B 37 20.468 49.206 46.105 0.05 11.96 O ANISOU 2822 O ALA B 37 1966 604 1973 -18 -153 -132 O ATOM 2823 CB ALA B 37 23.129 50.750 46.599 0.05 12.89 C ANISOU 2823 CB ALA B 37 2081 657 2159 -113 -229 -135 C ATOM 2824 H ALA B 37 20.522 51.573 45.415 0.05 12.71 H ANISOU 2824 H ALA B 37 2109 600 2122 -38 -187 -121 H ATOM 2825 HA ALA B 37 22.822 50.600 44.578 0.05 12.62 H ANISOU 2825 HA ALA B 37 2021 640 2135 -118 -178 -69 H ATOM 2826 HB1 ALA B 37 23.704 49.969 46.639 0.05 12.72 H ANISOU 2826 HB1 ALA B 37 2028 674 2133 -121 -222 -125 H ATOM 2827 HB2 ALA B 37 23.671 51.550 46.539 0.05 13.30 H ANISOU 2827 HB2 ALA B 37 2138 672 2244 -146 -255 -131 H ATOM 2828 HB3 ALA B 37 22.561 50.783 47.384 0.05 12.91 H ANISOU 2828 HB3 ALA B 37 2111 655 2137 -84 -238 -169 H ATOM 2829 N TRP B 38 22.077 48.294 44.779 0.05 11.81 N ANISOU 2829 N TRP B 38 1891 622 1972 -67 -136 -86 N ATOM 2830 CA TRP B 38 21.655 46.892 44.953 0.05 11.43 C ANISOU 2830 CA TRP B 38 1830 614 1899 -43 -115 -93 C ATOM 2831 C TRP B 38 22.423 46.330 46.123 0.05 11.48 C ANISOU 2831 C TRP B 38 1825 635 1901 -43 -129 -108 C ATOM 2832 O TRP B 38 23.637 46.372 46.138 0.05 11.69 O ANISOU 2832 O TRP B 38 1828 668 1946 -68 -142 -98 O ATOM 2833 CB TRP B 38 21.977 46.128 43.682 0.05 11.33 C ANISOU 2833 CB TRP B 38 1795 627 1882 -47 -89 -70 C ATOM 2834 CG TRP B 38 21.392 44.701 43.669 0.05 11.06 C ANISOU 2834 CG TRP B 38 1757 615 1831 -25 -74 -81 C ATOM 2835 CD1 TRP B 38 21.716 43.674 44.544 0.05 10.98 C ANISOU 2835 CD1 TRP B 38 1737 616 1820 -15 -73 -90 C ATOM 2836 CD2 TRP B 38 20.392 44.214 42.801 0.05 10.97 C ANISOU 2836 CD2 TRP B 38 1754 610 1806 -15 -66 -83 C ATOM 2837 NE1 TRP B 38 20.976 42.572 44.210 0.05 10.87 N ANISOU 2837 NE1 TRP B 38 1725 604 1800 -3 -62 -94 N ATOM 2838 CE2 TRP B 38 20.152 42.854 43.163 0.05 10.87 C ANISOU 2838 CE2 TRP B 38 1734 602 1793 -5 -61 -94 C ATOM 2839 CE3 TRP B 38 19.685 44.747 41.708 0.05 11.07 C ANISOU 2839 CE3 TRP B 38 1777 623 1807 -13 -69 -73 C ATOM 2840 CZ2 TRP B 38 19.241 42.070 42.499 0.05 10.89 C ANISOU 2840 CZ2 TRP B 38 1741 605 1791 -2 -64 -101 C ATOM 2841 CZ3 TRP B 38 18.769 43.968 41.056 0.05 11.07 C ANISOU 2841 CZ3 TRP B 38 1779 633 1794 -5 -74 -81 C ATOM 2842 CH2 TRP B 38 18.562 42.628 41.444 0.05 10.99 C ANISOU 2842 CH2 TRP B 38 1763 624 1790 -4 -73 -98 C ATOM 2843 H TRP B 38 22.722 48.375 44.227 0.05 11.92 H ANISOU 2843 H TRP B 38 1888 640 1999 -88 -132 -66 H ATOM 2844 HA TRP B 38 20.708 46.835 45.134 0.05 11.33 H ANISOU 2844 HA TRP B 38 1829 600 1875 -22 -111 -102 H ATOM 2845 HB2 TRP B 38 21.599 46.580 42.925 0.05 11.39 H ANISOU 2845 HB2 TRP B 38 1810 628 1887 -49 -84 -58 H ATOM 2846 HB3 TRP B 38 22.933 46.062 43.593 0.05 11.46 H ANISOU 2846 HB3 TRP B 38 1792 652 1909 -62 -87 -60 H ATOM 2847 HD1 TRP B 38 22.338 43.733 45.229 0.05 11.06 H ANISOU 2847 HD1 TRP B 38 1740 628 1835 -18 -82 -90 H ATOM 2848 HE1 TRP B 38 21.013 41.833 44.623 0.05 10.85 H ANISOU 2848 HE1 TRP B 38 1719 603 1801 3 -59 -94 H ATOM 2849 HE3 TRP B 38 19.822 45.628 41.447 0.05 11.20 H ANISOU 2849 HE3 TRP B 38 1799 630 1826 -19 -72 -59 H ATOM 2850 HZ2 TRP B 38 19.101 41.187 42.745 0.05 10.89 H ANISOU 2850 HZ2 TRP B 38 1739 601 1799 -1 -63 -106 H ATOM 2851 HZ3 TRP B 38 18.286 44.289 40.337 0.05 11.19 H ANISOU 2851 HZ3 TRP B 38 1800 653 1798 -3 -81 -74 H ATOM 2852 HH2 TRP B 38 17.937 42.137 40.967 0.05 11.08 H ANISOU 2852 HH2 TRP B 38 1775 636 1797 -5 -83 -105 H ATOM 2853 N CYS B 39 21.696 45.862 47.118 0.05 11.39 N ANISOU 2853 N CYS B 39 1828 634 1866 -15 -128 -124 N ATOM 2854 CA CYS B 39 22.272 45.416 48.379 0.05 11.54 C ANISOU 2854 CA CYS B 39 1845 671 1868 -8 -145 -135 C ATOM 2855 C CYS B 39 21.992 43.947 48.664 0.05 11.34 C ANISOU 2855 C CYS B 39 1807 674 1830 13 -122 -119 C ATOM 2856 O CYS B 39 20.878 43.482 48.498 0.05 11.18 O ANISOU 2856 O CYS B 39 1790 655 1804 28 -98 -111 O ATOM 2857 CB CYS B 39 21.692 46.263 49.537 0.05 11.84 C ANISOU 2857 CB CYS B 39 1924 697 1879 14 -165 -167 C ATOM 2858 SG CYS B 39 21.966 48.004 49.506 0.05 12.30 S ANISOU 2858 SG CYS B 39 2015 701 1958 -9 -206 -196 S ATOM 2859 H CYS B 39 20.852 45.759 47.083 0.05 11.29 H ANISOU 2859 H CYS B 39 1823 622 1845 1 -116 -126 H ATOM 2860 HA CYS B 39 23.237 45.532 48.362 0.05 11.69 H ANISOU 2860 HA CYS B 39 1848 691 1901 -28 -162 -131 H ATOM 2861 HB2 CYS B 39 20.743 46.137 49.567 0.05 11.75 H ANISOU 2861 HB2 CYS B 39 1921 689 1855 36 -144 -166 H ATOM 2862 HB3 CYS B 39 22.088 45.984 50.365 0.05 12.01 H ANISOU 2862 HB3 CYS B 39 1949 735 1879 21 -180 -174 H ATOM 2863 HG CYS B 39 23.006 48.152 48.945 0.05 12.45 H ANISOU 2863 HG CYS B 39 2010 714 2006 -49 -229 -185 H ATOM 2864 N ILE B 40 23.029 43.273 49.167 0.05 11.48 N ANISOU 2864 N ILE B 40 1805 710 1847 13 -135 -109 N ATOM 2865 CA ILE B 40 22.901 41.870 49.578 0.05 11.44 C ANISOU 2865 CA ILE B 40 1791 720 1834 34 -117 -88 C ATOM 2866 C ILE B 40 23.323 41.761 51.037 0.05 11.78 C ANISOU 2866 C ILE B 40 1843 788 1846 52 -142 -85 C ATOM 2867 O ILE B 40 24.458 42.069 51.397 0.05 12.06 O ANISOU 2867 O ILE B 40 1864 835 1883 42 -178 -90 O ATOM 2868 CB ILE B 40 23.760 40.919 48.738 0.05 11.41 C ANISOU 2868 CB ILE B 40 1758 717 1859 33 -106 -71 C ATOM 2869 CG1 ILE B 40 23.632 41.158 47.235 0.05 11.22 C ANISOU 2869 CG1 ILE B 40 1731 680 1854 20 -86 -77 C ATOM 2870 CG2 ILE B 40 23.390 39.474 49.152 0.05 11.45 C ANISOU 2870 CG2 ILE B 40 1766 720 1865 57 -89 -48 C ATOM 2871 CD1 ILE B 40 24.512 40.176 46.419 0.05 11.35 C ANISOU 2871 CD1 ILE B 40 1724 701 1888 32 -68 -66 C ATOM 2872 H ILE B 40 23.807 43.589 49.282 0.05 11.65 H ANISOU 2872 H ILE B 40 1817 733 1876 0 -155 -111 H ATOM 2873 HA ILE B 40 21.980 41.613 49.482 0.05 11.32 H ANISOU 2873 HA ILE B 40 1785 700 1815 42 -98 -84 H ATOM 2874 HB ILE B 40 24.684 41.078 48.972 0.05 11.59 H ANISOU 2874 HB ILE B 40 1765 752 1888 29 -123 -68 H ATOM 2875 HG12 ILE B 40 22.706 41.000 46.978 0.05 11.08 H ANISOU 2875 HG12 ILE B 40 1727 651 1833 22 -74 -80 H ATOM 2876 HG13 ILE B 40 23.902 42.061 47.031 0.05 11.26 H ANISOU 2876 HG13 ILE B 40 1734 683 1861 4 -95 -82 H ATOM 2877 HG21 ILE B 40 22.489 39.287 48.854 0.05 11.33 H ANISOU 2877 HG21 ILE B 40 1762 692 1850 55 -75 -49 H ATOM 2878 HG22 ILE B 40 24.022 38.876 48.738 0.05 11.50 H ANISOU 2878 HG22 ILE B 40 1760 722 1890 63 -83 -42 H ATOM 2879 HG23 ILE B 40 23.443 39.408 50.113 0.05 11.63 H ANISOU 2879 HG23 ILE B 40 1792 756 1869 68 -101 -39 H ATOM 2880 HD11 ILE B 40 25.448 40.334 46.616 0.05 11.52 H ANISOU 2880 HD11 ILE B 40 1730 733 1914 42 -77 -56 H ATOM 2881 HD12 ILE B 40 24.261 39.269 46.633 0.05 11.28 H ANISOU 2881 HD12 ILE B 40 1727 679 1881 42 -54 -70 H ATOM 2882 HD13 ILE B 40 24.359 40.326 45.471 0.05 11.40 H ANISOU 2882 HD13 ILE B 40 1719 713 1900 22 -62 -66 H ATOM 2883 N VAL B 41 22.385 41.308 51.879 0.05 11.86 N ANISOU 2883 N VAL B 41 1871 811 1824 77 -124 -73 N ATOM 2884 CA VAL B 41 22.660 40.999 53.282 0.05 12.28 C ANISOU 2884 CA VAL B 41 1938 896 1831 103 -140 -61 C ATOM 2885 C VAL B 41 22.862 39.465 53.290 0.05 12.30 C ANISOU 2885 C VAL B 41 1920 901 1854 115 -122 -13 C ATOM 2886 O VAL B 41 21.953 38.693 52.978 0.05 12.18 O ANISOU 2886 O VAL B 41 1902 870 1857 116 -86 12 O ATOM 2887 CB VAL B 41 21.561 41.502 54.272 0.05 12.50 C ANISOU 2887 CB VAL B 41 1998 944 1808 132 -120 -67 C ATOM 2888 CG1 VAL B 41 21.754 40.970 55.681 0.05 13.08 C ANISOU 2888 CG1 VAL B 41 2094 1060 1815 165 -139 -57 C ATOM 2889 CG2 VAL B 41 21.621 43.050 54.358 0.05 12.47 C ANISOU 2889 CG2 VAL B 41 2017 917 1802 126 -130 -116 C ATOM 2890 H VAL B 41 21.577 41.142 51.645 0.05 11.73 H ANISOU 2890 H VAL B 41 1858 788 1812 80 -102 -67 H ATOM 2891 HA VAL B 41 23.498 41.401 53.545 0.05 12.48 H ANISOU 2891 HA VAL B 41 1964 931 1849 98 -175 -76 H ATOM 2892 HB VAL B 41 20.691 41.258 53.942 0.05 12.38 H ANISOU 2892 HB VAL B 41 1973 925 1805 135 -87 -43 H ATOM 2893 HG11 VAL B 41 20.902 40.945 56.134 0.05 13.30 H ANISOU 2893 HG11 VAL B 41 2147 1105 1803 189 -124 -67 H ATOM 2894 HG12 VAL B 41 22.123 40.073 55.638 0.05 13.12 H ANISOU 2894 HG12 VAL B 41 2086 1075 1825 173 -124 -17 H ATOM 2895 HG13 VAL B 41 22.368 41.550 56.148 0.05 13.24 H ANISOU 2895 HG13 VAL B 41 2118 1084 1830 157 -180 -78 H ATOM 2896 HG21 VAL B 41 20.837 43.367 54.831 0.05 12.83 H ANISOU 2896 HG21 VAL B 41 2091 976 1807 145 -147 -139 H ATOM 2897 HG22 VAL B 41 22.430 43.317 54.818 0.05 12.31 H ANISOU 2897 HG22 VAL B 41 1986 876 1814 100 -149 -128 H ATOM 2898 HG23 VAL B 41 21.620 43.370 53.447 0.05 12.33 H ANISOU 2898 HG23 VAL B 41 1996 894 1793 133 -99 -108 H ATOM 2899 N ARG B 42 24.066 39.098 53.628 0.05 12.56 N ANISOU 2899 N ARG B 42 1936 949 1888 122 -152 -1 N ATOM 2900 CA ARG B 42 24.451 37.685 53.550 0.05 12.68 C ANISOU 2900 CA ARG B 42 1933 954 1931 139 -138 43 C ATOM 2901 C ARG B 42 23.757 36.886 54.663 0.05 13.03 C ANISOU 2901 C ARG B 42 1997 1013 1940 166 -121 90 C ATOM 2902 O ARG B 42 23.276 37.414 55.656 0.05 13.28 O ANISOU 2902 O ARG B 42 2053 1080 1913 180 -124 89 O ATOM 2903 CB ARG B 42 25.974 37.597 53.645 0.05 12.98 C ANISOU 2903 CB ARG B 42 1938 1011 1982 146 -177 48 C ATOM 2904 CG ARG B 42 26.756 38.338 52.553 0.05 12.79 C ANISOU 2904 CG ARG B 42 1883 981 1997 118 -185 18 C ATOM 2905 CD ARG B 42 26.421 37.863 51.159 0.05 12.43 C ANISOU 2905 CD ARG B 42 1832 898 1992 113 -142 13 C ATOM 2906 NE ARG B 42 27.257 38.528 50.160 0.05 12.40 N ANISOU 2906 NE ARG B 42 1796 900 2017 93 -143 -2 N ATOM 2907 CZ ARG B 42 27.193 38.300 48.860 0.05 12.22 C ANISOU 2907 CZ ARG B 42 1768 859 2017 93 -107 -10 C ATOM 2908 NH1 ARG B 42 26.372 37.387 48.362 0.05 12.07 N ANISOU 2908 NH1 ARG B 42 1775 807 2002 108 -79 -13 N ATOM 2909 NH2 ARG B 42 27.987 38.968 48.039 0.05 12.33 N ANISOU 2909 NH2 ARG B 42 1747 887 2048 76 -103 -13 N ATOM 2910 H ARG B 42 24.690 39.598 53.904 0.05 12.73 H ANISOU 2910 H ARG B 42 1955 984 1899 118 -182 -15 H ATOM 2911 HA ARG B 42 24.168 37.369 52.683 0.05 12.43 H ANISOU 2911 HA ARG B 42 1895 894 1933 129 -116 40 H ATOM 2912 HB2 ARG B 42 26.259 37.948 54.503 0.05 13.28 H ANISOU 2912 HB2 ARG B 42 1983 1078 1984 153 -207 47 H ATOM 2913 HB3 ARG B 42 26.233 36.656 53.565 0.05 13.10 H ANISOU 2913 HB3 ARG B 42 1943 1017 2018 165 -166 77 H ATOM 2914 HG2 ARG B 42 26.512 39.275 52.615 0.05 12.72 H ANISOU 2914 HG2 ARG B 42 1886 973 1973 98 -199 -8 H ATOM 2915 HG3 ARG B 42 27.704 38.242 52.703 0.05 13.08 H ANISOU 2915 HG3 ARG B 42 1890 1035 2044 124 -208 29 H ATOM 2916 HD2 ARG B 42 26.617 36.909 51.093 0.05 12.56 H ANISOU 2916 HD2 ARG B 42 1843 904 2025 136 -129 34 H ATOM 2917 HD3 ARG B 42 25.493 38.019 50.950 0.05 12.18 H ANISOU 2917 HD3 ARG B 42 1824 851 1954 104 -125 3 H ATOM 2918 HE ARG B 42 27.988 38.853 50.454 0.05 12.64 H ANISOU 2918 HE ARG B 42 1802 951 2050 88 -166 2 H ATOM 2919 HH11 ARG B 42 25.851 36.956 48.884 0.05 12.06 H ANISOU 2919 HH11 ARG B 42 1792 796 1996 114 -80 -5 H ATOM 2920 HH12 ARG B 42 26.339 37.253 47.520 0.05 12.02 H ANISOU 2920 HH12 ARG B 42 1771 790 2005 110 -60 -24 H ATOM 2921 HH21 ARG B 42 28.542 39.534 48.349 0.05 12.50 H ANISOU 2921 HH21 ARG B 42 1748 926 2075 61 -125 -9 H ATOM 2922 HH22 ARG B 42 27.961 38.820 47.199 0.05 12.27 H ANISOU 2922 HH22 ARG B 42 1740 874 2048 81 -78 -17 H ATOM 2923 N PRO B 43 23.721 35.544 54.515 0.05 13.17 N ANISOU 2923 N PRO B 43 2007 1002 1995 178 -100 136 N ATOM 2924 CA PRO B 43 23.021 34.699 55.490 0.05 13.60 C ANISOU 2924 CA PRO B 43 2076 1062 2028 197 -77 197 C ATOM 2925 C PRO B 43 23.517 34.877 56.907 0.05 14.14 C ANISOU 2925 C PRO B 43 2160 1191 2024 231 -103 223 C ATOM 2926 O PRO B 43 24.699 34.958 57.167 0.05 14.38 O ANISOU 2926 O PRO B 43 2179 1244 2041 247 -147 218 O ATOM 2927 CB PRO B 43 23.301 33.279 54.952 0.05 13.76 C ANISOU 2927 CB PRO B 43 2089 1026 2115 203 -67 235 C ATOM 2928 CG PRO B 43 23.438 33.478 53.482 0.05 13.30 C ANISOU 2928 CG PRO B 43 2018 928 2106 181 -66 180 C ATOM 2929 CD PRO B 43 24.175 34.774 53.334 0.05 13.04 C ANISOU 2929 CD PRO B 43 1972 938 2043 175 -93 133 C ATOM 2930 HA PRO B 43 22.066 34.842 55.460 0.05 13.51 H ANISOU 2930 HA PRO B 43 2071 1047 2014 185 -52 200 H ATOM 2931 HB2 PRO B 43 24.120 32.959 55.350 0.05 14.07 H ANISOU 2931 HB2 PRO B 43 2122 1076 2146 228 -86 256 H ATOM 2932 HB3 PRO B 43 22.554 32.705 55.168 0.05 13.94 H ANISOU 2932 HB3 PRO B 43 2117 1028 2150 197 -44 270 H ATOM 2933 HG2 PRO B 43 23.954 32.761 53.085 0.05 13.45 H ANISOU 2933 HG2 PRO B 43 2033 918 2159 195 -68 188 H ATOM 2934 HG3 PRO B 43 22.561 33.539 53.076 0.05 13.10 H ANISOU 2934 HG3 PRO B 43 1999 884 2096 158 -49 170 H ATOM 2935 HD2 PRO B 43 25.130 34.613 53.363 0.05 13.23 H ANISOU 2935 HD2 PRO B 43 1981 974 2072 192 -112 138 H ATOM 2936 HD3 PRO B 43 23.917 35.215 52.522 0.05 12.71 H ANISOU 2936 HD3 PRO B 43 1928 883 2018 155 -86 100 H ATOM 2937 N GLU B 44 22.589 34.914 57.852 0.05 14.46 N ANISOU 2937 N GLU B 44 2221 1263 2011 244 -74 254 N ATOM 2938 CA GLU B 44 22.913 34.961 59.277 0.05 15.15 C ANISOU 2938 CA GLU B 44 2333 1415 2010 285 -90 286 C ATOM 2939 C GLU B 44 23.692 36.191 59.662 0.05 15.30 C ANISOU 2939 C GLU B 44 2369 1480 1965 295 -149 223 C ATOM 2940 O GLU B 44 24.551 36.174 60.508 0.05 15.92 O ANISOU 2940 O GLU B 44 2463 1607 1980 327 -189 240 O ATOM 2941 CB GLU B 44 23.687 33.686 59.749 0.05 15.70 C ANISOU 2941 CB GLU B 44 2395 1476 2093 311 -93 370 C ATOM 2942 CG GLU B 44 22.850 32.476 60.168 0.05 15.81 C ANISOU 2942 CG GLU B 44 2403 1438 2166 295 -34 441 C ATOM 2943 CD GLU B 44 23.648 31.172 60.158 0.05 16.37 C ANISOU 2943 CD GLU B 44 2471 1471 2278 316 -37 524 C ATOM 2944 OE1 GLU B 44 22.954 30.153 60.231 0.05 16.18 O ANISOU 2944 OE1 GLU B 44 2433 1398 2318 317 -62 504 O ATOM 2945 OE2 GLU B 44 24.910 31.168 60.074 0.05 17.06 O ANISOU 2945 OE2 GLU B 44 2571 1576 2336 335 -8 611 O ATOM 2946 H GLU B 44 21.754 34.934 57.680 0.05 14.34 H ANISOU 2946 H GLU B 44 2205 1237 2006 232 -44 258 H ATOM 2947 HA GLU B 44 22.080 34.983 59.771 0.05 15.33 H ANISOU 2947 HA GLU B 44 2368 1457 2000 293 -56 305 H ATOM 2948 HB2 GLU B 44 24.259 33.400 59.022 0.05 15.56 H ANISOU 2948 HB2 GLU B 44 2361 1436 2116 308 -121 357 H ATOM 2949 HB3 GLU B 44 24.239 33.910 60.509 0.05 16.20 H ANISOU 2949 HB3 GLU B 44 2477 1588 2091 340 -107 393 H ATOM 2950 HG2 GLU B 44 22.506 32.609 61.062 0.05 16.06 H ANISOU 2950 HG2 GLU B 44 2444 1501 2158 301 -3 467 H ATOM 2951 HG3 GLU B 44 22.114 32.389 59.539 0.05 15.35 H ANISOU 2951 HG3 GLU B 44 2332 1336 2165 266 -24 410 H ATOM 2952 N THR B 45 23.364 37.294 58.997 0.05 14.80 N ANISOU 2952 N THR B 45 2307 1398 1920 267 -156 151 N ATOM 2953 CA THR B 45 23.979 38.598 59.288 0.05 14.97 C ANISOU 2953 CA THR B 45 2349 1442 1896 263 -213 79 C ATOM 2954 C THR B 45 22.930 39.665 59.325 0.05 14.89 C ANISOU 2954 C THR B 45 2373 1432 1851 267 -187 29 C ATOM 2955 O THR B 45 21.758 39.464 59.045 0.05 14.63 O ANISOU 2955 O THR B 45 2336 1386 1837 269 -126 50 O ATOM 2956 CB THR B 45 25.046 39.008 58.269 0.05 14.60 C ANISOU 2956 CB THR B 45 2266 1361 1919 222 -256 41 C ATOM 2957 OG1 THR B 45 24.389 39.387 57.045 0.05 13.92 O ANISOU 2957 OG1 THR B 45 2169 1228 1893 191 -218 16 O ATOM 2958 CG2 THR B 45 26.052 37.876 58.016 0.05 14.68 C ANISOU 2958 CG2 THR B 45 2232 1367 1978 227 -269 91 C ATOM 2959 H THR B 45 22.783 37.310 58.373 0.05 14.41 H ANISOU 2959 H THR B 45 2247 1318 1912 247 -130 143 H ATOM 2960 HA THR B 45 24.393 38.584 60.166 0.05 15.50 H ANISOU 2960 HA THR B 45 2433 1549 1907 287 -243 87 H ATOM 2961 HB THR B 45 25.538 39.769 58.622 0.05 14.87 H ANISOU 2961 HB THR B 45 2313 1412 1927 217 -302 3 H ATOM 2962 HG1 THR B 45 24.817 39.127 56.375 0.05 13.72 H ANISOU 2962 HG1 THR B 45 2118 1183 1911 173 -224 15 H ATOM 2963 HG21 THR B 45 26.814 38.204 57.520 0.05 14.52 H ANISOU 2963 HG21 THR B 45 2184 1334 2000 205 -290 70 H ATOM 2964 HG22 THR B 45 26.354 37.521 58.863 0.05 15.18 H ANISOU 2964 HG22 THR B 45 2301 1465 2001 251 -297 113 H ATOM 2965 HG23 THR B 45 25.622 37.180 57.505 0.05 14.47 H ANISOU 2965 HG23 THR B 45 2199 1316 1982 231 -227 123 H ATOM 2966 N ALYS B 46 23.404 40.838 59.729 0.03 15.27 N ANISOU 2966 N ALYS B 46 2458 1496 1848 272 -241 -37 N ATOM 2967 N BLYS B 46 23.385 40.842 59.691 0.02 15.18 N ANISOU 2967 N BLYS B 46 2442 1478 1849 266 -241 -39 N ATOM 2968 CA ALYS B 46 22.587 42.029 59.844 0.03 15.39 C ANISOU 2968 CA ALYS B 46 2517 1503 1826 285 -231 -100 C ATOM 2969 CA BLYS B 46 22.521 41.977 59.630 0.02 15.18 C ANISOU 2969 CA BLYS B 46 2478 1463 1826 274 -225 -96 C ATOM 2970 C ALYS B 46 23.429 43.244 59.425 0.03 15.28 C ANISOU 2970 C ALYS B 46 2507 1445 1856 241 -296 -170 C ATOM 2971 C BLYS B 46 23.280 43.227 59.301 0.02 15.23 C ANISOU 2971 C BLYS B 46 2498 1433 1855 239 -293 -171 C ATOM 2972 O ALYS B 46 24.604 43.332 59.749 0.03 15.63 O ANISOU 2972 O ALYS B 46 2544 1496 1899 220 -368 -186 O ATOM 2973 O BLYS B 46 24.507 43.280 59.335 0.02 15.44 O ANISOU 2973 O BLYS B 46 2507 1460 1898 210 -360 -181 O ATOM 2974 CB ALYS B 46 22.070 42.184 61.275 0.03 16.30 C ANISOU 2974 CB ALYS B 46 2695 1681 1819 348 -234 -117 C ATOM 2975 CB BLYS B 46 21.793 42.170 60.941 0.02 15.95 C ANISOU 2975 CB BLYS B 46 2629 1617 1812 336 -206 -101 C ATOM 2976 CG ALYS B 46 22.916 43.095 62.102 0.03 17.09 C ANISOU 2976 CG ALYS B 46 2833 1810 1851 355 -328 -164 C ATOM 2977 CG BLYS B 46 22.741 42.458 62.060 0.02 16.75 C ANISOU 2977 CG BLYS B 46 2770 1761 1834 355 -282 -130 C ATOM 2978 CD ALYS B 46 22.513 43.168 63.571 0.03 18.11 C ANISOU 2978 CD ALYS B 46 3041 1996 1843 423 -334 -205 C ATOM 2979 CD BLYS B 46 22.022 42.562 63.371 0.02 17.65 C ANISOU 2979 CD BLYS B 46 2946 1940 1819 427 -259 -139 C ATOM 2980 CE ALYS B 46 22.564 44.612 64.092 0.03 18.29 C ANISOU 2980 CE ALYS B 46 3118 1977 1853 435 -338 -300 C ATOM 2981 CE BLYS B 46 21.144 43.786 63.414 0.02 17.78 C ANISOU 2981 CE BLYS B 46 3008 1934 1814 453 -235 -211 C ATOM 2982 NZ ALYS B 46 23.680 45.386 63.475 0.03 18.50 N ANISOU 2982 NZ ALYS B 46 3172 1940 1916 387 -437 -394 N ATOM 2983 NZ BLYS B 46 21.631 44.724 64.427 0.02 18.84 N ANISOU 2983 NZ BLYS B 46 3225 2100 1833 500 -289 -290 N ATOM 2984 H ALYS B 46 24.222 40.971 59.935 0.05 15.54 H ANISOU 2984 H ALYS B 46 2493 1543 1870 268 -289 -48 H ATOM 2985 H BLYS B 46 24.177 41.005 59.964 0.05 15.45 H ANISOU 2985 H BLYS B 46 2476 1522 1871 261 -290 -53 H ATOM 2986 HA ALYS B 46 21.834 41.931 59.249 0.05 15.03 H ANISOU 2986 HA ALYS B 46 2459 1442 1811 284 -181 -84 H ATOM 2987 HA BLYS B 46 21.868 41.820 58.931 0.05 14.74 H ANISOU 2987 HA BLYS B 46 2402 1384 1813 264 -182 -81 H ATOM 2988 HB2ALYS B 46 21.162 42.516 61.257 0.05 16.36 H ANISOU 2988 HB2ALYS B 46 2728 1678 1811 363 -215 -155 H ATOM 2989 HB2BLYS B 46 21.177 42.912 60.845 0.05 15.97 H ANISOU 2989 HB2BLYS B 46 2656 1608 1805 348 -190 -140 H ATOM 2990 HB3ALYS B 46 22.089 41.315 61.697 0.05 16.45 H ANISOU 2990 HB3ALYS B 46 2707 1733 1811 373 -193 -62 H ATOM 2991 HB3BLYS B 46 21.298 41.362 61.152 0.05 15.98 H ANISOU 2991 HB3BLYS B 46 2619 1645 1807 354 -159 -44 H ATOM 2992 HG2ALYS B 46 23.842 42.818 62.045 0.05 17.17 H ANISOU 2992 HG2ALYS B 46 2818 1842 1863 352 -345 -119 H ATOM 2993 HG2BLYS B 46 23.390 41.738 62.103 0.05 16.75 H ANISOU 2993 HG2BLYS B 46 2741 1774 1848 346 -298 -87 H ATOM 2994 HG3ALYS B 46 22.791 43.982 61.726 0.05 16.99 H ANISOU 2994 HG3ALYS B 46 2819 1760 1876 320 -375 -212 H ATOM 2995 HG3BLYS B 46 23.189 43.299 61.901 0.05 16.81 H ANISOU 2995 HG3BLYS B 46 2789 1741 1855 332 -333 -187 H ATOM 2996 HD2ALYS B 46 21.610 42.836 63.677 0.05 18.22 H ANISOU 2996 HD2ALYS B 46 3055 2045 1821 459 -272 -155 H ATOM 2997 HD2BLYS B 46 21.453 41.790 63.484 0.05 17.65 H ANISOU 2997 HD2BLYS B 46 2930 1967 1808 448 -203 -75 H ATOM 2998 HD3ALYS B 46 23.131 42.642 64.099 0.05 18.66 H ANISOU 2998 HD3ALYS B 46 3130 2093 1866 428 -395 -219 H ATOM 2999 HD3BLYS B 46 22.672 42.625 64.086 0.05 18.22 H ANISOU 2999 HD3BLYS B 46 3047 2042 1836 439 -315 -160 H ATOM 3000 HE2ALYS B 46 21.719 45.048 63.911 0.05 17.68 H ANISOU 3000 HE2ALYS B 46 3011 1869 1838 421 -288 -280 H ATOM 3001 HE2BLYS B 46 21.164 44.221 62.551 0.05 17.31 H ANISOU 3001 HE2BLYS B 46 2932 1819 1824 412 -254 -242 H ATOM 3002 HE3ALYS B 46 22.736 44.603 65.043 0.05 18.90 H ANISOU 3002 HE3ALYS B 46 3242 2094 1844 491 -316 -315 H ATOM 3003 HE3BLYS B 46 20.240 43.525 63.652 0.05 17.74 H ANISOU 3003 HE3BLYS B 46 2994 1947 1798 481 -165 -175 H ATOM 3004 HZ1ALYS B 46 23.747 45.244 62.602 0.05 18.04 H ANISOU 3004 HZ1ALYS B 46 3101 1834 1921 363 -421 -407 H ATOM 3005 HZ1BLYS B 46 21.210 44.580 65.199 0.05 19.29 H ANISOU 3005 HZ1BLYS B 46 3308 2203 1819 552 -246 -275 H ATOM 3006 HZ2ALYS B 46 23.542 46.264 63.601 0.05 19.17 H ANISOU 3006 HZ2ALYS B 46 3314 2034 1935 417 -465 -448 H ATOM 3007 HZ2BLYS B 46 22.506 44.615 64.546 0.05 19.11 H ANISOU 3007 HZ2BLYS B 46 3264 2148 1849 486 -347 -294 H ATOM 3008 HZ3ALYS B 46 24.448 45.150 63.859 0.05 18.47 H ANISOU 3008 HZ3ALYS B 46 3141 1938 1939 352 -485 -382 H ATOM 3009 HZ3BLYS B 46 21.477 45.561 64.165 0.05 18.85 H ANISOU 3009 HZ3BLYS B 46 3250 2059 1851 492 -311 -350 H ATOM 3010 N ASER B 47 22.808 44.191 58.727 0.03 14.91 N ANISOU 3010 N ASER B 47 2465 1350 1849 226 -273 -204 N ATOM 3011 N BSER B 47 22.476 44.231 58.996 0.02 15.15 N ANISOU 3011 N BSER B 47 2518 1391 1848 244 -274 -218 N ATOM 3012 CA ASER B 47 23.488 45.430 58.280 0.03 14.96 C ANISOU 3012 CA ASER B 47 2483 1305 1897 185 -329 -265 C ATOM 3013 CA BSER B 47 22.906 45.587 58.705 0.02 15.31 C ANISOU 3013 CA BSER B 47 2564 1360 1894 213 -330 -289 C ATOM 3014 C ASER B 47 23.764 46.456 59.407 0.03 15.85 C ANISOU 3014 C ASER B 47 2668 1422 1931 213 -382 -337 C ATOM 3015 C BSER B 47 22.202 46.480 59.709 0.02 16.02 C ANISOU 3015 C BSER B 47 2730 1455 1901 269 -330 -350 C ATOM 3016 O ASER B 47 23.249 46.333 60.514 0.03 16.34 O ANISOU 3016 O ASER B 47 2774 1532 1903 275 -358 -341 O ATOM 3017 O BSER B 47 21.084 46.210 60.124 0.02 16.02 O ANISOU 3017 O BSER B 47 2742 1481 1865 320 -260 -333 O ATOM 3018 CB ASER B 47 22.708 46.070 57.139 0.03 14.38 C ANISOU 3018 CB ASER B 47 2399 1179 1888 167 -287 -270 C ATOM 3019 CB BSER B 47 22.506 45.953 57.286 0.02 14.58 C ANISOU 3019 CB BSER B 47 2435 1211 1893 173 -299 -279 C ATOM 3020 OG ASER B 47 21.406 46.455 57.535 0.03 14.58 O ANISOU 3020 OG ASER B 47 2465 1205 1869 217 -244 -291 O ATOM 3021 OG BSER B 47 23.156 47.122 56.860 0.02 14.78 O ANISOU 3021 OG BSER B 47 2481 1180 1956 137 -350 -331 O ATOM 3022 H ASER B 47 21.989 44.137 58.479 0.05 14.66 H ANISOU 3022 H ASER B 47 2429 1314 1827 238 -226 -188 H ATOM 3023 H BSER B 47 21.626 44.137 58.955 0.05 15.06 H ANISOU 3023 H BSER B 47 2511 1384 1826 267 -228 -206 H ATOM 3024 HA ASER B 47 24.351 45.160 57.928 0.05 14.91 H ANISOU 3024 HA ASER B 47 2444 1294 1925 151 -364 -253 H ATOM 3025 HA BSER B 47 23.859 45.677 58.808 0.05 15.55 H ANISOU 3025 HA BSER B 47 2587 1390 1932 187 -386 -300 H ATOM 3026 HB2ASER B 47 23.182 46.866 56.846 0.05 14.45 H ANISOU 3026 HB2ASER B 47 2409 1151 1929 134 -325 -298 H ATOM 3027 HB2BSER B 47 22.741 45.236 56.683 0.05 14.20 H ANISOU 3027 HB2BSER B 47 2344 1166 1887 148 -292 -241 H ATOM 3028 HB3ASER B 47 22.634 45.448 56.402 0.05 13.91 H ANISOU 3028 HB3ASER B 47 2300 1120 1864 154 -254 -229 H ATOM 3029 HB3BSER B 47 21.549 46.118 57.252 0.05 14.41 H ANISOU 3029 HB3BSER B 47 2420 1191 1866 199 -251 -271 H ATOM 3030 HG ASER B 47 21.449 47.052 58.122 0.05 15.06 H ANISOU 3030 HG ASER B 47 2565 1267 1890 236 -270 -330 H ATOM 3031 HG BSER B 47 22.907 47.307 56.081 0.05 14.44 H ANISOU 3031 HG BSER B 47 2424 1110 1952 124 -327 -323 H ATOM 3032 N APHE B 48 24.563 47.480 59.124 0.03 16.15 N ANISOU 3032 N APHE B 48 2721 1409 2006 169 -452 -392 N ATOM 3033 N BPHE B 48 22.874 47.555 60.087 0.02 16.72 N ANISOU 3033 N BPHE B 48 2869 1521 1964 258 -411 -423 N ATOM 3034 CA APHE B 48 24.841 48.494 60.135 0.03 17.14 C ANISOU 3034 CA APHE B 48 2922 1520 2069 185 -522 -475 C ATOM 3035 CA BPHE B 48 22.282 48.572 60.943 0.02 17.56 C ANISOU 3035 CA BPHE B 48 3062 1616 1993 314 -423 -502 C ATOM 3036 C APHE B 48 23.625 49.410 60.395 0.03 17.45 C ANISOU 3036 C APHE B 48 3035 1538 2058 249 -481 -526 C ATOM 3037 C BPHE B 48 22.816 49.899 60.444 0.02 17.80 C ANISOU 3037 C BPHE B 48 3121 1555 2089 264 -492 -570 C ATOM 3038 O APHE B 48 22.814 49.613 59.514 0.03 16.88 O ANISOU 3038 O APHE B 48 2946 1438 2031 258 -415 -506 O ATOM 3039 O BPHE B 48 23.981 49.999 60.058 0.02 17.77 O ANISOU 3039 O BPHE B 48 3081 1524 2148 190 -560 -567 O ATOM 3040 CB APHE B 48 26.058 49.305 59.707 0.03 17.40 C ANISOU 3040 CB APHE B 48 2946 1484 2182 108 -605 -513 C ATOM 3041 CB BPHE B 48 22.631 48.335 62.414 0.02 18.56 C ANISOU 3041 CB BPHE B 48 3246 1811 1996 363 -465 -531 C ATOM 3042 CG APHE B 48 26.792 49.906 60.846 0.03 18.57 C ANISOU 3042 CG APHE B 48 3154 1624 2277 102 -710 -591 C ATOM 3043 CG BPHE B 48 22.310 49.507 63.348 0.02 19.69 C ANISOU 3043 CG BPHE B 48 3490 1921 2070 396 -530 -644 C ATOM 3044 CD1APHE B 48 27.460 49.097 61.735 0.03 19.07 C ANISOU 3044 CD1APHE B 48 3203 1755 2289 102 -770 -581 C ATOM 3045 CD1BPHE B 48 21.351 49.371 64.329 0.02 20.48 C ANISOU 3045 CD1BPHE B 48 3665 2066 2050 494 -487 -682 C ATOM 3046 CD2APHE B 48 26.813 51.276 61.032 0.03 19.27 C ANISOU 3046 CD2APHE B 48 3319 1635 2366 100 -755 -677 C ATOM 3047 CD2BPHE B 48 23.004 50.721 63.285 0.02 20.10 C ANISOU 3047 CD2BPHE B 48 3563 1897 2177 330 -636 -712 C ATOM 3048 CE1APHE B 48 28.129 49.638 62.802 0.03 20.27 C ANISOU 3048 CE1APHE B 48 3412 1904 2384 95 -879 -657 C ATOM 3049 CE1BPHE B 48 21.062 50.420 65.208 0.02 21.65 C ANISOU 3049 CE1BPHE B 48 3918 2177 2130 533 -549 -798 C ATOM 3050 CE2APHE B 48 27.485 51.828 62.096 0.03 20.49 C ANISOU 3050 CE2APHE B 48 3538 1775 2470 91 -864 -760 C ATOM 3051 CE2BPHE B 48 22.714 51.774 64.152 0.02 21.24 C ANISOU 3051 CE2BPHE B 48 3806 1997 2267 355 -704 -821 C ATOM 3052 CZ APHE B 48 28.151 51.013 62.978 0.03 21.00 C ANISOU 3052 CZ APHE B 48 3586 1915 2477 87 -929 -752 C ATOM 3053 CZ BPHE B 48 21.742 51.619 65.113 0.02 22.02 C ANISOU 3053 CZ BPHE B 48 3992 2137 2240 461 -663 -871 C ATOM 3054 H APHE B 48 24.960 47.620 58.378 0.05 15.86 H ANISOU 3054 H APHE B 48 2653 1341 2033 127 -463 -383 H ATOM 3055 H BPHE B 48 23.680 47.721 59.854 0.05 16.80 H ANISOU 3055 H BPHE B 48 2864 1517 2003 219 -463 -431 H ATOM 3056 HA APHE B 48 25.050 48.049 60.969 0.05 17.58 H ANISOU 3056 HA APHE B 48 2992 1623 2065 206 -550 -476 H ATOM 3057 HA BPHE B 48 21.323 48.545 60.843 0.05 17.40 H ANISOU 3057 HA BPHE B 48 3045 1604 1961 353 -358 -488 H ATOM 3058 HB2APHE B 48 26.683 48.737 59.235 0.05 17.08 H ANISOU 3058 HB2APHE B 48 2844 1454 2192 68 -613 -470 H ATOM 3059 HB2BPHE B 48 22.104 47.582 62.729 0.05 18.59 H ANISOU 3059 HB2BPHE B 48 3252 1864 1946 414 -404 -498 H ATOM 3060 HB3APHE B 48 25.765 50.031 59.133 0.05 17.22 H ANISOU 3060 HB3APHE B 48 2934 1410 2198 101 -585 -527 H ATOM 3061 HB3BPHE B 48 23.563 48.096 62.456 0.05 18.55 H ANISOU 3061 HB3BPHE B 48 3214 1828 2004 330 -507 -508 H ATOM 3062 HD1APHE B 48 27.447 48.178 61.616 0.05 18.66 H ANISOU 3062 HD1APHE B 48 3103 1749 2240 108 -740 -522 H ATOM 3063 HD1BPHE B 48 20.890 48.569 64.392 0.05 20.30 H ANISOU 3063 HD1BPHE B 48 3623 2096 1994 535 -414 -631 H ATOM 3064 HD2APHE B 48 26.363 51.833 60.437 0.05 18.97 H ANISOU 3064 HD2APHE B 48 3291 1552 2365 105 -716 -679 H ATOM 3065 HD2BPHE B 48 23.661 50.832 62.637 0.05 19.65 H ANISOU 3065 HD2BPHE B 48 3450 1816 2199 266 -660 -681 H ATOM 3066 HE1APHE B 48 28.582 49.086 63.397 0.05 20.65 H ANISOU 3066 HE1APHE B 48 3447 2002 2396 96 -923 -646 H ATOM 3067 HE1BPHE B 48 20.401 50.315 65.855 0.05 22.24 H ANISOU 3067 HE1BPHE B 48 4046 2287 2119 607 -514 -825 H ATOM 3068 HE2APHE B 48 27.502 52.748 62.219 0.05 21.03 H ANISOU 3068 HE2APHE B 48 3664 1783 2543 91 -896 -822 H ATOM 3069 HE2BPHE B 48 23.182 52.574 64.085 0.05 21.56 H ANISOU 3069 HE2BPHE B 48 3856 1981 2354 302 -778 -861 H ATOM 3070 HZ APHE B 48 28.608 51.383 63.697 0.05 21.89 H ANISOU 3070 HZ APHE B 48 3743 2021 2552 80 -1009 -810 H ATOM 3071 HZ BPHE B 48 21.545 52.312 65.700 0.05 22.88 H ANISOU 3071 HZ BPHE B 48 4175 2211 2307 483 -710 -952 H ATOM 3072 N AARG B 49 23.469 49.854 61.640 0.03 18.48 N ANISOU 3072 N AARG B 49 3245 1689 2088 298 -524 -595 N ATOM 3073 N BARG B 49 21.941 50.901 60.447 0.02 18.16 N ANISOU 3073 N BARG B 49 3227 1553 2121 308 -472 -626 N ATOM 3074 CA AARG B 49 22.285 50.578 62.088 0.03 19.09 C ANISOU 3074 CA AARG B 49 3402 1753 2097 376 -489 -657 C ATOM 3075 CA BARG B 49 22.284 52.258 60.073 0.02 18.69 C ANISOU 3075 CA BARG B 49 3342 1520 2238 273 -540 -699 C ATOM 3076 C AARG B 49 22.615 52.042 61.939 0.03 19.81 C ANISOU 3076 C AARG B 49 3560 1747 2220 347 -575 -754 C ATOM 3077 C BARG B 49 21.639 53.207 61.066 0.02 19.79 C ANISOU 3077 C BARG B 49 3591 1641 2288 357 -550 -794 C ATOM 3078 O AARG B 49 23.738 52.451 62.247 0.03 20.61 O ANISOU 3078 O AARG B 49 3697 1838 2296 315 -677 -809 O ATOM 3079 O BARG B 49 20.459 53.030 61.420 0.02 19.81 O ANISOU 3079 O BARG B 49 3611 1688 2229 445 -464 -784 O ATOM 3080 CB AARG B 49 21.944 50.198 63.544 0.03 19.94 C ANISOU 3080 CB AARG B 49 3566 1953 2059 460 -475 -671 C ATOM 3081 CB BARG B 49 21.775 52.527 58.666 0.02 17.95 C ANISOU 3081 CB BARG B 49 3209 1362 2248 245 -493 -662 C ATOM 3082 CG AARG B 49 21.177 51.225 64.413 0.03 20.71 C ANISOU 3082 CG AARG B 49 3743 2056 2069 561 -420 -729 C ATOM 3083 CG BARG B 49 22.500 51.728 57.615 0.02 17.00 C ANISOU 3083 CG BARG B 49 2994 1248 2219 167 -483 -581 C ATOM 3084 CD AARG B 49 20.588 50.580 65.709 0.03 21.80 C ANISOU 3084 CD AARG B 49 3948 2293 2043 652 -410 -748 C ATOM 3085 CD BARG B 49 23.895 52.239 57.384 0.02 17.32 C ANISOU 3085 CD BARG B 49 3011 1255 2315 80 -573 -590 C ATOM 3086 NE AARG B 49 19.158 50.873 65.858 0.03 22.28 N ANISOU 3086 NE AARG B 49 4045 2385 2034 757 -308 -759 N ATOM 3087 NE BARG B 49 24.508 51.613 56.217 0.02 16.50 N ANISOU 3087 NE BARG B 49 2815 1162 2293 19 -549 -510 N ATOM 3088 CZ AARG B 49 18.311 50.233 66.665 0.03 22.63 C ANISOU 3088 CZ AARG B 49 4083 2536 1981 836 -216 -698 C ATOM 3089 CZ BARG B 49 25.111 50.434 56.230 0.02 16.08 C ANISOU 3089 CZ BARG B 49 2699 1177 2235 8 -536 -457 C ATOM 3090 NH1AARG B 49 17.034 50.587 66.665 0.03 23.09 N ANISOU 3090 NH1AARG B 49 4160 2618 1997 928 -122 -706 N ATOM 3091 NH1BARG B 49 25.639 49.965 55.106 0.02 15.47 N ANISOU 3091 NH1BARG B 49 2546 1103 2230 -38 -510 -395 N ATOM 3092 NH2AARG B 49 18.709 49.227 67.438 0.03 22.60 N ANISOU 3092 NH2AARG B 49 4045 2615 1927 826 -212 -621 N ATOM 3093 NH2BARG B 49 25.174 49.725 57.349 0.02 16.37 N ANISOU 3093 NH2BARG B 49 2750 1279 2190 48 -547 -464 N ATOM 3094 H AARG B 49 24.058 49.750 62.260 0.05 18.92 H ANISOU 3094 H AARG B 49 3312 1768 2109 290 -575 -609 H ATOM 3095 H BARG B 49 21.118 50.811 60.670 0.05 18.17 H ANISOU 3095 H BARG B 49 3241 1577 2086 360 -417 -620 H ATOM 3096 HA AARG B 49 21.531 50.366 61.523 0.05 18.60 H ANISOU 3096 HA AARG B 49 3317 1684 2065 393 -422 -626 H ATOM 3097 HA BARG B 49 23.244 52.378 60.090 0.05 18.92 H ANISOU 3097 HA BARG B 49 3363 1533 2293 219 -609 -712 H ATOM 3098 HB2AARG B 49 21.409 49.389 63.516 0.05 19.53 H ANISOU 3098 HB2AARG B 49 3468 1955 1998 468 -426 -600 H ATOM 3099 HB2BARG B 49 20.839 52.273 58.627 0.05 17.71 H ANISOU 3099 HB2BARG B 49 3176 1360 2194 297 -426 -642 H ATOM 3100 HB3AARG B 49 22.775 50.021 64.011 0.05 20.53 H ANISOU 3100 HB3AARG B 49 3671 2032 2099 444 -552 -709 H ATOM 3101 HB3BARG B 49 21.872 53.477 58.470 0.05 18.40 H ANISOU 3101 HB3BARG B 49 3308 1349 2334 233 -531 -708 H ATOM 3102 HG2AARG B 49 21.794 51.919 64.692 0.05 21.11 H ANISOU 3102 HG2AARG B 49 3842 2040 2139 555 -466 -799 H ATOM 3103 HG2BARG B 49 22.558 50.804 57.920 0.05 16.59 H ANISOU 3103 HG2BARG B 49 2905 1257 2142 180 -446 -538 H ATOM 3104 HG3AARG B 49 20.454 51.610 63.893 0.05 20.19 H ANISOU 3104 HG3AARG B 49 3639 1998 2033 580 -343 -681 H ATOM 3105 HG3BARG B 49 22.013 51.762 56.773 0.05 16.66 H ANISOU 3105 HG3BARG B 49 2937 1167 2225 160 -452 -563 H ATOM 3106 HD2AARG B 49 20.702 49.614 65.675 0.05 21.52 H ANISOU 3106 HD2AARG B 49 3868 2316 1992 642 -390 -679 H ATOM 3107 HD2BARG B 49 23.844 53.194 57.211 0.05 17.77 H ANISOU 3107 HD2BARG B 49 3104 1245 2404 60 -611 -629 H ATOM 3108 HD3AARG B 49 21.050 50.944 66.481 0.05 22.56 H ANISOU 3108 HD3AARG B 49 4104 2372 2095 650 -489 -820 H ATOM 3109 HD3BARG B 49 24.443 52.065 58.162 0.05 17.71 H ANISOU 3109 HD3BARG B 49 3071 1342 2317 85 -612 -607 H ATOM 3110 HE AARG B 49 18.905 51.652 65.604 0.05 22.40 H ANISOU 3110 HE AARG B 49 4087 2348 2077 772 -306 -805 H ATOM 3111 HE BARG B 49 24.276 51.909 55.446 0.05 16.25 H ANISOU 3111 HE BARG B 49 2771 1094 2308 2 -528 -494 H ATOM 3112 HH11AARG B 49 16.770 51.229 66.159 0.05 23.15 H ANISOU 3112 HH11AARG B 49 4189 2570 2039 940 -125 -753 H ATOM 3113 HH11BARG B 49 25.592 50.424 54.382 0.05 15.34 H ANISOU 3113 HH11BARG B 49 2521 1049 2259 -63 -500 -386 H ATOM 3114 HH12AARG B 49 16.476 50.183 67.178 0.05 23.40 H ANISOU 3114 HH12AARG B 49 4190 2729 1973 979 -58 -662 H ATOM 3115 HH12BARG B 49 26.021 49.194 55.103 0.05 15.25 H ANISOU 3115 HH12BARG B 49 2480 1115 2200 -40 -500 -363 H ATOM 3116 HH21AARG B 49 19.533 48.983 67.442 0.05 22.34 H ANISOU 3116 HH21AARG B 49 3994 2570 1923 771 -271 -612 H ATOM 3117 HH21BARG B 49 24.832 50.021 58.076 0.05 16.82 H ANISOU 3117 HH21BARG B 49 2858 1341 2192 83 -561 -505 H ATOM 3118 HH22AARG B 49 18.142 48.829 67.948 0.05 22.90 H ANISOU 3118 HH22AARG B 49 4079 2720 1904 876 -150 -576 H ATOM 3119 HH22BARG B 49 25.560 48.960 57.341 0.05 16.13 H ANISOU 3119 HH22BARG B 49 2680 1288 2161 43 -539 -426 H ATOM 3120 N AHIS B 50 21.673 52.826 61.420 0.03 19.59 N ANISOU 3120 N AHIS B 50 3544 1644 2257 353 -540 -770 N ATOM 3121 N BHIS B 50 22.411 54.215 61.500 0.02 20.80 N ANISOU 3121 N BHIS B 50 3790 1702 2412 330 -655 -884 N ATOM 3122 CA AHIS B 50 21.936 54.240 61.201 0.03 20.35 C ANISOU 3122 CA AHIS B 50 3707 1627 2397 327 -616 -855 C ATOM 3123 CA BHIS B 50 21.915 55.272 62.392 0.02 21.98 C ANISOU 3123 CA BHIS B 50 4057 1796 2499 404 -676 -992 C ATOM 3124 C AHIS B 50 20.672 55.036 60.885 0.03 20.47 C ANISOU 3124 C AHIS B 50 3766 1587 2424 396 -552 -881 C ATOM 3125 C BHIS B 50 20.863 56.080 61.664 0.02 21.61 C ANISOU 3125 C BHIS B 50 4008 1676 2527 429 -610 -980 C ATOM 3126 O AHIS B 50 19.628 54.471 60.557 0.03 19.89 O ANISOU 3126 O AHIS B 50 3656 1568 2335 454 -451 -826 O ATOM 3127 O BHIS B 50 20.759 56.024 60.445 0.02 20.65 O ANISOU 3127 O BHIS B 50 3808 1525 2512 365 -585 -906 O ATOM 3128 CB AHIS B 50 22.894 54.369 60.036 0.03 19.85 C ANISOU 3128 CB AHIS B 50 3577 1499 2465 211 -667 -816 C ATOM 3129 CB BHIS B 50 23.039 56.212 62.921 0.02 23.16 C ANISOU 3129 CB BHIS B 50 4280 1851 2670 346 -816 -1093 C ATOM 3130 CG AHIS B 50 22.324 53.876 58.747 0.03 18.66 C ANISOU 3130 CG AHIS B 50 3345 1348 2396 191 -583 -726 C ATOM 3131 CG BHIS B 50 23.638 57.141 61.898 0.02 22.80 C ANISOU 3131 CG BHIS B 50 4180 1705 2778 228 -868 -1062 C ATOM 3132 ND1AHIS B 50 22.029 54.727 57.718 0.03 18.49 N ANISOU 3132 ND1AHIS B 50 3315 1237 2473 148 -585 -714 N ATOM 3133 ND1BHIS B 50 23.073 57.391 60.664 0.02 22.33 N ANISOU 3133 ND1BHIS B 50 4105 1563 2815 219 -818 -1031 N ATOM 3134 CD2AHIS B 50 21.999 52.630 58.314 0.03 17.68 C ANISOU 3134 CD2AHIS B 50 3149 1302 2268 206 -502 -644 C ATOM 3135 CD2BHIS B 50 24.763 57.896 61.947 0.02 22.89 C ANISOU 3135 CD2BHIS B 50 4137 1696 2864 115 -960 -1042 C ATOM 3136 CE1AHIS B 50 21.523 54.051 56.708 0.03 17.47 C ANISOU 3136 CE1AHIS B 50 3115 1138 2386 145 -508 -634 C ATOM 3137 CE1BHIS B 50 23.828 58.245 59.995 0.02 22.16 C ANISOU 3137 CE1BHIS B 50 4030 1475 2915 106 -873 -994 C ATOM 3138 NE2AHIS B 50 21.508 52.764 57.035 0.03 16.97 N ANISOU 3138 NE2AHIS B 50 3011 1171 2265 175 -460 -594 N ATOM 3139 NE2BHIS B 50 24.858 58.572 60.755 0.02 22.50 N ANISOU 3139 NE2BHIS B 50 4043 1555 2950 41 -957 -999 N ATOM 3140 H AHIS B 50 20.884 52.580 61.187 0.05 19.07 H ANISOU 3140 H AHIS B 50 3448 1586 2212 371 -476 -730 H ATOM 3141 H BHIS B 50 23.239 54.312 61.290 0.05 20.90 H ANISOU 3141 H BHIS B 50 3784 1696 2460 269 -717 -886 H ATOM 3142 HA AHIS B 50 22.356 54.617 61.992 0.05 21.20 H ANISOU 3142 HA AHIS B 50 3874 1734 2447 340 -676 -919 H ATOM 3143 HA BHIS B 50 21.496 54.870 63.169 0.05 22.37 H ANISOU 3143 HA BHIS B 50 4141 1910 2449 476 -645 -1009 H ATOM 3144 HB2AHIS B 50 23.128 55.303 59.920 0.05 20.43 H ANISOU 3144 HB2AHIS B 50 3694 1493 2574 189 -719 -867 H ATOM 3145 HB2BHIS B 50 22.657 56.761 63.621 0.05 23.92 H ANISOU 3145 HB2BHIS B 50 4457 1901 2731 401 -822 -1164 H ATOM 3146 HB3AHIS B 50 23.692 53.849 60.216 0.05 19.83 H ANISOU 3146 HB3AHIS B 50 3540 1533 2460 171 -706 -798 H ATOM 3147 HB3BHIS B 50 23.756 55.675 63.295 0.05 23.56 H ANISOU 3147 HB3BHIS B 50 4337 1949 2664 336 -867 -1109 H ATOM 3148 HD2AHIS B 50 22.092 51.845 58.798 0.05 17.60 H ANISOU 3148 HD2AHIS B 50 3127 1357 2204 232 -481 -625 H ATOM 3149 HD2BHIS B 50 25.358 57.948 62.658 0.05 23.22 H ANISOU 3149 HD2BHIS B 50 4172 1782 2870 94 -1014 -1053 H ATOM 3150 HE1AHIS B 50 21.259 54.417 55.900 0.05 17.22 H ANISOU 3150 HE1AHIS B 50 3065 1063 2413 121 -495 -609 H ATOM 3151 HE1BHIS B 50 23.658 58.562 59.137 0.05 21.91 H ANISOU 3151 HE1BHIS B 50 3981 1384 2959 80 -855 -964 H ATOM 3152 N ASER B 51 20.800 56.357 60.972 0.03 21.31 N ANISOU 3152 N ASER B 51 3948 1581 2568 386 -617 -962 N ATOM 3153 N BSER B 51 20.105 56.860 62.423 0.02 22.51 N ANISOU 3153 N BSER B 51 4214 1760 2580 527 -587 -1055 N ATOM 3154 CA ASER B 51 19.731 57.305 60.604 0.03 21.66 C ANISOU 3154 CA ASER B 51 4044 1551 2633 455 -572 -995 C ATOM 3155 CA BSER B 51 19.153 57.787 61.817 0.02 22.52 C ANISOU 3155 CA BSER B 51 4232 1668 2656 556 -550 -1062 C ATOM 3156 C ASER B 51 20.284 58.534 59.883 0.03 22.14 C ANISOU 3156 C ASER B 51 4141 1464 2806 384 -653 -1032 C ATOM 3157 C BSER B 51 19.877 58.901 61.061 0.02 22.75 C ANISOU 3157 C BSER B 51 4277 1560 2808 452 -647 -1087 C ATOM 3158 O ASER B 51 21.478 58.841 59.985 0.03 22.62 O ANISOU 3158 O ASER B 51 4215 1480 2900 297 -756 -1065 O ATOM 3159 O BSER B 51 20.998 59.293 61.425 0.02 23.61 O ANISOU 3159 O BSER B 51 4439 1623 2910 400 -756 -1157 O ATOM 3160 CB ASER B 51 18.925 57.739 61.835 0.03 22.82 C ANISOU 3160 CB ASER B 51 4294 1725 2652 583 -551 -1085 C ATOM 3161 CB BSER B 51 18.223 58.367 62.875 0.02 23.78 C ANISOU 3161 CB BSER B 51 4502 1815 2718 689 -524 -1158 C ATOM 3162 OG ASER B 51 19.768 58.172 62.880 0.03 23.68 O ANISOU 3162 OG ASER B 51 4461 1870 2665 580 -629 -1153 O ATOM 3163 OG BSER B 51 18.857 58.393 64.130 0.02 24.86 O ANISOU 3163 OG BSER B 51 4722 1983 2740 713 -592 -1246 O ATOM 3164 H ASER B 51 21.515 56.744 61.246 0.05 21.76 H ANISOU 3164 H ASER B 51 4027 1597 2644 339 -691 -997 H ATOM 3165 H BSER B 51 20.122 56.869 63.283 0.05 23.19 H ANISOU 3165 H BSER B 51 4354 1879 2579 584 -591 -1103 H ATOM 3166 HA ASER B 51 19.129 56.850 59.990 0.05 20.90 H ANISOU 3166 HA ASER B 51 3892 1485 2566 468 -501 -930 H ATOM 3167 HA BSER B 51 18.610 57.315 61.172 0.05 21.70 H ANISOU 3167 HA BSER B 51 4061 1596 2586 559 -481 -990 H ATOM 3168 HB2ASER B 51 18.339 58.474 61.593 0.05 23.44 H ANISOU 3168 HB2ASER B 51 4432 1720 2753 611 -566 -1139 H ATOM 3169 HB2BSER B 51 17.977 59.267 62.612 0.05 24.20 H ANISOU 3169 HB2BSER B 51 4599 1773 2824 696 -544 -1197 H ATOM 3170 HB3ASER B 51 18.409 56.995 62.164 0.05 22.48 H ANISOU 3170 HB3ASER B 51 4220 1755 2566 642 -469 -1043 H ATOM 3171 HB3BSER B 51 17.436 57.814 62.950 0.05 23.49 H ANISOU 3171 HB3BSER B 51 4434 1849 2642 753 -438 -1117 H ATOM 3172 HG ASER B 51 20.216 58.836 62.628 0.05 24.33 H ANISOU 3172 HG ASER B 51 4596 1880 2767 556 -699 -1214 H ATOM 3173 HG BSER B 51 18.851 57.626 64.469 0.05 24.71 H ANISOU 3173 HG BSER B 51 4682 2054 2652 747 -550 -1218 H ATOM 3174 N AHIS B 52 19.399 59.244 59.177 0.03 22.11 N ANISOU 3174 N AHIS B 52 4150 1387 2864 420 -608 -1021 N ATOM 3175 N BHIS B 52 19.226 59.362 59.993 0.02 22.04 N ANISOU 3175 N BHIS B 52 4133 1412 2830 415 -613 -1020 N ATOM 3176 CA AHIS B 52 19.822 60.317 58.272 0.03 22.47 C ANISOU 3176 CA AHIS B 52 4216 1290 3032 346 -671 -1025 C ATOM 3177 CA BHIS B 52 19.757 60.401 59.104 0.02 22.52 C ANISOU 3177 CA BHIS B 52 4221 1329 3006 336 -689 -1037 C ATOM 3178 C AHIS B 52 18.710 61.197 57.720 0.03 22.81 C ANISOU 3178 C AHIS B 52 4301 1242 3124 414 -628 -1028 C ATOM 3179 C BHIS B 52 18.622 61.245 58.519 0.02 23.04 C ANISOU 3179 C BHIS B 52 4348 1304 3102 418 -650 -1064 C ATOM 3180 O AHIS B 52 17.544 60.786 57.608 0.03 22.28 O ANISOU 3180 O AHIS B 52 4199 1239 3028 498 -531 -985 O ATOM 3181 O BHIS B 52 17.448 60.999 58.806 0.02 23.41 O ANISOU 3181 O BHIS B 52 4438 1392 3063 542 -587 -1103 O ATOM 3182 CB AHIS B 52 20.578 59.732 57.086 0.03 21.42 C ANISOU 3182 CB AHIS B 52 3971 1173 2994 224 -676 -919 C ATOM 3183 CB BHIS B 52 20.610 59.781 57.977 0.02 21.55 C ANISOU 3183 CB BHIS B 52 3991 1203 2994 209 -702 -935 C ATOM 3184 CG AHIS B 52 19.916 58.536 56.495 0.03 20.07 C ANISOU 3184 CG AHIS B 52 3701 1109 2814 244 -574 -819 C ATOM 3185 CG BHIS B 52 19.836 58.977 56.975 0.02 20.16 C ANISOU 3185 CG BHIS B 52 3713 1119 2830 217 -601 -827 C ATOM 3186 ND1AHIS B 52 18.658 58.546 55.918 0.03 19.66 N ANISOU 3186 ND1AHIS B 52 3633 1058 2780 307 -495 -777 N ATOM 3187 ND1BHIS B 52 19.117 59.557 55.950 0.02 19.79 N ANISOU 3187 ND1BHIS B 52 3653 1060 2805 275 -525 -786 N ATOM 3188 CD2AHIS B 52 20.354 57.261 56.422 0.03 19.13 C ANISOU 3188 CD2AHIS B 52 3497 1097 2676 207 -547 -756 C ATOM 3189 CD2BHIS B 52 19.723 57.635 56.803 0.02 19.17 C ANISOU 3189 CD2BHIS B 52 3492 1089 2701 169 -574 -752 C ATOM 3190 CE1AHIS B 52 18.360 57.314 55.519 0.03 18.55 C ANISOU 3190 CE1AHIS B 52 3401 1018 2630 299 -429 -695 C ATOM 3191 CE1BHIS B 52 18.560 58.611 55.215 0.02 18.63 C ANISOU 3191 CE1BHIS B 52 3411 1002 2666 258 -461 -697 C ATOM 3192 NE2AHIS B 52 19.376 56.522 55.800 0.03 18.21 N ANISOU 3192 NE2AHIS B 52 3318 1035 2565 241 -456 -682 N ATOM 3193 NE2BHIS B 52 18.911 57.434 55.710 0.02 18.24 N ANISOU 3193 NE2BHIS B 52 3314 1014 2601 196 -486 -677 N ATOM 3194 H AHIS B 52 18.549 59.129 59.216 0.05 21.95 H ANISOU 3194 H AHIS B 52 4126 1397 2819 486 -543 -1006 H ATOM 3195 H BHIS B 52 18.450 59.082 59.757 0.05 21.35 H ANISOU 3195 H BHIS B 52 3993 1366 2753 432 -547 -961 H ATOM 3196 HA AHIS B 52 20.432 60.896 58.754 0.05 23.33 H ANISOU 3196 HA AHIS B 52 4385 1344 3136 321 -748 -1093 H ATOM 3197 HA BHIS B 52 20.330 60.990 59.618 0.05 23.36 H ANISOU 3197 HA BHIS B 52 4385 1394 3096 316 -765 -1106 H ATOM 3198 HB2AHIS B 52 20.649 60.407 56.392 0.05 21.62 H ANISOU 3198 HB2AHIS B 52 4003 1113 3099 185 -699 -905 H ATOM 3199 HB2BHIS B 52 21.051 60.498 57.498 0.05 21.88 H ANISOU 3199 HB2BHIS B 52 4048 1152 3112 170 -732 -933 H ATOM 3200 HB3AHIS B 52 21.463 59.463 57.373 0.05 21.50 H ANISOU 3200 HB3AHIS B 52 3965 1208 2995 171 -726 -928 H ATOM 3201 HB3BHIS B 52 21.272 59.190 58.369 0.05 21.61 H ANISOU 3201 HB3BHIS B 52 3979 1239 2992 156 -750 -940 H ATOM 3202 HD2AHIS B 52 21.173 56.950 56.729 0.05 19.18 H ANISOU 3202 HD2AHIS B 52 3488 1129 2669 165 -587 -761 H ATOM 3203 HD2BHIS B 52 20.102 56.987 57.344 0.05 19.18 H ANISOU 3203 HD2BHIS B 52 3474 1121 2692 127 -611 -753 H ATOM 3204 HE1AHIS B 52 17.580 57.045 55.091 0.05 18.14 H ANISOU 3204 HE1AHIS B 52 3317 989 2586 330 -375 -654 H ATOM 3205 HE1BHIS B 52 18.019 58.751 54.472 0.05 18.23 H ANISOU 3205 HE1BHIS B 52 3331 966 2628 287 -409 -656 H ATOM 3206 N AASN B 53 19.130 62.423 57.394 0.03 23.77 N ANISOU 3206 N AASN B 53 4491 1212 3328 373 -705 -1074 N ATOM 3207 N BASN B 53 18.984 62.211 57.677 0.02 23.20 N ANISOU 3207 N BASN B 53 4371 1203 3241 355 -685 -1038 N ATOM 3208 CA AASN B 53 18.380 63.393 56.601 0.03 24.11 C ANISOU 3208 CA AASN B 53 4564 1143 3453 408 -682 -1054 C ATOM 3209 CA BASN B 53 18.048 63.196 57.138 0.02 23.76 C ANISOU 3209 CA BASN B 53 4497 1175 3355 431 -654 -1051 C ATOM 3210 C AASN B 53 18.594 63.187 55.105 0.03 22.93 C ANISOU 3210 C AASN B 53 4304 1014 3393 337 -638 -920 C ATOM 3211 C BASN B 53 17.417 62.864 55.780 0.02 22.74 C ANISOU 3211 C BASN B 53 4281 1067 3292 433 -574 -935 C ATOM 3212 O AASN B 53 19.291 63.975 54.444 0.03 23.11 O ANISOU 3212 O AASN B 53 4316 942 3522 243 -686 -876 O ATOM 3213 O BASN B 53 16.269 63.207 55.520 0.02 23.05 O ANISOU 3213 O BASN B 53 4345 1075 3336 528 -524 -934 O ATOM 3214 CB AASN B 53 18.810 64.821 56.957 0.03 25.60 C ANISOU 3214 CB AASN B 53 4861 1151 3716 368 -789 -1135 C ATOM 3215 CB BASN B 53 18.749 64.547 57.005 0.02 25.03 C ANISOU 3215 CB BASN B 53 4746 1159 3603 375 -758 -1112 C ATOM 3216 CG AASN B 53 18.001 65.885 56.223 0.03 26.27 C ANISOU 3216 CG AASN B 53 5003 1107 3871 436 -766 -1132 C ATOM 3217 CG BASN B 53 17.794 65.705 57.104 0.02 26.38 C ANISOU 3217 CG BASN B 53 5045 1235 3745 496 -761 -1216 C ATOM 3218 OD1AASN B 53 17.089 66.482 56.794 0.03 27.63 O ANISOU 3218 OD1AASN B 53 5297 1181 4021 524 -794 -1238 O ATOM 3219 OD1BASN B 53 17.126 66.061 56.138 0.02 26.53 O ANISOU 3219 OD1BASN B 53 5077 1191 3814 560 -714 -1187 O ATOM 3220 ND2AASN B 53 18.340 66.142 54.963 0.03 25.46 N ANISOU 3220 ND2AASN B 53 4821 1000 3853 399 -720 -1011 N ATOM 3221 ND2BASN B 53 17.718 66.298 58.287 0.02 27.46 N ANISOU 3221 ND2BASN B 53 5278 1367 3788 542 -814 -1341 N ATOM 3222 H AASN B 53 19.897 62.727 57.632 0.05 24.32 H ANISOU 3222 H AASN B 53 4593 1236 3413 320 -778 -1115 H ATOM 3223 H BASN B 53 19.788 62.315 57.397 0.05 23.06 H ANISOU 3223 H BASN B 53 4322 1156 3282 270 -726 -1009 H ATOM 3224 HA AASN B 53 17.436 63.303 56.795 0.05 24.26 H ANISOU 3224 HA AASN B 53 4607 1187 3422 509 -627 -1074 H ATOM 3225 HA BASN B 53 17.323 63.307 57.774 0.05 24.19 H ANISOU 3225 HA BASN B 53 4598 1255 3338 527 -622 -1103 H ATOM 3226 HB2AASN B 53 18.685 64.954 57.910 0.05 26.38 H ANISOU 3226 HB2AASN B 53 5031 1241 3752 404 -828 -1226 H ATOM 3227 HB2BASN B 53 19.405 64.640 57.714 0.05 25.37 H ANISOU 3227 HB2BASN B 53 4803 1195 3639 313 -826 -1149 H ATOM 3228 HB3AASN B 53 19.745 64.945 56.725 0.05 25.48 H ANISOU 3228 HB3AASN B 53 4810 1105 3767 263 -839 -1099 H ATOM 3229 HB3BASN B 53 19.183 64.585 56.138 0.05 24.73 H ANISOU 3229 HB3BASN B 53 4670 1074 3651 321 -755 -1045 H ATOM 3230 HD21AASN B 53 17.766 66.499 54.428 0.05 25.64 H ANISOU 3230 HD21AASN B 53 4860 986 3897 457 -687 -996 H ATOM 3231 HD21BASN B 53 17.729 67.153 58.343 0.05 28.39 H ANISOU 3231 HD21BASN B 53 5480 1419 3889 610 -826 -1411 H ATOM 3232 HD22AASN B 53 19.130 65.951 54.682 0.05 24.80 H ANISOU 3232 HD22AASN B 53 4671 952 3800 320 -723 -949 H ATOM 3233 HD22BASN B 53 17.668 65.820 59.001 0.05 27.27 H ANISOU 3233 HD22BASN B 53 5237 1407 3719 507 -839 -1352 H ATOM 3234 N AGLU B 54 18.021 62.105 54.605 0.03 21.81 N ANISOU 3234 N AGLU B 54 4082 1001 3206 381 -547 -853 N ATOM 3235 N BGLU B 54 18.174 62.240 54.893 0.02 21.68 N ANISOU 3235 N BGLU B 54 4047 981 3209 332 -568 -839 N ATOM 3236 CA AGLU B 54 17.853 61.860 53.183 0.03 20.84 C ANISOU 3236 CA AGLU B 54 3869 904 3146 345 -497 -739 C ATOM 3237 CA BGLU B 54 17.648 62.003 53.545 0.02 20.74 C ANISOU 3237 CA BGLU B 54 3847 899 3134 335 -497 -732 C ATOM 3238 C AGLU B 54 16.820 60.742 53.064 0.03 19.97 C ANISOU 3238 C AGLU B 54 3693 928 2968 421 -403 -697 C ATOM 3239 C BGLU B 54 16.455 61.041 53.542 0.02 20.16 C ANISOU 3239 C BGLU B 54 3733 944 2984 438 -404 -713 C ATOM 3240 O AGLU B 54 17.023 59.633 53.571 0.03 19.48 O ANISOU 3240 O AGLU B 54 3596 972 2834 423 -381 -702 O ATOM 3241 O BGLU B 54 16.244 60.295 54.500 0.02 20.03 O ANISOU 3241 O BGLU B 54 3712 1019 2880 473 -383 -747 O ATOM 3242 CB AGLU B 54 19.179 61.495 52.475 0.03 20.22 C ANISOU 3242 CB AGLU B 54 3719 839 3125 209 -534 -673 C ATOM 3243 CB BGLU B 54 18.728 61.496 52.577 0.02 19.74 C ANISOU 3243 CB BGLU B 54 3623 828 3050 219 -501 -644 C ATOM 3244 CG AGLU B 54 19.125 61.723 50.933 0.03 19.80 C ANISOU 3244 CG AGLU B 54 3612 754 3159 161 -511 -569 C ATOM 3245 CG BGLU B 54 20.199 61.753 52.931 0.02 20.25 C ANISOU 3245 CG BGLU B 54 3696 811 3189 102 -586 -645 C ATOM 3246 CD AGLU B 54 20.474 61.952 50.226 0.03 19.95 C ANISOU 3246 CD AGLU B 54 3600 719 3263 32 -565 -518 C ATOM 3247 CD BGLU B 54 20.957 60.438 53.121 0.02 20.07 C ANISOU 3247 CD BGLU B 54 3642 861 3122 47 -625 -671 C ATOM 3248 OE1AGLU B 54 20.449 62.317 48.990 0.03 19.85 O ANISOU 3248 OE1AGLU B 54 3556 671 3315 1 -544 -432 O ATOM 3249 OE1BGLU B 54 21.651 60.276 54.148 0.02 21.05 O ANISOU 3249 OE1BGLU B 54 3830 926 3241 25 -707 -752 O ATOM 3250 OE2AGLU B 54 21.532 61.814 50.900 0.03 20.30 O ANISOU 3250 OE2AGLU B 54 3647 756 3311 -36 -627 -558 O ATOM 3251 OE2BGLU B 54 20.852 59.561 52.239 0.02 19.04 O ANISOU 3251 OE2BGLU B 54 3426 843 2965 29 -579 -611 O ATOM 3252 H AGLU B 54 17.699 61.477 55.095 0.05 21.67 H ANISOU 3252 H AGLU B 54 4060 1056 3118 432 -515 -872 H ATOM 3253 H BGLU B 54 18.965 61.959 55.050 0.05 21.54 H ANISOU 3253 H BGLU B 54 4008 976 3200 264 -606 -834 H ATOM 3254 HA AGLU B 54 17.483 62.640 52.752 0.05 21.26 H ANISOU 3254 HA AGLU B 54 3950 879 3249 364 -500 -729 H ATOM 3255 HA BGLU B 54 17.324 62.846 53.196 0.05 21.17 H ANISOU 3255 HA BGLU B 54 3930 871 3243 344 -506 -723 H ATOM 3256 HB2AGLU B 54 19.900 62.031 52.842 0.05 20.83 H ANISOU 3256 HB2AGLU B 54 3832 858 3225 160 -598 -713 H ATOM 3257 HB2BGLU B 54 18.618 60.538 52.485 0.05 19.23 H ANISOU 3257 HB2BGLU B 54 3522 851 2932 221 -481 -642 H ATOM 3258 HB3AGLU B 54 19.361 60.553 52.609 0.05 19.53 H ANISOU 3258 HB3AGLU B 54 3579 846 2995 202 -507 -652 H ATOM 3259 HB3BGLU B 54 18.565 61.913 51.717 0.05 19.30 H ANISOU 3259 HB3BGLU B 54 3526 781 3025 219 -464 -580 H ATOM 3260 HG2AGLU B 54 18.691 60.966 50.506 0.05 19.01 H ANISOU 3260 HG2AGLU B 54 3452 735 3034 175 -459 -520 H ATOM 3261 HG2BGLU B 54 20.623 62.222 52.196 0.05 19.91 H ANISOU 3261 HG2BGLU B 54 3605 761 3198 53 -574 -574 H ATOM 3262 HG3AGLU B 54 18.612 62.521 50.789 0.05 20.34 H ANISOU 3262 HG3AGLU B 54 3725 751 3252 204 -510 -578 H ATOM 3263 HG3BGLU B 54 20.290 62.275 53.737 0.05 21.16 H ANISOU 3263 HG3BGLU B 54 3881 832 3327 111 -631 -697 H ATOM 3264 N TYR B 55 15.690 61.068 52.454 0.05 19.92 N ANISOU 3264 N TYR B 55 3668 912 2988 484 -352 -652 N ATOM 3265 CA TYR B 55 14.617 60.106 52.210 0.05 19.17 C ANISOU 3265 CA TYR B 55 3494 938 2852 541 -269 -597 C ATOM 3266 C TYR B 55 15.211 58.839 51.613 0.05 17.98 C ANISOU 3266 C TYR B 55 3251 875 2705 450 -258 -525 C ATOM 3267 O TYR B 55 16.223 58.878 50.919 0.05 17.68 O ANISOU 3267 O TYR B 55 3197 803 2720 355 -298 -492 O ATOM 3268 CB TYR B 55 13.616 60.670 51.229 0.05 19.32 C ANISOU 3268 CB TYR B 55 3495 925 2922 597 -236 -545 C ATOM 3269 CG TYR B 55 12.924 61.905 51.752 0.05 20.60 C ANISOU 3269 CG TYR B 55 3751 987 3091 697 -245 -613 C ATOM 3270 CD1 TYR B 55 13.402 63.183 51.449 0.05 21.30 C ANISOU 3270 CD1 TYR B 55 3898 935 3262 680 -294 -611 C ATOM 3271 CD2 TYR B 55 11.816 61.812 52.578 0.05 21.27 C ANISOU 3271 CD2 TYR B 55 3873 1109 3097 809 -206 -683 C ATOM 3272 CE1 TYR B 55 12.790 64.313 51.943 0.05 22.59 C ANISOU 3272 CE1 TYR B 55 4157 992 3435 775 -307 -680 C ATOM 3273 CE2 TYR B 55 11.193 62.953 53.065 0.05 22.58 C ANISOU 3273 CE2 TYR B 55 4135 1179 3264 911 -214 -757 C ATOM 3274 CZ TYR B 55 11.686 64.203 52.745 0.05 23.22 C ANISOU 3274 CZ TYR B 55 4275 1113 3434 893 -266 -757 C ATOM 3275 OH TYR B 55 11.104 65.368 53.232 0.05 24.64 O ANISOU 3275 OH TYR B 55 4559 1182 3621 1000 -277 -836 O ATOM 3276 H ATYR B 55 15.514 61.857 52.170 0.05 20.36 H ANISOU 3276 H ATYR B 55 3754 892 3090 493 -367 -650 H ATOM 3277 H BTYR B 55 15.787 61.636 51.822 0.05 20.24 H ANISOU 3277 H BTYR B 55 3728 881 3081 480 -367 -639 H ATOM 3278 HA TYR B 55 14.159 59.875 53.032 0.05 19.40 H ANISOU 3278 HA TYR B 55 3538 1014 2821 602 -242 -635 H ATOM 3279 HB2 TYR B 55 14.079 60.896 50.409 0.05 19.09 H ANISOU 3279 HB2 TYR B 55 3450 858 2946 537 -259 -500 H ATOM 3280 HB3 TYR B 55 12.938 60.001 51.057 0.05 18.92 H ANISOU 3280 HB3 TYR B 55 3389 955 2846 632 -187 -511 H ATOM 3281 HD1 TYR B 55 14.148 63.261 50.907 0.05 20.95 H ANISOU 3281 HD1 TYR B 55 3827 867 3265 607 -316 -559 H ATOM 3282 HD2 TYR B 55 11.480 60.981 52.797 0.05 20.89 H ANISOU 3282 HD2 TYR B 55 3787 1153 2995 819 -172 -678 H ATOM 3283 HE1 TYR B 55 13.119 65.148 51.727 0.05 23.10 H ANISOU 3283 HE1 TYR B 55 4261 956 3561 762 -340 -673 H ATOM 3284 HE2 TYR B 55 10.452 62.885 53.617 0.05 23.09 H ANISOU 3284 HE2 TYR B 55 4226 1276 3271 994 -181 -803 H ATOM 3285 HH TYR B 55 10.538 65.182 53.826 0.05 24.93 H ANISOU 3285 HH TYR B 55 4605 1269 3598 1075 -240 -873 H ATOM 3286 N GLU B 56 14.573 57.703 51.917 0.05 17.41 N ANISOU 3286 N GLU B 56 3119 918 2578 484 -200 -500 N ATOM 3287 CA GLU B 56 15.066 56.403 51.458 0.05 16.39 C ANISOU 3287 CA GLU B 56 2911 868 2448 409 -188 -440 C ATOM 3288 C GLU B 56 13.884 55.483 51.365 0.05 15.98 C ANISOU 3288 C GLU B 56 2792 913 2368 458 -121 -396 C ATOM 3289 O GLU B 56 12.973 55.528 52.169 0.05 16.46 O ANISOU 3289 O GLU B 56 2863 1009 2384 543 -80 -418 O ATOM 3290 CB GLU B 56 16.120 55.900 52.449 0.05 16.35 C ANISOU 3290 CB GLU B 56 2923 888 2403 363 -223 -479 C ATOM 3291 CG GLU B 56 16.792 54.591 52.047 0.05 15.43 C ANISOU 3291 CG GLU B 56 2733 838 2293 291 -216 -423 C ATOM 3292 CD GLU B 56 18.279 54.510 52.449 0.05 15.49 C ANISOU 3292 CD GLU B 56 2752 861 2274 241 -261 -452 C ATOM 3293 OE1 GLU B 56 19.002 53.619 51.866 0.05 14.89 O ANISOU 3293 OE1 GLU B 56 2620 817 2220 176 -267 -408 O ATOM 3294 OE2 GLU B 56 18.688 55.343 53.329 0.05 16.23 O ANISOU 3294 OE2 GLU B 56 2909 936 2321 274 -292 -521 O ATOM 3295 H GLU B 56 13.854 57.658 52.380 0.05 17.66 H ANISOU 3295 H GLU B 56 3154 981 2574 548 -167 -514 H ATOM 3296 HA GLU B 56 15.462 56.507 50.591 0.05 16.13 H ANISOU 3296 HA GLU B 56 2858 807 2461 360 -204 -404 H ATOM 3297 HB2 GLU B 56 16.804 56.577 52.526 0.05 16.74 H ANISOU 3297 HB2 GLU B 56 3013 872 2476 331 -271 -509 H ATOM 3298 HB3 GLU B 56 15.697 55.767 53.310 0.05 16.65 H ANISOU 3298 HB3 GLU B 56 2980 959 2385 415 -205 -511 H ATOM 3299 HG2 GLU B 56 16.322 53.871 52.496 0.05 15.14 H ANISOU 3299 HG2 GLU B 56 2660 861 2230 319 -173 -398 H ATOM 3300 HG3 GLU B 56 16.720 54.494 51.087 0.05 15.17 H ANISOU 3300 HG3 GLU B 56 2676 780 2306 249 -224 -387 H ATOM 3301 N LEU B 57 13.930 54.597 50.362 0.05 15.18 N ANISOU 3301 N LEU B 57 2619 855 2293 401 -110 -330 N ATOM 3302 CA LEU B 57 13.020 53.450 50.371 0.05 14.79 C ANISOU 3302 CA LEU B 57 2498 898 2223 423 -58 -286 C ATOM 3303 C LEU B 57 13.750 52.224 49.891 0.05 14.00 C ANISOU 3303 C LEU B 57 2350 839 2129 344 -65 -249 C ATOM 3304 O LEU B 57 14.724 52.310 49.176 0.05 13.69 O ANISOU 3304 O LEU B 57 2316 767 2119 281 -98 -240 O ATOM 3305 CB LEU B 57 11.777 53.687 49.558 0.05 14.96 C ANISOU 3305 CB LEU B 57 2480 928 2276 469 -33 -245 C ATOM 3306 CG LEU B 57 11.983 53.926 48.090 0.05 14.47 C ANISOU 3306 CG LEU B 57 2350 897 2252 432 -33 -180 C ATOM 3307 CD1 LEU B 57 12.113 52.566 47.240 0.05 14.38 C ANISOU 3307 CD1 LEU B 57 2262 970 2231 449 7 -142 C ATOM 3308 CD2 LEU B 57 10.781 54.673 47.609 0.05 14.96 C ANISOU 3308 CD2 LEU B 57 2431 900 2352 470 -49 -166 C ATOM 3309 H LEU B 57 14.471 54.622 49.703 0.05 14.92 H ANISOU 3309 H LEU B 57 2578 800 2289 352 -131 -311 H ATOM 3310 HA LEU B 57 12.743 53.277 51.282 0.05 15.06 H ANISOU 3310 HA LEU B 57 2541 963 2216 462 -36 -307 H ATOM 3311 HB2 LEU B 57 11.219 52.892 49.633 0.05 15.26 H ANISOU 3311 HB2 LEU B 57 2503 1004 2289 522 2 -248 H ATOM 3312 HB3 LEU B 57 11.300 54.452 49.924 0.05 15.36 H ANISOU 3312 HB3 LEU B 57 2573 919 2346 491 -51 -263 H ATOM 3313 HG LEU B 57 12.773 54.453 47.948 0.05 14.02 H ANISOU 3313 HG LEU B 57 2288 837 2202 371 -53 -169 H ATOM 3314 HD11 LEU B 57 13.002 52.211 47.329 0.05 14.47 H ANISOU 3314 HD11 LEU B 57 2240 989 2267 460 4 -112 H ATOM 3315 HD12 LEU B 57 11.455 51.948 47.563 0.05 13.93 H ANISOU 3315 HD12 LEU B 57 2186 938 2169 400 3 -131 H ATOM 3316 HD13 LEU B 57 11.936 52.775 46.311 0.05 14.75 H ANISOU 3316 HD13 LEU B 57 2312 1039 2253 498 36 -157 H ATOM 3317 HD21 LEU B 57 10.807 55.571 47.986 0.05 15.03 H ANISOU 3317 HD21 LEU B 57 2486 851 2374 447 -77 -182 H ATOM 3318 HD22 LEU B 57 10.829 54.723 46.643 0.05 14.75 H ANISOU 3318 HD22 LEU B 57 2364 897 2343 453 -54 -125 H ATOM 3319 HD23 LEU B 57 9.962 54.234 47.878 0.05 15.45 H ANISOU 3319 HD23 LEU B 57 2499 965 2408 536 -28 -179 H ATOM 3320 N PHE B 58 13.239 51.074 50.340 0.05 13.79 N ANISOU 3320 N PHE B 58 2278 886 2075 353 -27 -226 N ATOM 3321 CA PHE B 58 13.757 49.766 49.942 0.05 13.15 C ANISOU 3321 CA PHE B 58 2154 842 2001 290 -29 -193 C ATOM 3322 C PHE B 58 12.712 49.068 49.083 0.05 12.94 C ANISOU 3322 C PHE B 58 2063 853 2002 285 -7 -142 C ATOM 3323 O PHE B 58 11.528 49.045 49.388 0.05 13.30 O ANISOU 3323 O PHE B 58 2076 934 2044 332 27 -124 O ATOM 3324 CB PHE B 58 13.997 48.834 51.148 0.05 13.20 C ANISOU 3324 CB PHE B 58 2161 896 1960 298 -10 -197 C ATOM 3325 CG PHE B 58 14.973 49.295 52.189 0.05 13.48 C ANISOU 3325 CG PHE B 58 2254 910 1957 298 -42 -247 C ATOM 3326 CD1 PHE B 58 15.873 50.305 51.950 0.05 13.62 C ANISOU 3326 CD1 PHE B 58 2317 863 1996 274 -91 -285 C ATOM 3327 CD2 PHE B 58 15.012 48.644 53.432 0.05 13.68 C ANISOU 3327 CD2 PHE B 58 2286 985 1927 317 -27 -249 C ATOM 3328 CE1 PHE B 58 16.770 50.690 52.920 0.05 14.00 C ANISOU 3328 CE1 PHE B 58 2413 893 2013 266 -132 -332 C ATOM 3329 CE2 PHE B 58 15.919 49.024 54.396 0.05 14.01 C ANISOU 3329 CE2 PHE B 58 2379 1017 1928 316 -66 -293 C ATOM 3330 CZ PHE B 58 16.782 50.062 54.154 0.05 14.21 C ANISOU 3330 CZ PHE B 58 2448 975 1975 290 -123 -341 C ATOM 3331 H PHE B 58 12.576 51.028 50.874 0.05 14.07 H ANISOU 3331 H PHE B 58 2306 949 2090 396 1 -226 H ATOM 3332 HA PHE B 58 14.571 49.852 49.427 0.05 12.91 H ANISOU 3332 HA PHE B 58 2133 784 1988 248 -56 -195 H ATOM 3333 HB2 PHE B 58 13.146 48.754 51.592 0.05 13.52 H ANISOU 3333 HB2 PHE B 58 2190 965 1981 342 22 -190 H ATOM 3334 HB3 PHE B 58 14.281 47.968 50.811 0.05 12.84 H ANISOU 3334 HB3 PHE B 58 2084 869 1925 261 -9 -171 H ATOM 3335 HD1 PHE B 58 15.867 50.736 51.128 0.05 13.55 H ANISOU 3335 HD1 PHE B 58 2305 821 2023 262 -99 -276 H ATOM 3336 HD2 PHE B 58 14.413 47.959 53.612 0.05 13.64 H ANISOU 3336 HD2 PHE B 58 2249 1021 1913 329 8 -215 H ATOM 3337 HE1 PHE B 58 17.362 51.379 52.742 0.05 14.18 H ANISOU 3337 HE1 PHE B 58 2462 868 2058 243 -168 -355 H ATOM 3338 HE2 PHE B 58 15.916 48.603 55.225 0.05 14.21 H ANISOU 3338 HE2 PHE B 58 2410 1080 1909 334 -56 -291 H ATOM 3339 HZ PHE B 58 17.394 50.317 54.804 0.05 14.51 H ANISOU 3339 HZ PHE B 58 2518 1006 1989 285 -157 -373 H ATOM 3340 N ILE B 59 13.225 48.425 48.046 0.05 12.46 N ANISOU 3340 N ILE B 59 1980 787 1965 226 -28 -122 N ATOM 3341 CA ILE B 59 12.449 47.517 47.196 0.05 12.28 C ANISOU 3341 CA ILE B 59 1903 797 1967 204 -23 -83 C ATOM 3342 C ILE B 59 13.017 46.100 47.422 0.05 11.96 C ANISOU 3342 C ILE B 59 1845 777 1921 162 -19 -74 C ATOM 3343 O ILE B 59 14.182 45.846 47.131 0.05 11.65 O ANISOU 3343 O ILE B 59 1828 719 1880 128 -37 -87 O ATOM 3344 CB ILE B 59 12.623 47.915 45.758 0.05 12.12 C ANISOU 3344 CB ILE B 59 1887 752 1967 176 -54 -74 C ATOM 3345 CG1 ILE B 59 12.082 49.322 45.574 0.05 12.52 C ANISOU 3345 CG1 ILE B 59 1959 769 2027 218 -62 -74 C ATOM 3346 CG2 ILE B 59 11.923 46.910 44.804 0.05 12.04 C ANISOU 3346 CG2 ILE B 59 1828 773 1973 149 -64 -45 C ATOM 3347 CD1 ILE B 59 12.407 49.896 44.305 0.05 12.44 C ANISOU 3347 CD1 ILE B 59 1973 725 2029 188 -91 -62 C ATOM 3348 H ILE B 59 14.035 48.497 47.797 0.05 12.28 H ANISOU 3348 H ILE B 59 1976 744 1945 198 -46 -131 H ATOM 3349 HA ILE B 59 11.517 47.541 47.440 0.05 12.56 H ANISOU 3349 HA ILE B 59 1911 854 2005 234 -5 -68 H ATOM 3350 HB ILE B 59 13.565 47.922 45.550 0.05 11.91 H ANISOU 3350 HB ILE B 59 1882 707 1937 149 -65 -84 H ATOM 3351 HG12 ILE B 59 11.125 49.288 45.642 0.05 12.73 H ANISOU 3351 HG12 ILE B 59 1957 818 2064 243 -56 -56 H ATOM 3352 HG13 ILE B 59 12.437 49.882 46.277 0.05 12.70 H ANISOU 3352 HG13 ILE B 59 2011 772 2041 241 -56 -97 H ATOM 3353 HG21 ILE B 59 12.150 47.101 43.886 0.05 11.97 H ANISOU 3353 HG21 ILE B 59 1829 755 1966 133 -84 -42 H ATOM 3354 HG22 ILE B 59 12.263 46.033 45.036 0.05 11.85 H ANISOU 3354 HG22 ILE B 59 1798 759 1947 125 -59 -47 H ATOM 3355 HG23 ILE B 59 10.969 46.948 44.948 0.05 12.30 H ANISOU 3355 HG23 ILE B 59 1831 827 2016 172 -56 -30 H ATOM 3356 HD11 ILE B 59 12.020 50.781 44.255 0.05 12.76 H ANISOU 3356 HD11 ILE B 59 2028 739 2079 217 -96 -58 H ATOM 3357 HD12 ILE B 59 13.372 49.946 44.215 0.05 12.29 H ANISOU 3357 HD12 ILE B 59 1977 687 2006 162 -96 -75 H ATOM 3358 HD13 ILE B 59 12.039 49.338 43.599 0.05 12.32 H ANISOU 3358 HD13 ILE B 59 1935 732 2014 169 -99 -44 H ATOM 3359 N VAL B 60 12.187 45.230 47.989 0.05 12.14 N ANISOU 3359 N VAL B 60 1828 837 1947 169 8 -46 N ATOM 3360 CA VAL B 60 12.671 43.896 48.392 0.05 11.98 C ANISOU 3360 CA VAL B 60 1798 827 1926 136 14 -32 C ATOM 3361 C VAL B 60 12.637 42.931 47.199 0.05 11.77 C ANISOU 3361 C VAL B 60 1749 788 1936 86 -10 -20 C ATOM 3362 O VAL B 60 11.619 42.748 46.572 0.05 11.97 O ANISOU 3362 O VAL B 60 1737 825 1989 77 -18 -2 O ATOM 3363 CB VAL B 60 11.869 43.383 49.561 0.05 12.40 C ANISOU 3363 CB VAL B 60 1822 921 1968 162 56 2 C ATOM 3364 CG1 VAL B 60 12.370 41.992 49.959 0.05 12.33 C ANISOU 3364 CG1 VAL B 60 1806 914 1967 127 61 28 C ATOM 3365 CG2 VAL B 60 11.961 44.324 50.770 0.05 12.73 C ANISOU 3365 CG2 VAL B 60 1900 979 1956 222 80 -21 C ATOM 3366 H VAL B 60 11.367 45.358 48.160 0.05 12.41 H ANISOU 3366 H VAL B 60 1838 890 1985 192 24 -32 H ATOM 3367 HA VAL B 60 13.590 43.969 48.681 0.05 11.82 H ANISOU 3367 HA VAL B 60 1809 795 1889 132 6 -50 H ATOM 3368 HB VAL B 60 10.947 43.303 49.296 0.05 12.62 H ANISOU 3368 HB VAL B 60 1811 966 2019 165 65 25 H ATOM 3369 HG11 VAL B 60 11.890 41.716 50.752 0.05 12.67 H ANISOU 3369 HG11 VAL B 60 1829 985 2001 144 91 58 H ATOM 3370 HG12 VAL B 60 12.188 41.388 49.228 0.05 12.23 H ANISOU 3370 HG12 VAL B 60 1774 885 1987 93 44 37 H ATOM 3371 HG13 VAL B 60 13.320 42.043 50.126 0.05 12.14 H ANISOU 3371 HG13 VAL B 60 1815 877 1922 126 49 8 H ATOM 3372 HG21 VAL B 60 12.891 44.517 50.948 0.05 12.54 H ANISOU 3372 HG21 VAL B 60 1915 932 1917 216 58 -52 H ATOM 3373 HG22 VAL B 60 11.476 45.139 50.580 0.05 12.96 H ANISOU 3373 HG22 VAL B 60 1924 1013 1987 253 89 -26 H ATOM 3374 HG23 VAL B 60 11.573 43.870 51.530 0.05 12.97 H ANISOU 3374 HG23 VAL B 60 1921 1039 1969 234 106 2 H ATOM 3375 N ILE B 61 13.810 42.422 46.894 0.05 11.47 N ANISOU 3375 N ILE B 61 1736 727 1894 60 -26 -37 N ATOM 3376 CA ILE B 61 14.014 41.656 45.657 0.05 11.35 C ANISOU 3376 CA ILE B 61 1719 693 1898 24 -51 -43 C ATOM 3377 C ILE B 61 14.024 40.145 45.864 0.05 11.46 C ANISOU 3377 C ILE B 61 1721 696 1937 -2 -50 -29 C ATOM 3378 O ILE B 61 13.400 39.473 45.045 0.05 11.64 O ANISOU 3378 O ILE B 61 1730 706 1985 -30 -73 -30 O ATOM 3379 CB ILE B 61 15.301 42.125 44.986 0.05 11.08 C ANISOU 3379 CB ILE B 61 1720 643 1847 20 -63 -69 C ATOM 3380 CG1 ILE B 61 15.077 43.540 44.406 0.05 11.11 C ANISOU 3380 CG1 ILE B 61 1735 644 1841 33 -72 -74 C ATOM 3381 CG2 ILE B 61 15.790 41.145 43.922 0.05 11.05 C ANISOU 3381 CG2 ILE B 61 1724 627 1849 -3 -77 -81 C ATOM 3382 CD1 ILE B 61 16.350 44.180 43.843 0.05 10.98 C ANISOU 3382 CD1 ILE B 61 1746 613 1813 26 -77 -85 C ATOM 3383 H ILE B 61 14.514 42.503 47.371 0.05 11.38 H ANISOU 3383 H ILE B 61 1745 712 1867 65 -23 -46 H ATOM 3384 HA ILE B 61 13.286 41.826 45.053 0.05 11.47 H ANISOU 3384 HA ILE B 61 1719 714 1924 21 -63 -39 H ATOM 3385 HB ILE B 61 15.998 42.219 45.652 0.05 11.01 H ANISOU 3385 HB ILE B 61 1722 633 1829 26 -55 -72 H ATOM 3386 HG12 ILE B 61 14.419 43.469 43.705 0.05 11.19 H ANISOU 3386 HG12 ILE B 61 1736 659 1857 27 -84 -69 H ATOM 3387 HG13 ILE B 61 14.742 44.106 45.106 0.05 11.21 H ANISOU 3387 HG13 ILE B 61 1746 662 1853 54 -63 -70 H ATOM 3388 HG21 ILE B 61 16.407 41.572 43.317 0.05 10.96 H ANISOU 3388 HG21 ILE B 61 1728 613 1825 -2 -78 -91 H ATOM 3389 HG22 ILE B 61 16.242 40.417 44.370 0.05 11.07 H ANISOU 3389 HG22 ILE B 61 1725 620 1859 -8 -71 -79 H ATOM 3390 HG23 ILE B 61 15.021 40.816 43.431 0.05 11.19 H ANISOU 3390 HG23 ILE B 61 1732 646 1874 -12 -91 -80 H ATOM 3391 HD11 ILE B 61 16.091 44.997 43.390 0.05 11.06 H ANISOU 3391 HD11 ILE B 61 1766 615 1823 35 -80 -84 H ATOM 3392 HD12 ILE B 61 16.966 44.369 44.566 0.05 10.91 H ANISOU 3392 HD12 ILE B 61 1741 603 1803 24 -71 -91 H ATOM 3393 HD13 ILE B 61 16.767 43.589 43.203 0.05 10.96 H ANISOU 3393 HD13 ILE B 61 1745 612 1808 14 -82 -86 H ATOM 3394 N GLN B 62 14.709 39.628 46.872 0.05 11.46 N ANISOU 3394 N GLN B 62 1729 694 1929 5 -32 -17 N ATOM 3395 CA GLN B 62 14.799 38.196 47.017 0.05 11.67 C ANISOU 3395 CA GLN B 62 1748 698 1987 -18 -32 3 C ATOM 3396 C GLN B 62 15.137 37.850 48.430 0.05 11.78 C ANISOU 3396 C GLN B 62 1767 724 1984 2 -7 32 C ATOM 3397 O GLN B 62 15.889 38.527 49.121 0.05 11.62 O ANISOU 3397 O GLN B 62 1768 721 1925 28 -3 19 O ATOM 3398 CB GLN B 62 15.841 37.775 46.015 0.05 11.56 C ANISOU 3398 CB GLN B 62 1760 649 1981 -33 -58 -32 C ATOM 3399 CG GLN B 62 15.442 36.657 45.267 0.05 11.78 C ANISOU 3399 CG GLN B 62 1800 639 2035 -42 -60 -25 C ATOM 3400 CD GLN B 62 16.274 35.704 45.699 0.05 11.55 C ANISOU 3400 CD GLN B 62 1793 616 1982 -14 -50 -36 C ATOM 3401 OE1 GLN B 62 15.887 34.872 46.585 0.05 11.46 O ANISOU 3401 OE1 GLN B 62 1777 631 1947 4 -37 -20 O ATOM 3402 NE2 GLN B 62 17.486 35.669 45.116 0.05 11.57 N ANISOU 3402 NE2 GLN B 62 1816 596 1984 -8 -59 -68 N ATOM 3403 H GLN B 62 15.116 40.048 47.488 0.05 11.40 H ANISOU 3403 H GLN B 62 1733 696 1901 23 -23 -20 H ATOM 3404 HA GLN B 62 13.934 37.835 46.793 0.05 11.91 H ANISOU 3404 HA GLN B 62 1753 730 2041 -33 -34 21 H ATOM 3405 HB2 GLN B 62 16.004 38.498 45.395 0.05 11.65 H ANISOU 3405 HB2 GLN B 62 1767 657 2004 -48 -75 -42 H ATOM 3406 HB3 GLN B 62 16.660 37.582 46.491 0.05 11.33 H ANISOU 3406 HB3 GLN B 62 1748 628 1930 -19 -57 -50 H ATOM 3407 HG2 GLN B 62 14.530 36.402 45.456 0.05 11.98 H ANISOU 3407 HG2 GLN B 62 1810 665 2077 -47 -48 8 H ATOM 3408 HG3 GLN B 62 15.584 36.787 44.318 0.05 11.92 H ANISOU 3408 HG3 GLN B 62 1827 633 2070 -57 -78 -44 H ATOM 3409 HE21 GLN B 62 17.741 34.928 44.767 0.05 11.50 H ANISOU 3409 HE21 GLN B 62 1813 593 1965 -11 -66 -89 H ATOM 3410 HE22 GLN B 62 18.010 36.352 45.090 0.05 11.69 H ANISOU 3410 HE22 GLN B 62 1839 594 2009 2 -56 -65 H ATOM 3411 N GLY B 63 14.591 36.717 48.857 0.05 12.17 N ANISOU 3411 N GLY B 63 1796 762 2064 -14 5 76 N ATOM 3412 CA GLY B 63 14.788 36.221 50.197 0.05 12.43 C ANISOU 3412 CA GLY B 63 1833 811 2080 5 31 120 C ATOM 3413 C GLY B 63 13.822 36.803 51.207 0.05 12.77 C ANISOU 3413 C GLY B 63 1850 907 2095 28 69 158 C ATOM 3414 O GLY B 63 12.757 37.310 50.877 0.05 12.89 O ANISOU 3414 O GLY B 63 1832 940 2125 23 78 163 O ATOM 3415 H GLY B 63 14.081 36.227 48.375 0.05 12.35 H ANISOU 3415 H GLY B 63 1804 769 2120 -39 -3 85 H ATOM 3416 HA2 GLY B 63 14.681 35.256 50.202 0.05 12.68 H ANISOU 3416 HA2 GLY B 63 1860 813 2143 -13 30 145 H ATOM 3417 HA3 GLY B 63 15.687 36.421 50.487 0.05 12.25 H ANISOU 3417 HA3 GLY B 63 1833 793 2028 25 26 103 H ATOM 3418 N ASN B 64 14.210 36.651 52.455 0.05 13.02 N ANISOU 3418 N ASN B 64 1896 968 2083 59 93 189 N ATOM 3419 CA ASN B 64 13.369 37.138 53.553 0.05 13.52 C ANISOU 3419 CA ASN B 64 1942 1091 2104 94 140 231 C ATOM 3420 C ASN B 64 14.249 37.812 54.597 0.05 13.54 C ANISOU 3420 C ASN B 64 1991 1130 2022 146 140 203 C ATOM 3421 O ASN B 64 15.407 37.456 54.763 0.05 13.44 O ANISOU 3421 O ASN B 64 2007 1105 1996 147 115 198 O ATOM 3422 CB ASN B 64 12.526 35.982 54.159 0.05 14.17 C ANISOU 3422 CB ASN B 64 1995 1176 2213 77 173 320 C ATOM 3423 CG ASN B 64 11.431 35.468 53.205 0.05 14.40 C ANISOU 3423 CG ASN B 64 1973 1164 2333 17 167 353 C ATOM 3424 OD1 ASN B 64 11.645 34.538 52.423 0.05 14.21 O ANISOU 3424 OD1 ASN B 64 1962 1072 2366 -25 126 334 O ATOM 3425 ND2 ASN B 64 10.275 36.077 53.256 0.05 14.93 N ANISOU 3425 ND2 ASN B 64 1983 1274 2416 14 206 404 N ATOM 3426 H ASN B 64 14.947 36.298 52.695 0.05 12.97 H ANISOU 3426 H ASN B 64 1910 951 2066 65 83 187 H ATOM 3427 HA ASN B 64 12.761 37.800 53.199 0.05 13.54 H ANISOU 3427 HA ASN B 64 1923 1108 2113 97 149 222 H ATOM 3428 HB2 ASN B 64 13.088 35.224 54.355 0.05 14.15 H ANISOU 3428 HB2 ASN B 64 2016 1152 2210 75 159 328 H ATOM 3429 HB3 ASN B 64 12.097 36.299 54.969 0.05 14.56 H ANISOU 3429 HB3 ASN B 64 2035 1274 2224 107 210 351 H ATOM 3430 HD21 ASN B 64 9.557 35.636 53.096 0.05 14.89 H ANISOU 3430 HD21 ASN B 64 1951 1266 2440 -2 196 391 H ATOM 3431 HD22 ASN B 64 10.241 36.907 53.463 0.05 15.36 H ANISOU 3431 HD22 ASN B 64 2025 1362 2451 31 243 453 H ATOM 3432 N ALA B 65 13.707 38.809 55.290 0.05 13.79 N ANISOU 3432 N ALA B 65 2030 1209 1999 192 165 186 N ATOM 3433 CA ALA B 65 14.475 39.536 56.288 0.05 13.99 C ANISOU 3433 CA ALA B 65 2109 1269 1939 241 156 152 C ATOM 3434 C ALA B 65 13.473 40.108 57.257 0.05 14.66 C ANISOU 3434 C ALA B 65 2193 1415 1960 301 210 164 C ATOM 3435 O ALA B 65 12.267 40.085 57.016 0.05 14.86 O ANISOU 3435 O ALA B 65 2172 1457 2017 305 251 194 O ATOM 3436 CB ALA B 65 15.295 40.666 55.654 0.05 13.49 C ANISOU 3436 CB ALA B 65 2082 1170 1875 234 103 70 C ATOM 3437 H ALA B 65 12.897 39.067 55.214 0.05 13.91 H ANISOU 3437 H ALA B 65 2023 1238 2024 198 184 191 H ATOM 3438 HA ALA B 65 15.068 38.937 56.765 0.05 14.14 H ANISOU 3438 HA ALA B 65 2139 1294 1941 241 151 177 H ATOM 3439 HB1 ALA B 65 15.905 41.038 56.311 0.05 13.74 H ANISOU 3439 HB1 ALA B 65 2147 1222 1852 266 94 42 H ATOM 3440 HB2 ALA B 65 15.798 40.324 54.902 0.05 13.20 H ANISOU 3440 HB2 ALA B 65 2045 1106 1865 205 75 68 H ATOM 3441 HB3 ALA B 65 14.682 41.354 55.353 0.05 13.31 H ANISOU 3441 HB3 ALA B 65 2046 1132 1879 228 104 52 H ATOM 3442 N ILE B 66 13.982 40.568 58.401 0.05 15.12 N ANISOU 3442 N ILE B 66 2305 1516 1926 354 209 143 N ATOM 3443 CA ILE B 66 13.199 41.367 59.337 0.05 15.87 C ANISOU 3443 CA ILE B 66 2420 1671 1938 429 257 132 C ATOM 3444 C ILE B 66 13.847 42.737 59.267 0.05 15.73 C ANISOU 3444 C ILE B 66 2468 1624 1887 452 203 27 C ATOM 3445 O ILE B 66 15.065 42.907 59.424 0.05 15.62 O ANISOU 3445 O ILE B 66 2498 1591 1846 438 143 -13 O ATOM 3446 CB ILE B 66 13.258 40.805 60.770 0.05 16.72 C ANISOU 3446 CB ILE B 66 2547 1852 1952 476 296 188 C ATOM 3447 CG1 ILE B 66 12.609 39.414 60.848 0.05 16.92 C ANISOU 3447 CG1 ILE B 66 2506 1891 2031 439 345 304 C ATOM 3448 CG2 ILE B 66 12.559 41.777 61.713 0.05 17.59 C ANISOU 3448 CG2 ILE B 66 2690 2029 1964 567 347 160 C ATOM 3449 CD1 ILE B 66 12.870 38.682 62.154 0.05 17.68 C ANISOU 3449 CD1 ILE B 66 2621 2044 2053 467 372 381 C ATOM 3450 H ILE B 66 14.787 40.442 58.653 0.05 15.08 H ANISOU 3450 H ILE B 66 2325 1506 1899 350 180 133 H ATOM 3451 HA ILE B 66 12.283 41.402 59.047 0.05 15.97 H ANISOU 3451 HA ILE B 66 2393 1693 1981 434 295 154 H ATOM 3452 HB ILE B 66 14.188 40.730 61.025 0.05 16.65 H ANISOU 3452 HB ILE B 66 2576 1835 1914 472 252 164 H ATOM 3453 HG12 ILE B 66 11.649 39.496 60.750 0.05 17.17 H ANISOU 3453 HG12 ILE B 66 2497 1945 2083 448 392 335 H ATOM 3454 HG13 ILE B 66 12.971 38.875 60.131 0.05 16.36 H ANISOU 3454 HG13 ILE B 66 2419 1768 2031 385 311 305 H ATOM 3455 HG21 ILE B 66 13.016 42.629 61.681 0.05 17.47 H ANISOU 3455 HG21 ILE B 66 2718 1988 1931 583 310 84 H ATOM 3456 HG22 ILE B 66 11.636 41.885 61.437 0.05 17.75 H ANISOU 3456 HG22 ILE B 66 2665 2066 2014 577 396 193 H ATOM 3457 HG23 ILE B 66 12.598 41.421 62.615 0.05 18.17 H ANISOU 3457 HG23 ILE B 66 2787 2151 1964 601 365 187 H ATOM 3458 HD11 ILE B 66 12.709 39.283 62.897 0.05 18.22 H ANISOU 3458 HD11 ILE B 66 2725 2165 2033 526 391 361 H ATOM 3459 HD12 ILE B 66 12.275 37.922 62.223 0.05 17.98 H ANISOU 3459 HD12 ILE B 66 2612 2095 2126 451 417 458 H ATOM 3460 HD13 ILE B 66 13.794 38.389 62.163 0.05 17.40 H ANISOU 3460 HD13 ILE B 66 2606 1979 2025 444 325 372 H ATOM 3461 N ILE B 67 13.043 43.772 59.041 0.05 15.85 N ANISOU 3461 N ILE B 67 2486 1628 1907 486 220 -15 N ATOM 3462 CA ILE B 67 13.586 45.114 58.976 0.05 15.84 C ANISOU 3462 CA ILE B 67 2549 1581 1888 503 167 -110 C ATOM 3463 C ILE B 67 13.113 45.869 60.190 0.05 16.84 C ANISOU 3463 C ILE B 67 2735 1755 1909 597 196 -152 C ATOM 3464 O ILE B 67 11.934 45.893 60.511 0.05 17.38 O ANISOU 3464 O ILE B 67 2777 1872 1956 657 270 -121 O ATOM 3465 CB ILE B 67 13.318 45.776 57.637 0.05 15.35 C ANISOU 3465 CB ILE B 67 2464 1460 1908 480 154 -134 C ATOM 3466 CG1 ILE B 67 14.094 44.975 56.576 0.05 14.48 C ANISOU 3466 CG1 ILE B 67 2302 1312 1887 394 127 -96 C ATOM 3467 CG2 ILE B 67 13.646 47.277 57.669 0.05 15.58 C ANISOU 3467 CG2 ILE B 67 2567 1434 1919 504 104 -226 C ATOM 3468 CD1 ILE B 67 13.897 45.494 55.191 0.05 13.95 C ANISOU 3468 CD1 ILE B 67 2261 1186 1853 340 58 -138 C ATOM 3469 H ILE B 67 12.196 43.716 58.913 0.05 15.98 H ANISOU 3469 H ILE B 67 2466 1660 1944 498 259 13 H ATOM 3470 HA ILE B 67 14.544 45.064 59.045 0.05 15.61 H ANISOU 3470 HA ILE B 67 2544 1529 1858 471 117 -132 H ATOM 3471 HB ILE B 67 12.370 45.689 57.445 0.05 15.61 H ANISOU 3471 HB ILE B 67 2467 1519 1945 512 201 -108 H ATOM 3472 HG12 ILE B 67 15.038 44.991 56.792 0.05 14.47 H ANISOU 3472 HG12 ILE B 67 2277 1336 1884 379 143 -51 H ATOM 3473 HG13 ILE B 67 13.774 44.063 56.587 0.05 14.35 H ANISOU 3473 HG13 ILE B 67 2252 1286 1912 390 143 -82 H ATOM 3474 HG21 ILE B 67 13.317 47.699 56.862 0.05 15.30 H ANISOU 3474 HG21 ILE B 67 2517 1359 1936 488 96 -233 H ATOM 3475 HG22 ILE B 67 13.208 47.668 58.437 0.05 16.21 H ANISOU 3475 HG22 ILE B 67 2679 1538 1943 566 128 -250 H ATOM 3476 HG23 ILE B 67 14.604 47.402 57.736 0.05 15.46 H ANISOU 3476 HG23 ILE B 67 2581 1399 1895 474 56 -252 H ATOM 3477 HD11 ILE B 67 12.980 45.792 55.114 0.05 13.54 H ANISOU 3477 HD11 ILE B 67 2181 1109 1856 309 54 -126 H ATOM 3478 HD12 ILE B 67 14.502 46.240 55.062 0.05 14.17 H ANISOU 3478 HD12 ILE B 67 2332 1194 1859 358 33 -187 H ATOM 3479 HD13 ILE B 67 14.085 44.802 54.540 0.05 13.86 H ANISOU 3479 HD13 ILE B 67 2249 1185 1832 320 44 -122 H ATOM 3480 N ARG B 68 14.098 46.424 60.872 0.05 17.18 N ANISOU 3480 N ARG B 68 2856 1786 1887 610 137 -221 N ATOM 3481 CA ARG B 68 13.862 47.035 62.138 0.05 18.29 C ANISOU 3481 CA ARG B 68 3068 1976 1904 701 154 -269 C ATOM 3482 C ARG B 68 13.928 48.532 61.932 0.05 18.64 C ANISOU 3482 C ARG B 68 3181 1954 1946 735 115 -373 C ATOM 3483 O ARG B 68 14.933 49.015 61.478 0.05 18.43 O ANISOU 3483 O ARG B 68 3196 1860 1947 685 28 -434 O ATOM 3484 CB ARG B 68 14.908 46.636 63.136 0.05 18.64 C ANISOU 3484 CB ARG B 68 3162 2051 1870 694 99 -282 C ATOM 3485 CG ARG B 68 14.573 47.311 64.429 0.05 19.91 C ANISOU 3485 CG ARG B 68 3410 2267 1889 792 109 -342 C ATOM 3486 CD ARG B 68 15.280 46.813 65.521 0.05 20.46 C ANISOU 3486 CD ARG B 68 3513 2402 1860 804 83 -323 C ATOM 3487 NE ARG B 68 15.065 45.392 65.675 0.05 20.41 N ANISOU 3487 NE ARG B 68 3440 2470 1847 805 159 -198 N ATOM 3488 CZ ARG B 68 15.905 44.670 66.384 0.05 20.92 C ANISOU 3488 CZ ARG B 68 3524 2597 1828 817 145 -155 C ATOM 3489 NH1 ARG B 68 16.928 45.259 66.981 0.05 21.44 N ANISOU 3489 NH1 ARG B 68 3667 2664 1816 826 52 -233 N ATOM 3490 NH2 ARG B 68 15.708 43.373 66.495 0.05 20.97 N ANISOU 3490 NH2 ARG B 68 3471 2660 1837 815 216 -33 N ATOM 3491 H ARG B 68 14.908 46.489 60.597 0.05 16.86 H ANISOU 3491 H ARG B 68 2827 1708 1870 568 84 -244 H ATOM 3492 HA ARG B 68 13.005 46.755 62.453 0.05 18.69 H ANISOU 3492 HA ARG B 68 3096 2082 1924 748 223 -226 H ATOM 3493 HB2 ARG B 68 14.909 45.676 63.263 0.05 18.46 H ANISOU 3493 HB2 ARG B 68 3100 2064 1851 673 120 -214 H ATOM 3494 HB3 ARG B 68 15.771 46.948 62.828 0.05 18.33 H ANISOU 3494 HB3 ARG B 68 3141 1959 1865 649 32 -326 H ATOM 3495 HG2 ARG B 68 14.761 48.264 64.359 0.05 20.13 H ANISOU 3495 HG2 ARG B 68 3490 2245 1912 800 61 -423 H ATOM 3496 HG3 ARG B 68 13.641 47.160 64.630 0.05 20.28 H ANISOU 3496 HG3 ARG B 68 3441 2357 1909 846 183 -312 H ATOM 3497 HD2 ARG B 68 16.222 46.961 65.361 0.05 20.14 H ANISOU 3497 HD2 ARG B 68 3478 2328 1847 751 11 -342 H ATOM 3498 HD3 ARG B 68 14.996 47.256 66.340 0.05 21.35 H ANISOU 3498 HD3 ARG B 68 3689 2547 1875 871 85 -371 H ATOM 3499 HE ARG B 68 14.253 45.115 65.623 0.05 20.33 H ANISOU 3499 HE ARG B 68 3387 2473 1865 816 222 -154 H ATOM 3500 HH11 ARG B 68 17.060 46.105 66.910 0.05 21.48 H ANISOU 3500 HH11 ARG B 68 3709 2625 1826 822 4 -310 H ATOM 3501 HH12 ARG B 68 17.470 44.785 67.445 0.05 21.82 H ANISOU 3501 HH12 ARG B 68 3727 2756 1807 836 38 -204 H ATOM 3502 HH21 ARG B 68 15.033 43.009 66.107 0.05 20.69 H ANISOU 3502 HH21 ARG B 68 3384 2620 1858 803 269 15 H ATOM 3503 HH22 ARG B 68 16.246 42.901 66.969 0.05 21.34 H ANISOU 3503 HH22 ARG B 68 3532 2747 1830 824 207 1 H ATOM 3504 N ILE B 69 12.849 49.232 62.255 0.05 19.26 N ANISOU 3504 N ILE B 69 3269 2051 1999 820 179 -389 N ATOM 3505 CA ILE B 69 12.768 50.694 62.092 0.05 19.74 C ANISOU 3505 CA ILE B 69 3400 2036 2064 864 147 -487 C ATOM 3506 C ILE B 69 12.344 51.233 63.441 0.05 21.11 C ANISOU 3506 C ILE B 69 3650 2270 2102 988 191 -540 C ATOM 3507 O ILE B 69 11.257 50.897 63.930 0.05 21.65 O ANISOU 3507 O ILE B 69 3680 2414 2132 1069 292 -492 O ATOM 3508 CB ILE B 69 11.792 51.046 60.994 0.05 19.20 C ANISOU 3508 CB ILE B 69 3271 1918 2106 851 173 -459 C ATOM 3509 CG1 ILE B 69 12.275 50.453 59.651 0.05 17.97 C ANISOU 3509 CG1 ILE B 69 3061 1707 2060 729 117 -420 C ATOM 3510 CG2 ILE B 69 11.608 52.589 60.877 0.05 19.81 C ANISOU 3510 CG2 ILE B 69 3423 1910 2193 905 144 -550 C ATOM 3511 CD1 ILE B 69 11.258 50.530 58.550 0.05 17.36 C ANISOU 3511 CD1 ILE B 69 2903 1613 2079 704 149 -362 C ATOM 3512 H ILE B 69 12.133 48.888 62.580 0.05 19.51 H ANISOU 3512 H ILE B 69 3266 2135 2011 856 243 -342 H ATOM 3513 HA ILE B 69 13.637 51.065 61.876 0.05 19.62 H ANISOU 3513 HA ILE B 69 3427 1966 2061 821 74 -537 H ATOM 3514 HB ILE B 69 10.936 50.651 61.211 0.05 19.31 H ANISOU 3514 HB ILE B 69 3233 1987 2119 886 241 -405 H ATOM 3515 HG12 ILE B 69 13.083 50.898 59.352 0.05 17.93 H ANISOU 3515 HG12 ILE B 69 3101 1639 2072 700 56 -472 H ATOM 3516 HG13 ILE B 69 12.457 49.511 59.794 0.05 17.67 H ANISOU 3516 HG13 ILE B 69 2997 1707 2011 693 117 -380 H ATOM 3517 HG21 ILE B 69 10.659 52.781 60.847 0.05 19.63 H ANISOU 3517 HG21 ILE B 69 3356 1877 2225 917 176 -520 H ATOM 3518 HG22 ILE B 69 12.019 53.042 61.627 0.05 20.68 H ANISOU 3518 HG22 ILE B 69 3588 2044 2224 982 164 -596 H ATOM 3519 HG23 ILE B 69 12.030 52.869 60.052 0.05 19.56 H ANISOU 3519 HG23 ILE B 69 3425 1813 2194 851 74 -589 H ATOM 3520 HD11 ILE B 69 11.650 50.171 57.738 0.05 16.74 H ANISOU 3520 HD11 ILE B 69 2815 1489 2058 637 104 -359 H ATOM 3521 HD12 ILE B 69 10.488 49.998 58.804 0.05 17.24 H ANISOU 3521 HD12 ILE B 69 2831 1654 2065 703 195 -301 H ATOM 3522 HD13 ILE B 69 11.000 51.453 58.412 0.05 17.77 H ANISOU 3522 HD13 ILE B 69 2972 1645 2135 756 165 -387 H ATOM 3523 N AASN B 70 13.118 52.203 63.935 0.03 21.74 N ANISOU 3523 N AASN B 70 3833 2318 2110 996 110 -636 N ATOM 3524 N BASN B 70 13.264 51.933 64.107 0.02 21.81 N ANISOU 3524 N BASN B 70 3845 2328 2115 1004 115 -639 N ATOM 3525 CA AASN B 70 13.085 52.591 65.339 0.03 23.13 C ANISOU 3525 CA AASN B 70 4101 2558 2130 1101 126 -698 C ATOM 3526 CA BASN B 70 13.058 52.413 65.482 0.02 23.29 C ANISOU 3526 CA BASN B 70 4127 2567 2157 1129 144 -711 C ATOM 3527 C AASN B 70 13.173 51.279 66.124 0.03 23.25 C ANISOU 3527 C AASN B 70 4075 2699 2062 1113 183 -605 C ATOM 3528 C BASN B 70 12.341 51.380 66.363 0.02 23.76 C ANISOU 3528 C BASN B 70 4141 2767 2119 1193 250 -620 C ATOM 3529 O AASN B 70 14.082 50.475 65.877 0.03 22.60 O ANISOU 3529 O AASN B 70 3963 2621 2002 1026 129 -562 O ATOM 3530 O BASN B 70 11.348 51.691 67.029 0.02 24.78 O ANISOU 3530 O BASN B 70 4285 2961 2169 1311 342 -623 O ATOM 3531 CB AASN B 70 11.841 53.435 65.664 0.03 24.15 C ANISOU 3531 CB AASN B 70 4272 2687 2218 1229 197 -749 C ATOM 3532 CB BASN B 70 12.316 53.748 65.458 0.02 24.00 C ANISOU 3532 CB BASN B 70 4263 2596 2260 1218 173 -783 C ATOM 3533 CG AASN B 70 11.888 54.834 65.028 0.03 24.26 C ANISOU 3533 CG AASN B 70 4352 2560 2306 1220 123 -851 C ATOM 3534 CG BASN B 70 13.178 54.881 64.928 0.02 24.07 C ANISOU 3534 CG BASN B 70 4355 2460 2329 1173 58 -892 C ATOM 3535 OD1AASN B 70 12.624 55.705 65.488 0.03 24.26 O ANISOU 3535 OD1AASN B 70 4418 2478 2320 1153 8 -925 O ATOM 3536 OD1BASN B 70 14.339 54.693 64.573 0.02 23.39 O ANISOU 3536 OD1BASN B 70 4266 2320 2300 1059 -38 -897 O ATOM 3537 ND2AASN B 70 11.091 55.051 63.980 0.03 24.39 N ANISOU 3537 ND2AASN B 70 4344 2545 2381 1281 183 -846 N ATOM 3538 ND2BASN B 70 12.601 56.062 64.860 0.02 24.99 N ANISOU 3538 ND2BASN B 70 4542 2513 2440 1264 68 -973 N ATOM 3539 H AASN B 70 13.677 52.662 63.467 0.05 21.43 H ANISOU 3539 H AASN B 70 3812 2220 2110 938 41 -668 H ATOM 3540 H BASN B 70 14.034 52.142 63.783 0.05 21.53 H ANISOU 3540 H BASN B 70 3829 2244 2107 946 44 -668 H ATOM 3541 HA AASN B 70 13.874 53.115 65.555 0.05 23.44 H ANISOU 3541 HA AASN B 70 4208 2554 2142 1082 45 -770 H ATOM 3542 HA BASN B 70 13.924 52.579 65.889 0.05 23.67 H ANISOU 3542 HA BASN B 70 4243 2595 2156 1116 72 -774 H ATOM 3543 HB2AASN B 70 11.053 52.978 65.331 0.05 23.88 H ANISOU 3543 HB2AASN B 70 4162 2689 2221 1245 273 -678 H ATOM 3544 HB2BASN B 70 11.543 53.669 64.878 0.05 23.50 H ANISOU 3544 HB2BASN B 70 4126 2535 2269 1213 224 -723 H ATOM 3545 HB3AASN B 70 11.775 53.547 66.625 0.05 25.13 H ANISOU 3545 HB3AASN B 70 4457 2862 2228 1304 215 -788 H ATOM 3546 HB3BASN B 70 12.035 53.983 66.356 0.05 25.01 H ANISOU 3546 HB3BASN B 70 4442 2773 2289 1314 214 -818 H ATOM 3547 HD21AASN B 70 10.361 54.607 63.893 0.05 24.20 H ANISOU 3547 HD21AASN B 70 4251 2574 2372 1303 254 -778 H ATOM 3548 HD21BASN B 70 13.067 56.756 64.660 0.05 25.13 H ANISOU 3548 HD21BASN B 70 4610 2442 2496 1240 4 -1033 H ATOM 3549 HD22AASN B 70 11.302 55.646 63.397 0.05 24.71 H ANISOU 3549 HD22AASN B 70 4435 2508 2446 1297 149 -908 H ATOM 3550 HD22BASN B 70 11.758 56.139 65.016 0.05 25.50 H ANISOU 3550 HD22BASN B 70 4602 2622 2464 1348 140 -964 H ATOM 3551 N AASP B 71 12.230 51.043 67.032 0.03 24.18 N ANISOU 3551 N AASP B 71 4187 2916 2084 1221 292 -568 N ATOM 3552 N BASP B 71 12.854 50.149 66.332 0.02 23.08 N ANISOU 3552 N BASP B 71 3997 2726 2045 1115 239 -533 N ATOM 3553 CA AASP B 71 12.237 49.812 67.809 0.03 24.43 C ANISOU 3553 CA AASP B 71 4176 3068 2040 1233 357 -462 C ATOM 3554 CA BASP B 71 12.339 49.026 67.126 0.02 23.56 C ANISOU 3554 CA BASP B 71 4020 2913 2017 1155 323 -435 C ATOM 3555 C AASP B 71 11.285 48.753 67.250 0.03 23.96 C ANISOU 3555 C AASP B 71 3984 3060 2061 1221 468 -325 C ATOM 3556 C BASP B 71 11.094 48.321 66.584 0.02 23.36 C ANISOU 3556 C BASP B 71 3879 2946 2050 1170 445 -314 C ATOM 3557 O AASP B 71 10.969 47.789 67.940 0.03 24.51 O ANISOU 3557 O AASP B 71 4012 3234 2065 1253 550 -227 O ATOM 3558 O BASP B 71 10.692 47.296 67.134 0.02 23.84 O ANISOU 3558 O BASP B 71 3899 3108 2050 1196 521 -217 O ATOM 3559 CB AASP B 71 11.893 50.106 69.269 0.03 26.10 C ANISOU 3559 CB AASP B 71 4482 3374 2059 1363 396 -509 C ATOM 3560 CB BASP B 71 12.054 49.439 68.575 0.02 25.17 C ANISOU 3560 CB BASP B 71 4331 3194 2038 1279 344 -501 C ATOM 3561 CG AASP B 71 10.508 50.719 69.444 0.03 27.15 C ANISOU 3561 CG AASP B 71 4643 3529 2144 1494 485 -556 C ATOM 3562 CG BASP B 71 13.133 50.315 69.159 0.02 25.60 C ANISOU 3562 CG BASP B 71 4505 3187 2035 1267 214 -633 C ATOM 3563 OD1AASP B 71 10.176 51.088 70.585 0.03 28.65 O ANISOU 3563 OD1AASP B 71 4923 3793 2170 1615 521 -610 O ATOM 3564 OD1BASP B 71 14.297 50.250 68.706 0.02 24.65 O ANISOU 3564 OD1BASP B 71 4369 2989 2007 1154 112 -644 O ATOM 3565 OD2AASP B 71 9.749 50.828 68.456 0.03 26.58 O ANISOU 3565 OD2AASP B 71 4504 3402 2192 1483 520 -539 O ATOM 3566 OD2BASP B 71 12.803 51.077 70.077 0.02 26.99 O ANISOU 3566 OD2BASP B 71 4790 3393 2074 1372 212 -727 O ATOM 3567 H AASP B 71 11.577 51.570 67.220 0.05 24.74 H ANISOU 3567 H AASP B 71 4277 2989 2133 1291 334 -598 H ATOM 3568 H BASP B 71 13.536 49.937 65.852 0.05 22.38 H ANISOU 3568 H BASP B 71 3892 2595 2017 1037 181 -528 H ATOM 3569 HA AASP B 71 13.130 49.439 67.799 0.05 23.94 H ANISOU 3569 HA AASP B 71 4107 2994 1994 1164 299 -443 H ATOM 3570 HA BASP B 71 13.036 48.351 67.154 0.05 23.09 H ANISOU 3570 HA BASP B 71 3942 2857 1972 1092 284 -397 H ATOM 3571 HB2AASP B 71 11.920 49.274 69.766 0.05 26.31 H ANISOU 3571 HB2AASP B 71 4475 3483 2037 1371 445 -426 H ATOM 3572 HB2BASP B 71 11.211 49.911 68.622 0.05 25.75 H ANISOU 3572 HB2BASP B 71 4416 3281 2088 1356 403 -524 H ATOM 3573 HB3AASP B 71 12.544 50.727 69.629 0.05 26.40 H ANISOU 3573 HB3AASP B 71 4601 3380 2048 1358 312 -592 H ATOM 3574 HB3BASP B 71 12.005 48.641 69.124 0.05 25.47 H ANISOU 3574 HB3BASP B 71 4350 3313 2014 1293 384 -432 H ATOM 3575 N AGLU B 72 10.833 48.926 66.005 0.03 23.07 N ANISOU 3575 N AGLU B 72 3804 2873 2088 1170 466 -315 N ATOM 3576 N BGLU B 72 10.463 48.863 65.549 0.02 22.78 N ANISOU 3576 N BGLU B 72 3750 2812 2093 1152 460 -314 N ATOM 3577 CA AGLU B 72 9.854 48.007 65.431 0.03 22.60 C ANISOU 3577 CA AGLU B 72 3614 2851 2122 1139 549 -192 C ATOM 3578 CA BGLU B 72 9.339 48.161 64.933 0.02 22.46 C ANISOU 3578 CA BGLU B 72 3583 2814 2136 1135 549 -196 C ATOM 3579 C AGLU B 72 10.498 47.113 64.385 0.03 21.18 C ANISOU 3579 C AGLU B 72 3372 2603 2072 1001 484 -144 C ATOM 3580 C BGLU B 72 9.885 47.208 63.884 0.02 21.08 C ANISOU 3580 C BGLU B 72 3341 2585 2084 997 492 -136 C ATOM 3581 O AGLU B 72 11.491 47.476 63.764 0.03 20.40 O ANISOU 3581 O AGLU B 72 3301 2410 2040 939 396 -209 O ATOM 3582 O BGLU B 72 10.288 47.605 62.794 0.02 20.21 O ANISOU 3582 O BGLU B 72 3241 2380 2059 931 414 -188 O ATOM 3583 CB AGLU B 72 8.629 48.730 64.824 0.03 22.89 C ANISOU 3583 CB AGLU B 72 3605 2880 2213 1201 611 -196 C ATOM 3584 CB BGLU B 72 8.317 49.106 64.309 0.02 22.61 C ANISOU 3584 CB BGLU B 72 3570 2803 2219 1187 588 -220 C ATOM 3585 CG AGLU B 72 7.447 47.760 64.593 0.03 22.80 C ANISOU 3585 CG AGLU B 72 3453 2936 2274 1176 702 -56 C ATOM 3586 CG BGLU B 72 7.358 49.772 65.284 0.02 24.10 C ANISOU 3586 CG BGLU B 72 3802 3056 2300 1340 673 -259 C ATOM 3587 CD AGLU B 72 6.173 48.380 64.027 0.03 23.24 C ANISOU 3587 CD AGLU B 72 3438 3006 2384 1240 770 -39 C ATOM 3588 CD BGLU B 72 6.314 50.589 64.562 0.02 24.22 C ANISOU 3588 CD BGLU B 72 3774 3031 2396 1389 704 -275 C ATOM 3589 OE1AGLU B 72 6.140 49.603 63.757 0.03 23.41 O ANISOU 3589 OE1AGLU B 72 3521 2966 2409 1297 741 -135 O ATOM 3590 OE1BGLU B 72 6.654 51.169 63.512 0.02 23.46 O ANISOU 3590 OE1BGLU B 72 3703 2822 2389 1337 621 -334 O ATOM 3591 OE2AGLU B 72 5.192 47.605 63.840 0.03 23.44 O ANISOU 3591 OE2AGLU B 72 3344 3101 2461 1227 847 78 O ATOM 3592 OE2BGLU B 72 5.153 50.638 65.037 0.02 25.14 O ANISOU 3592 OE2BGLU B 72 3826 3234 2491 1482 813 -218 O ATOM 3593 H AGLU B 72 11.078 49.556 65.476 0.05 22.76 H ANISOU 3593 H AGLU B 72 3793 2762 2094 1151 415 -376 H ATOM 3594 H BGLU B 72 10.661 49.615 65.184 0.05 22.61 H ANISOU 3594 H BGLU B 72 3761 2724 2106 1146 416 -378 H ATOM 3595 HA AGLU B 72 9.519 47.424 66.128 0.05 23.12 H ANISOU 3595 HA AGLU B 72 3655 2995 2133 1166 609 -125 H ATOM 3596 HA BGLU B 72 8.872 47.639 65.602 0.05 23.08 H ANISOU 3596 HA BGLU B 72 3638 2976 2155 1175 617 -135 H ATOM 3597 HB2AGLU B 72 8.338 49.436 65.419 0.05 23.84 H ANISOU 3597 HB2AGLU B 72 3775 3032 2250 1296 648 -241 H ATOM 3598 HB2BGLU B 72 8.787 49.796 63.820 0.05 22.15 H ANISOU 3598 HB2BGLU B 72 3548 2661 2207 1157 522 -284 H ATOM 3599 HB3AGLU B 72 8.882 49.102 63.965 0.05 22.27 H ANISOU 3599 HB3AGLU B 72 3532 2721 2209 1161 557 -238 H ATOM 3600 HB3BGLU B 72 7.769 48.593 63.696 0.05 22.25 H ANISOU 3600 HB3BGLU B 72 3434 2775 2246 1152 625 -141 H ATOM 3601 HG2AGLU B 72 7.728 47.080 63.962 0.05 21.90 H ANISOU 3601 HG2AGLU B 72 3296 2782 2245 1084 662 -21 H ATOM 3602 HG2BGLU B 72 6.904 49.090 65.803 0.05 24.64 H ANISOU 3602 HG2BGLU B 72 3826 3213 2321 1373 747 -187 H ATOM 3603 HG3AGLU B 72 7.224 47.342 65.439 0.05 23.42 H ANISOU 3603 HG3AGLU B 72 3521 3092 2284 1207 757 -3 H ATOM 3604 HG3BGLU B 72 7.856 50.356 65.873 0.05 24.57 H ANISOU 3604 HG3BGLU B 72 3958 3095 2282 1380 633 -345 H ATOM 3605 N ASP B 73 9.901 45.936 64.241 0.05 20.99 N ANISOU 3605 N ASP B 73 3264 2632 2080 956 532 -26 N ATOM 3606 CA ASP B 73 10.329 44.903 63.324 0.05 19.85 C ANISOU 3606 CA ASP B 73 3064 2433 2047 838 482 24 C ATOM 3607 C ASP B 73 9.227 44.649 62.291 0.05 19.39 C ANISOU 3607 C ASP B 73 2905 2352 2110 799 516 78 C ATOM 3608 O ASP B 73 8.040 44.705 62.601 0.05 20.07 O ANISOU 3608 O ASP B 73 2928 2504 2195 847 603 141 O ATOM 3609 CB ASP B 73 10.642 43.614 64.104 0.05 20.08 C ANISOU 3609 CB ASP B 73 3087 2514 2028 815 493 105 C ATOM 3610 CG ASP B 73 11.907 43.722 64.970 0.05 20.36 C ANISOU 3610 CG ASP B 73 3226 2552 1960 836 422 33 C ATOM 3611 OD1 ASP B 73 12.686 44.687 64.767 0.05 20.95 O ANISOU 3611 OD1 ASP B 73 3380 2625 1953 906 402 -68 O ATOM 3612 OD2 ASP B 73 12.118 42.830 65.840 0.05 20.06 O ANISOU 3612 OD2 ASP B 73 3191 2508 1925 784 377 68 O ATOM 3613 H AASP B 73 9.208 45.709 64.693 0.05 21.60 H ANISOU 3613 H AASP B 73 3316 2775 2115 996 597 28 H ATOM 3614 H BASP B 73 9.668 45.649 65.017 0.05 21.64 H ANISOU 3614 H BASP B 73 3335 2781 2104 997 589 20 H ATOM 3615 HA ASP B 73 11.129 45.190 62.854 0.05 19.33 H ANISOU 3615 HA ASP B 73 3038 2305 2003 803 410 -38 H ATOM 3616 HB2 ASP B 73 9.896 43.401 64.682 0.05 20.79 H ANISOU 3616 HB2 ASP B 73 3152 2673 2075 860 566 164 H ATOM 3617 HB3 ASP B 73 10.784 42.898 63.467 0.05 19.43 H ANISOU 3617 HB3 ASP B 73 2960 2397 2025 743 472 148 H ATOM 3618 N PHE B 74 9.651 44.385 61.058 0.05 18.34 N ANISOU 3618 N PHE B 74 2762 2131 2077 720 444 45 N ATOM 3619 CA PHE B 74 8.773 44.003 59.932 0.05 17.86 C ANISOU 3619 CA PHE B 74 2613 2042 2130 673 453 86 C ATOM 3620 C PHE B 74 9.268 42.721 59.244 0.05 17.00 C ANISOU 3620 C PHE B 74 2464 1889 2104 564 408 132 C ATOM 3621 O PHE B 74 10.394 42.690 58.797 0.05 16.22 O ANISOU 3621 O PHE B 74 2401 1720 2039 512 334 80 O ATOM 3622 CB PHE B 74 8.772 45.125 58.880 0.05 17.55 C ANISOU 3622 CB PHE B 74 2605 1935 2127 688 410 3 C ATOM 3623 CG PHE B 74 8.190 46.406 59.349 0.05 18.51 C ANISOU 3623 CG PHE B 74 2760 2088 2184 803 458 -42 C ATOM 3624 CD1 PHE B 74 8.946 47.302 60.075 0.05 18.96 C ANISOU 3624 CD1 PHE B 74 2927 2124 2155 863 429 -138 C ATOM 3625 CD2 PHE B 74 6.877 46.731 59.040 0.05 19.07 C ANISOU 3625 CD2 PHE B 74 2752 2209 2285 853 530 11 C ATOM 3626 CE1 PHE B 74 8.391 48.491 60.516 0.05 19.98 C ANISOU 3626 CE1 PHE B 74 3097 2272 2220 978 474 -188 C ATOM 3627 CE2 PHE B 74 6.303 47.897 59.492 0.05 20.06 C ANISOU 3627 CE2 PHE B 74 2907 2364 2351 972 582 -30 C ATOM 3628 CZ PHE B 74 7.065 48.802 60.208 0.05 20.51 C ANISOU 3628 CZ PHE B 74 3086 2391 2316 1038 554 -134 C ATOM 3629 H PHE B 74 10.477 44.440 60.829 0.05 17.96 H ANISOU 3629 H PHE B 74 2756 2040 2028 693 387 -1 H ATOM 3630 HA PHE B 74 7.867 43.874 60.247 0.05 18.39 H ANISOU 3630 HA PHE B 74 2630 2161 2198 705 515 137 H ATOM 3631 HB2 PHE B 74 9.686 45.306 58.610 0.05 17.16 H ANISOU 3631 HB2 PHE B 74 2609 1839 2071 661 353 -48 H ATOM 3632 HB3 PHE B 74 8.253 44.831 58.114 0.05 17.18 H ANISOU 3632 HB3 PHE B 74 2504 1870 2155 650 405 31 H ATOM 3633 HD1 PHE B 74 9.830 47.100 60.282 0.05 18.66 H ANISOU 3633 HD1 PHE B 74 2935 2055 2100 826 376 -171 H ATOM 3634 HD2 PHE B 74 6.360 46.123 58.561 0.05 18.85 H ANISOU 3634 HD2 PHE B 74 2649 2194 2318 808 543 74 H ATOM 3635 HE1 PHE B 74 8.902 49.091 61.009 0.05 20.35 H ANISOU 3635 HE1 PHE B 74 3224 2297 2210 1015 447 -259 H ATOM 3636 HE2 PHE B 74 5.421 48.097 59.274 0.05 20.49 H ANISOU 3636 HE2 PHE B 74 2900 2456 2429 1009 632 10 H ATOM 3637 HZ PHE B 74 6.691 49.599 60.506 0.05 21.25 H ANISOU 3637 HZ PHE B 74 3207 2500 2369 1124 589 -168 H ATOM 3638 N PRO B 75 8.439 41.657 59.161 0.05 17.24 N ANISOU 3638 N PRO B 75 2421 1958 2173 530 454 233 N ATOM 3639 CA PRO B 75 8.846 40.567 58.253 0.05 16.58 C ANISOU 3639 CA PRO B 75 2302 1821 2176 433 412 273 C ATOM 3640 C PRO B 75 8.730 41.069 56.781 0.05 15.94 C ANISOU 3640 C PRO B 75 2184 1682 2189 381 369 247 C ATOM 3641 O PRO B 75 7.727 41.706 56.464 0.05 16.28 O ANISOU 3641 O PRO B 75 2172 1750 2262 404 400 264 O ATOM 3642 CB PRO B 75 7.855 39.430 58.575 0.05 17.28 C ANISOU 3642 CB PRO B 75 2318 1962 2288 418 477 387 C ATOM 3643 CG PRO B 75 7.144 39.860 59.836 0.05 18.31 C ANISOU 3643 CG PRO B 75 2467 2186 2305 516 555 409 C ATOM 3644 CD PRO B 75 7.172 41.355 59.859 0.05 18.30 C ANISOU 3644 CD PRO B 75 2505 2183 2266 584 548 316 C ATOM 3645 HA PRO B 75 9.754 40.281 58.434 0.05 16.27 H ANISOU 3645 HA PRO B 75 2307 1758 2118 415 375 252 H ATOM 3646 HB2 PRO B 75 7.213 39.331 57.857 0.05 17.34 H ANISOU 3646 HB2 PRO B 75 2264 1967 2356 397 488 412 H ATOM 3647 HB3 PRO B 75 8.345 38.606 58.712 0.05 17.13 H ANISOU 3647 HB3 PRO B 75 2302 1920 2288 376 460 418 H ATOM 3648 HG2 PRO B 75 6.235 39.525 59.823 0.05 18.89 H ANISOU 3648 HG2 PRO B 75 2478 2302 2397 518 610 483 H ATOM 3649 HG3 PRO B 75 7.621 39.508 60.603 0.05 18.40 H ANISOU 3649 HG3 PRO B 75 2528 2206 2257 529 546 405 H ATOM 3650 HD2 PRO B 75 6.418 41.710 59.368 0.05 18.52 H ANISOU 3650 HD2 PRO B 75 2476 2226 2334 594 577 338 H ATOM 3651 HD3 PRO B 75 7.192 41.684 60.770 0.05 18.80 H ANISOU 3651 HD3 PRO B 75 2616 2284 2241 649 571 291 H ATOM 3652 N VAL B 76 9.745 40.856 55.945 0.05 15.14 N ANISOU 3652 N VAL B 76 2110 1513 2128 320 302 210 N ATOM 3653 CA VAL B 76 9.693 41.365 54.564 0.05 14.59 C ANISOU 3653 CA VAL B 76 2018 1394 2131 278 258 180 C ATOM 3654 C VAL B 76 10.108 40.257 53.598 0.05 14.10 C ANISOU 3654 C VAL B 76 1942 1279 2136 197 214 195 C ATOM 3655 O VAL B 76 10.954 39.411 53.913 0.05 13.93 O ANISOU 3655 O VAL B 76 1952 1238 2104 176 199 201 O ATOM 3656 CB VAL B 76 10.519 42.675 54.391 0.05 14.18 C ANISOU 3656 CB VAL B 76 2027 1305 2054 303 217 95 C ATOM 3657 CG1 VAL B 76 10.379 43.556 55.653 0.05 14.77 C ANISOU 3657 CG1 VAL B 76 2125 1414 2072 389 253 65 C ATOM 3658 CG2 VAL B 76 11.959 42.396 54.173 0.05 13.74 C ANISOU 3658 CG2 VAL B 76 2034 1216 1972 281 172 53 C ATOM 3659 H VAL B 76 10.470 40.448 56.139 0.05 14.95 H ANISOU 3659 H VAL B 76 2116 1475 2090 306 282 203 H ATOM 3660 HA VAL B 76 8.777 41.579 54.336 0.05 14.89 H ANISOU 3660 HA VAL B 76 2008 1455 2196 285 282 207 H ATOM 3661 HB VAL B 76 10.180 43.169 53.631 0.05 13.90 H ANISOU 3661 HB VAL B 76 1973 1244 2064 276 193 87 H ATOM 3662 HG11 VAL B 76 11.072 43.307 56.283 0.05 15.17 H ANISOU 3662 HG11 VAL B 76 2191 1502 2072 421 283 77 H ATOM 3663 HG12 VAL B 76 10.480 44.487 55.400 0.05 14.56 H ANISOU 3663 HG12 VAL B 76 2144 1354 2035 398 221 12 H ATOM 3664 HG13 VAL B 76 9.510 43.420 56.051 0.05 15.01 H ANISOU 3664 HG13 VAL B 76 2110 1462 2130 403 275 89 H ATOM 3665 HG21 VAL B 76 12.185 41.536 54.556 0.05 13.96 H ANISOU 3665 HG21 VAL B 76 2067 1267 1972 287 188 79 H ATOM 3666 HG22 VAL B 76 12.120 42.389 53.216 0.05 13.31 H ANISOU 3666 HG22 VAL B 76 1972 1127 1959 237 142 50 H ATOM 3667 HG23 VAL B 76 12.497 43.085 54.585 0.05 13.76 H ANISOU 3667 HG23 VAL B 76 2077 1208 1944 308 158 7 H ATOM 3668 N ATHR B 77 9.591 40.346 52.384 0.02 13.90 N ANISOU 3668 N ATHR B 77 1880 1228 2172 160 186 189 N ATOM 3669 N BTHR B 77 9.383 40.226 52.474 0.02 14.07 N ANISOU 3669 N BTHR B 77 1885 1259 2200 158 198 209 N ATOM 3670 CA ATHR B 77 9.825 39.355 51.366 0.02 13.55 C ANISOU 3670 CA ATHR B 77 1831 1132 2186 92 141 187 C ATOM 3671 CA BTHR B 77 9.474 39.222 51.417 0.02 13.71 C ANISOU 3671 CA BTHR B 77 1833 1160 2219 87 149 205 C ATOM 3672 C ATHR B 77 9.638 39.982 50.002 0.02 13.28 C ANISOU 3672 C ATHR B 77 1787 1077 2182 77 101 150 C ATOM 3673 C BTHR B 77 9.521 39.928 50.027 0.02 13.32 C ANISOU 3673 C BTHR B 77 1788 1085 2190 76 103 155 C ATOM 3674 O ATHR B 77 9.294 41.160 49.881 0.02 13.34 O ANISOU 3674 O ATHR B 77 1792 1106 2172 118 108 132 O ATOM 3675 O BTHR B 77 9.261 41.137 49.928 0.02 13.34 O ANISOU 3675 O BTHR B 77 1793 1107 2170 120 110 132 O ATOM 3676 CB ATHR B 77 8.905 38.146 51.567 0.02 14.09 C ANISOU 3676 CB ATHR B 77 1842 1201 2310 47 158 260 C ATOM 3677 CB BTHR B 77 8.261 38.180 51.468 0.02 14.30 C ANISOU 3677 CB BTHR B 77 1834 1235 2363 35 158 277 C ATOM 3678 OG1ATHR B 77 9.609 36.963 51.180 0.02 13.84 O ANISOU 3678 OG1ATHR B 77 1830 1106 2324 -10 112 248 O ATOM 3679 OG1BTHR B 77 7.072 38.775 50.948 0.02 14.75 O ANISOU 3679 OG1BTHR B 77 1822 1333 2448 46 174 302 O ATOM 3680 CG2ATHR B 77 7.578 38.286 50.829 0.02 14.62 C ANISOU 3680 CG2ATHR B 77 1828 1300 2425 37 169 299 C ATOM 3681 CG2BTHR B 77 7.926 37.638 52.897 0.02 14.85 C ANISOU 3681 CG2BTHR B 77 1891 1330 2422 40 209 349 C ATOM 3682 H ATHR B 77 9.113 41.009 52.112 0.02 14.00 H ANISOU 3682 H ATHR B 77 1875 1253 2191 178 190 182 H ATOM 3683 H BTHR B 77 8.790 40.820 52.297 0.02 14.34 H ANISOU 3683 H BTHR B 77 1886 1318 2245 174 215 222 H ATOM 3684 HA ATHR B 77 10.743 39.061 51.429 0.02 13.24 H ANISOU 3684 HA ATHR B 77 1833 1069 2129 87 124 164 H ATOM 3685 HA BTHR B 77 10.303 38.740 51.527 0.02 13.45 H ANISOU 3685 HA BTHR B 77 1837 1102 2172 78 135 190 H ATOM 3686 HB ATHR B 77 8.690 38.094 52.510 0.02 14.38 H ANISOU 3686 HB ATHR B 77 1881 1263 2319 68 193 294 H ATOM 3687 HB BTHR B 77 8.495 37.417 50.922 0.02 14.11 H ANISOU 3687 HB BTHR B 77 1818 1168 2375 -8 120 263 H ATOM 3688 HG1ATHR B 77 10.210 37.160 50.628 0.02 13.69 H ANISOU 3688 HG1ATHR B 77 1844 1075 2283 -2 113 241 H ATOM 3689 HG1BTHR B 77 6.444 38.221 50.957 0.02 14.98 H ANISOU 3689 HG1BTHR B 77 1814 1351 2526 5 158 327 H ATOM 3690 HG21ATHR B 77 7.141 39.108 51.092 0.02 14.71 H ANISOU 3690 HG21ATHR B 77 1835 1348 2406 84 192 290 H ATOM 3691 HG21BTHR B 77 7.901 36.673 52.872 0.02 15.01 H ANISOU 3691 HG21BTHR B 77 1896 1315 2491 -8 193 377 H ATOM 3692 HG22ATHR B 77 7.703 38.269 49.867 0.02 14.46 H ANISOU 3692 HG22ATHR B 77 1800 1252 2443 2 127 278 H ATOM 3693 HG22BTHR B 77 8.584 37.926 53.543 0.02 14.66 H ANISOU 3693 HG22BTHR B 77 1914 1308 2349 68 215 332 H ATOM 3694 HG23ATHR B 77 7.001 37.544 51.071 0.02 15.12 H ANISOU 3694 HG23ATHR B 77 1851 1377 2515 18 194 356 H ATOM 3695 HG23BTHR B 77 7.057 37.949 53.182 0.02 15.33 H ANISOU 3695 HG23BTHR B 77 1911 1439 2477 64 250 388 H ATOM 3696 N LYS B 78 9.899 39.221 48.961 0.05 13.06 N ANISOU 3696 N LYS B 78 1761 1006 2195 23 57 137 N ATOM 3697 CA LYS B 78 9.928 39.727 47.566 0.05 12.82 C ANISOU 3697 CA LYS B 78 1735 958 2179 9 12 99 C ATOM 3698 C LYS B 78 8.688 40.499 47.247 0.05 13.20 C ANISOU 3698 C LYS B 78 1730 1041 2244 27 13 118 C ATOM 3699 O LYS B 78 7.598 40.060 47.443 0.05 13.75 O ANISOU 3699 O LYS B 78 1733 1138 2354 12 24 166 O ATOM 3700 CB LYS B 78 10.029 38.522 46.578 0.05 12.83 C ANISOU 3700 CB LYS B 78 1739 915 2220 -50 -33 88 C ATOM 3701 CG LYS B 78 9.761 38.772 45.038 0.05 12.58 C ANISOU 3701 CG LYS B 78 1733 871 2178 -55 -77 43 C ATOM 3702 CD LYS B 78 9.525 37.472 44.147 0.05 12.65 C ANISOU 3702 CD LYS B 78 1764 838 2207 -99 -120 16 C ATOM 3703 CE LYS B 78 9.754 37.776 42.714 0.05 13.27 C ANISOU 3703 CE LYS B 78 1791 914 2338 -144 -157 36 C ATOM 3704 NZ LYS B 78 9.304 36.612 41.804 0.05 13.57 N ANISOU 3704 NZ LYS B 78 1856 899 2403 -191 -207 4 N ATOM 3705 H ALYS B 78 10.071 38.376 49.027 0.05 13.10 H ANISOU 3705 H ALYS B 78 1768 991 2218 -4 51 150 H ATOM 3706 H BLYS B 78 10.163 38.401 49.025 0.05 13.07 H ANISOU 3706 H BLYS B 78 1768 986 2213 -3 50 147 H ATOM 3707 HA LYS B 78 10.707 40.280 47.438 0.05 12.48 H ANISOU 3707 HA LYS B 78 1732 904 2105 27 5 66 H ATOM 3708 HB2 LYS B 78 10.929 38.175 46.654 0.05 12.67 H ANISOU 3708 HB2 LYS B 78 1749 871 2192 -55 -30 81 H ATOM 3709 HB3 LYS B 78 9.386 37.870 46.875 0.05 13.24 H ANISOU 3709 HB3 LYS B 78 1748 971 2310 -76 -37 119 H ATOM 3710 HG2 LYS B 78 8.946 39.282 44.945 0.05 12.81 H ANISOU 3710 HG2 LYS B 78 1729 921 2217 -52 -86 55 H ATOM 3711 HG3 LYS B 78 10.508 39.277 44.685 0.05 12.25 H ANISOU 3711 HG3 LYS B 78 1724 828 2102 -31 -70 21 H ATOM 3712 HD2 LYS B 78 10.120 36.768 44.433 0.05 12.45 H ANISOU 3712 HD2 LYS B 78 1765 810 2155 -90 -137 -14 H ATOM 3713 HD3 LYS B 78 8.607 37.177 44.234 0.05 12.59 H ANISOU 3713 HD3 LYS B 78 1776 806 2202 -105 -110 15 H ATOM 3714 HE2 LYS B 78 9.250 38.557 42.455 0.05 13.53 H ANISOU 3714 HE2 LYS B 78 1786 957 2398 -151 -134 76 H ATOM 3715 HE3 LYS B 78 10.699 37.921 42.615 0.05 13.34 H ANISOU 3715 HE3 LYS B 78 1783 947 2340 -136 -175 32 H ATOM 3716 HZ1 LYS B 78 8.609 36.198 42.168 0.05 14.02 H ANISOU 3716 HZ1 LYS B 78 1876 952 2498 -223 -229 22 H ATOM 3717 HZ2 LYS B 78 9.093 36.893 41.003 0.05 13.47 H ANISOU 3717 HZ2 LYS B 78 1872 883 2364 -186 -231 -32 H ATOM 3718 HZ3 LYS B 78 9.971 36.038 41.744 0.05 13.49 H ANISOU 3718 HZ3 LYS B 78 1868 862 2397 -192 -192 3 H ATOM 3719 N GLY B 79 8.900 41.722 46.741 0.05 12.96 N ANISOU 3719 N GLY B 79 1728 1010 2187 61 0 84 N ATOM 3720 CA GLY B 79 7.808 42.596 46.337 0.05 13.33 C ANISOU 3720 CA GLY B 79 1732 1085 2248 91 -4 98 C ATOM 3721 C GLY B 79 7.461 43.658 47.351 0.05 13.60 C ANISOU 3721 C GLY B 79 1766 1147 2252 166 46 103 C ATOM 3722 O GLY B 79 6.827 44.662 46.985 0.05 13.86 O ANISOU 3722 O GLY B 79 1785 1191 2289 209 42 103 O ATOM 3723 H GLY B 79 9.674 42.053 46.622 0.05 12.64 H ANISOU 3723 H GLY B 79 1729 949 2123 67 -8 55 H ATOM 3724 HA2 GLY B 79 8.024 43.038 45.510 0.05 13.16 H ANISOU 3724 HA2 GLY B 79 1731 1048 2221 89 -35 77 H ATOM 3725 HA3 GLY B 79 7.024 42.052 46.189 0.05 13.69 H ANISOU 3725 HA3 GLY B 79 1725 1149 2329 69 -10 129 H ATOM 3726 N ASP B 80 7.833 43.481 48.592 0.05 13.65 N ANISOU 3726 N ASP B 80 1793 1166 2226 189 90 106 N ATOM 3727 CA ASP B 80 7.530 44.474 49.622 0.05 14.04 C ANISOU 3727 CA ASP B 80 1856 1244 2235 268 138 100 C ATOM 3728 C ASP B 80 8.342 45.747 49.413 0.05 13.76 C ANISOU 3728 C ASP B 80 1897 1163 2167 301 114 40 C ATOM 3729 O ASP B 80 9.460 45.730 48.951 0.05 13.22 O ANISOU 3729 O ASP B 80 1879 1052 2092 263 78 7 O ATOM 3730 CB ASP B 80 7.830 43.932 51.006 0.05 14.26 C ANISOU 3730 CB ASP B 80 1897 1300 2220 286 185 115 C ATOM 3731 CG ASP B 80 6.938 42.742 51.395 0.05 14.76 C ANISOU 3731 CG ASP B 80 1881 1409 2318 259 221 192 C ATOM 3732 OD1 ASP B 80 5.896 42.502 50.772 0.05 15.10 O ANISOU 3732 OD1 ASP B 80 1847 1471 2419 237 215 231 O ATOM 3733 OD2 ASP B 80 7.285 42.084 52.408 0.05 14.94 O ANISOU 3733 OD2 ASP B 80 1916 1451 2308 261 255 217 O ATOM 3734 H ASP B 80 8.290 42.821 48.888 0.05 13.50 H ANISOU 3734 H ASP B 80 1786 1140 2204 164 92 110 H ATOM 3735 HA ASP B 80 6.590 44.690 49.582 0.05 14.48 H ANISOU 3735 HA ASP B 80 1862 1329 2309 293 154 127 H ATOM 3736 HB2 ASP B 80 8.758 43.676 51.048 0.05 13.87 H ANISOU 3736 HB2 ASP B 80 1891 1223 2155 261 165 93 H ATOM 3737 HB3 ASP B 80 7.663 44.628 51.654 0.05 14.57 H ANISOU 3737 HB3 ASP B 80 1956 1357 2223 344 214 102 H ATOM 3738 N LEU B 81 7.681 46.863 49.734 0.05 14.25 N ANISOU 3738 N LEU B 81 1962 1234 2218 374 136 30 N ATOM 3739 CA LEU B 81 8.277 48.210 49.725 0.05 14.23 C ANISOU 3739 CA LEU B 81 2037 1180 2190 414 118 -26 C ATOM 3740 C LEU B 81 8.275 48.729 51.141 0.05 14.78 C ANISOU 3740 C LEU B 81 2148 1265 2203 488 161 -55 C ATOM 3741 O LEU B 81 7.323 48.561 51.880 0.05 15.39 O ANISOU 3741 O LEU B 81 2182 1401 2265 542 216 -26 O ATOM 3742 CB LEU B 81 7.465 49.173 48.845 0.05 14.49 C ANISOU 3742 CB LEU B 81 2057 1191 2258 446 99 -20 C ATOM 3743 CG LEU B 81 7.724 49.317 47.329 0.05 13.97 C ANISOU 3743 CG LEU B 81 2010 1079 2218 386 40 -23 C ATOM 3744 CD1 LEU B 81 8.881 48.484 46.818 0.05 13.54 C ANISOU 3744 CD1 LEU B 81 1912 1048 2184 310 18 5 C ATOM 3745 CD2 LEU B 81 6.457 49.095 46.499 0.05 14.38 C ANISOU 3745 CD2 LEU B 81 2047 1120 2298 429 25 -5 C ATOM 3746 H LEU B 81 6.867 46.867 49.984 0.05 14.67 H ANISOU 3746 H LEU B 81 1972 1321 2280 404 163 56 H ATOM 3747 HA LEU B 81 9.192 48.153 49.421 0.05 13.80 H ANISOU 3747 HA LEU B 81 2019 1092 2132 373 88 -47 H ATOM 3748 HB2 LEU B 81 6.534 48.929 48.944 0.05 14.80 H ANISOU 3748 HB2 LEU B 81 2036 1271 2318 462 116 16 H ATOM 3749 HB3 LEU B 81 7.586 50.060 49.212 0.05 14.80 H ANISOU 3749 HB3 LEU B 81 2137 1207 2279 497 107 -49 H ATOM 3750 HG LEU B 81 7.987 50.239 47.179 0.05 13.75 H ANISOU 3750 HG LEU B 81 2037 1012 2176 374 25 -53 H ATOM 3751 HD11 LEU B 81 9.137 48.856 45.961 0.05 13.29 H ANISOU 3751 HD11 LEU B 81 1899 993 2159 282 -14 0 H ATOM 3752 HD12 LEU B 81 9.622 48.532 47.432 0.05 13.32 H ANISOU 3752 HD12 LEU B 81 1896 1024 2141 288 28 -4 H ATOM 3753 HD13 LEU B 81 8.580 47.574 46.707 0.05 13.82 H ANISOU 3753 HD13 LEU B 81 1892 1119 2240 316 25 35 H ATOM 3754 HD21 LEU B 81 6.636 49.354 45.583 0.05 14.24 H ANISOU 3754 HD21 LEU B 81 2074 1056 2282 419 -1 -20 H ATOM 3755 HD22 LEU B 81 6.240 48.145 46.531 0.05 14.38 H ANISOU 3755 HD22 LEU B 81 1995 1150 2319 406 12 27 H ATOM 3756 HD23 LEU B 81 5.731 49.612 46.873 0.05 14.86 H ANISOU 3756 HD23 LEU B 81 2103 1190 2354 490 54 -8 H ATOM 3757 N AILE B 82 9.379 49.378 51.494 0.03 14.65 N ANISOU 3757 N AILE B 82 2215 1198 2154 488 133 -113 N ATOM 3758 N BILE B 82 9.348 49.394 51.517 0.02 14.68 N ANISOU 3758 N BILE B 82 2218 1202 2156 490 134 -113 N ATOM 3759 CA AILE B 82 9.602 49.992 52.794 0.03 15.23 C ANISOU 3759 CA AILE B 82 2352 1273 2163 553 153 -163 C ATOM 3760 CA BILE B 82 9.378 49.995 52.822 0.02 15.32 C ANISOU 3760 CA BILE B 82 2354 1292 2174 563 162 -157 C ATOM 3761 C AILE B 82 10.034 51.419 52.589 0.03 15.50 C ANISOU 3761 C AILE B 82 2461 1225 2201 582 115 -224 C ATOM 3762 C BILE B 82 10.075 51.350 52.749 0.02 15.51 C ANISOU 3762 C BILE B 82 2468 1234 2193 582 117 -227 C ATOM 3763 O AILE B 82 10.984 51.650 51.884 0.03 15.04 O ANISOU 3763 O AILE B 82 2428 1108 2179 522 63 -236 O ATOM 3764 O BILE B 82 11.165 51.482 52.221 0.02 15.03 O ANISOU 3764 O BILE B 82 2438 1118 2156 517 63 -245 O ATOM 3765 CB AILE B 82 10.777 49.328 53.507 0.03 14.95 C ANISOU 3765 CB AILE B 82 2353 1245 2084 511 136 -180 C ATOM 3766 CB BILE B 82 9.939 48.985 53.855 0.02 15.26 C ANISOU 3766 CB BILE B 82 2353 1331 2113 544 180 -149 C ATOM 3767 CG1AILE B 82 10.517 47.836 53.718 0.03 14.88 C ANISOU 3767 CG1AILE B 82 2280 1307 2065 491 178 -116 C ATOM 3768 CG1BILE B 82 9.497 49.338 55.270 0.02 16.14 C ANISOU 3768 CG1BILE B 82 2510 1481 2142 635 224 -181 C ATOM 3769 CG2AILE B 82 11.076 50.040 54.800 0.03 15.61 C ANISOU 3769 CG2AILE B 82 2520 1316 2095 572 133 -248 C ATOM 3770 CG2BILE B 82 11.427 48.816 53.690 0.02 14.63 C ANISOU 3770 CG2BILE B 82 2314 1207 2037 470 121 -175 C ATOM 3771 CD1AILE B 82 9.670 47.524 54.874 0.03 15.71 C ANISOU 3771 CD1AILE B 82 2367 1485 2119 571 250 -93 C ATOM 3772 CD1BILE B 82 9.805 48.257 56.263 0.02 16.25 C ANISOU 3772 CD1BILE B 82 2527 1554 2095 628 247 -159 C ATOM 3773 H AILE B 82 10.047 49.475 50.974 0.05 14.28 H ANISOU 3773 H AILE B 82 2189 1115 2121 447 98 -126 H ATOM 3774 H BILE B 82 10.055 49.503 51.055 0.05 14.31 H ANISOU 3774 H BILE B 82 2196 1119 2122 451 99 -129 H ATOM 3775 HA AILE B 82 8.805 49.951 53.340 0.05 15.73 H ANISOU 3775 HA AILE B 82 2390 1380 2206 607 199 -146 H ATOM 3776 HA BILE B 82 8.466 50.162 53.084 0.05 15.81 H ANISOU 3776 HA BILE B 82 2389 1388 2231 619 202 -141 H ATOM 3777 HB AILE B 82 11.550 49.422 52.935 0.05 14.48 H ANISOU 3777 HB AILE B 82 2303 1148 2050 457 96 -188 H ATOM 3778 HB BILE B 82 9.542 48.127 53.647 0.05 15.15 H ANISOU 3778 HB BILE B 82 2281 1356 2118 522 203 -98 H ATOM 3779 HG12AILE B 82 10.085 47.474 52.933 0.05 14.59 H ANISOU 3779 HG12AILE B 82 2193 1273 2077 456 176 -80 H ATOM 3780 HG12BILE B 82 9.934 50.156 55.551 0.05 16.33 H ANISOU 3780 HG12BILE B 82 2597 1460 2148 655 194 -238 H ATOM 3781 HG13AILE B 82 11.366 47.381 53.846 0.05 14.65 H ANISOU 3781 HG13AILE B 82 2272 1275 2017 459 160 -123 H ATOM 3782 HG13BILE B 82 8.535 49.455 55.274 0.05 16.57 H ANISOU 3782 HG13BILE B 82 2528 1569 2200 684 267 -157 H ATOM 3783 HG21AILE B 82 10.243 50.336 55.197 0.05 16.17 H ANISOU 3783 HG21AILE B 82 2592 1405 2147 638 169 -254 H ATOM 3784 HG21BILE B 82 11.581 48.416 52.823 0.05 14.16 H ANISOU 3784 HG21BILE B 82 2223 1133 2023 421 103 -151 H ATOM 3785 HG22AILE B 82 11.548 49.443 55.400 0.05 15.62 H ANISOU 3785 HG22AILE B 82 2528 1349 2057 563 137 -244 H ATOM 3786 HG22BILE B 82 11.865 49.678 53.749 0.05 14.76 H ANISOU 3786 HG22BILE B 82 2384 1181 2045 480 91 -222 H ATOM 3787 HG23AILE B 82 11.626 50.808 54.585 0.05 15.53 H ANISOU 3787 HG23AILE B 82 2553 1248 2099 553 88 -287 H ATOM 3788 HG23BILE B 82 11.758 48.234 54.387 0.05 14.66 H ANISOU 3788 HG23BILE B 82 2321 1241 2007 464 130 -167 H ATOM 3789 HD11AILE B 82 8.854 48.045 54.821 0.05 16.03 H ANISOU 3789 HD11AILE B 82 2386 1529 2175 611 270 -90 H ATOM 3790 HD11BILE B 82 8.995 48.052 56.759 0.05 16.92 H ANISOU 3790 HD11BILE B 82 2635 1673 2121 694 283 -174 H ATOM 3791 HD12AILE B 82 9.469 46.576 54.848 0.05 15.68 H ANISOU 3791 HD12AILE B 82 2316 1520 2121 547 274 -42 H ATOM 3792 HD12BILE B 82 10.109 47.470 55.784 0.05 16.05 H ANISOU 3792 HD12BILE B 82 2440 1560 2098 596 269 -100 H ATOM 3793 HD13AILE B 82 10.147 47.736 55.690 0.05 16.04 H ANISOU 3793 HD13AILE B 82 2464 1529 2102 606 250 -132 H ATOM 3794 HD13BILE B 82 10.500 48.561 56.866 0.05 15.94 H ANISOU 3794 HD13BILE B 82 2526 1485 2046 589 203 -187 H ATOM 3795 N ILE B 83 9.363 52.339 53.260 0.05 16.35 N ANISOU 3795 N ILE B 83 2609 1332 2273 677 145 -262 N ATOM 3796 CA ILE B 83 9.790 53.747 53.282 0.05 16.84 C ANISOU 3796 CA ILE B 83 2761 1303 2335 711 105 -332 C ATOM 3797 C ILE B 83 10.406 53.963 54.643 0.05 17.27 C ANISOU 3797 C ILE B 83 2896 1352 2313 729 90 -402 C ATOM 3798 O ILE B 83 9.731 53.731 55.675 0.05 17.75 O ANISOU 3798 O ILE B 83 2955 1487 2302 788 142 -405 O ATOM 3799 CB ILE B 83 8.594 54.682 53.130 0.05 17.68 C ANISOU 3799 CB ILE B 83 2866 1402 2450 817 144 -337 C ATOM 3800 CG1 ILE B 83 7.768 54.375 51.882 0.05 17.38 C ANISOU 3800 CG1 ILE B 83 2738 1383 2483 804 152 -261 C ATOM 3801 CG2 ILE B 83 9.059 56.146 53.132 0.05 18.37 C ANISOU 3801 CG2 ILE B 83 3061 1379 2541 860 101 -416 C ATOM 3802 CD1 ILE B 83 8.511 54.186 50.596 0.05 16.52 C ANISOU 3802 CD1 ILE B 83 2612 1232 2434 701 94 -229 C ATOM 3803 H AILE B 83 8.656 52.183 53.713 0.05 16.73 H ANISOU 3803 H AILE B 83 2634 1428 2296 724 188 -248 H ATOM 3804 H BILE B 83 8.592 52.227 53.611 0.05 16.74 H ANISOU 3804 H BILE B 83 2629 1426 2304 725 188 -244 H ATOM 3805 HA ILE B 83 10.442 53.930 52.590 0.05 16.45 H ANISOU 3805 HA ILE B 83 2721 1202 2327 657 62 -330 H ATOM 3806 HB ILE B 83 8.016 54.547 53.897 0.05 18.13 H ANISOU 3806 HB ILE B 83 2911 1515 2462 875 192 -337 H ATOM 3807 HG12 ILE B 83 7.280 53.563 52.065 0.05 17.31 H ANISOU 3807 HG12 ILE B 83 2666 1445 2466 805 189 -221 H ATOM 3808 HG13 ILE B 83 7.144 55.107 51.740 0.05 17.95 H ANISOU 3808 HG13 ILE B 83 2820 1430 2569 869 163 -270 H ATOM 3809 HG21 ILE B 83 8.334 56.714 52.828 0.05 18.54 H ANISOU 3809 HG21 ILE B 83 3071 1365 2606 883 98 -399 H ATOM 3810 HG22 ILE B 83 9.313 56.375 54.040 0.05 19.04 H ANISOU 3810 HG22 ILE B 83 3187 1476 2573 929 126 -460 H ATOM 3811 HG23 ILE B 83 9.820 56.229 52.538 0.05 18.04 H ANISOU 3811 HG23 ILE B 83 3054 1292 2507 795 52 -437 H ATOM 3812 HD11 ILE B 83 9.082 53.405 50.675 0.05 16.00 H ANISOU 3812 HD11 ILE B 83 2530 1194 2356 643 88 -219 H ATOM 3813 HD12 ILE B 83 7.862 54.048 49.893 0.05 16.50 H ANISOU 3813 HD12 ILE B 83 2555 1249 2464 706 100 -185 H ATOM 3814 HD13 ILE B 83 9.048 54.971 50.406 0.05 16.60 H ANISOU 3814 HD13 ILE B 83 2679 1172 2457 691 58 -260 H ATOM 3815 N ILE B 84 11.670 54.377 54.686 0.05 17.15 N ANISOU 3815 N ILE B 84 2945 1259 2312 671 19 -450 N ATOM 3816 CA ILE B 84 12.270 54.718 55.976 0.05 17.68 C ANISOU 3816 CA ILE B 84 3095 1311 2313 679 -19 -526 C ATOM 3817 C ILE B 84 11.972 56.191 56.387 0.05 18.77 C ANISOU 3817 C ILE B 84 3327 1364 2439 756 -39 -608 C ATOM 3818 O ILE B 84 12.368 57.135 55.700 0.05 18.85 O ANISOU 3818 O ILE B 84 3378 1270 2515 715 -98 -632 O ATOM 3819 CB ILE B 84 13.755 54.577 55.982 0.05 17.12 C ANISOU 3819 CB ILE B 84 3033 1194 2279 567 -96 -531 C ATOM 3820 CG1 ILE B 84 14.213 53.198 55.541 0.05 16.06 C ANISOU 3820 CG1 ILE B 84 2807 1115 2178 490 -80 -449 C ATOM 3821 CG2 ILE B 84 14.261 54.906 57.388 0.05 17.73 C ANISOU 3821 CG2 ILE B 84 3184 1270 2284 568 -145 -604 C ATOM 3822 CD1 ILE B 84 13.540 52.101 56.223 0.05 15.94 C ANISOU 3822 CD1 ILE B 84 2757 1200 2101 509 -35 -418 C ATOM 3823 H ILE B 84 12.192 54.461 54.012 0.05 16.81 H ANISOU 3823 H ILE B 84 2895 1174 2317 623 -12 -438 H ATOM 3824 HA ILE B 84 11.919 54.135 56.662 0.05 17.83 H ANISOU 3824 HA ILE B 84 3105 1395 2273 707 14 -521 H ATOM 3825 HB ILE B 84 14.126 55.219 55.359 0.05 17.18 H ANISOU 3825 HB ILE B 84 3059 1131 2337 544 -128 -541 H ATOM 3826 HG12 ILE B 84 14.032 53.103 54.590 0.05 15.77 H ANISOU 3826 HG12 ILE B 84 2732 1080 2182 490 -57 -411 H ATOM 3827 HG13 ILE B 84 15.166 53.110 55.697 0.05 15.80 H ANISOU 3827 HG13 ILE B 84 2778 1053 2170 428 -124 -453 H ATOM 3828 HG21 ILE B 84 14.987 54.306 57.610 0.05 17.50 H ANISOU 3828 HG21 ILE B 84 3156 1205 2289 499 -197 -607 H ATOM 3829 HG22 ILE B 84 14.566 55.827 57.401 0.05 18.49 H ANISOU 3829 HG22 ILE B 84 3342 1328 2355 622 -154 -661 H ATOM 3830 HG23 ILE B 84 13.526 54.794 58.013 0.05 17.67 H ANISOU 3830 HG23 ILE B 84 3156 1334 2224 585 -116 -586 H ATOM 3831 HD11 ILE B 84 12.646 52.028 55.865 0.05 16.30 H ANISOU 3831 HD11 ILE B 84 2795 1278 2119 571 12 -412 H ATOM 3832 HD12 ILE B 84 14.041 51.287 56.059 0.05 15.33 H ANISOU 3832 HD12 ILE B 84 2627 1146 2054 463 -27 -369 H ATOM 3833 HD13 ILE B 84 13.505 52.286 57.176 0.05 16.21 H ANISOU 3833 HD13 ILE B 84 2829 1240 2091 507 -61 -451 H ATOM 3834 N PRO B 85 11.222 56.390 57.467 0.05 19.68 N ANISOU 3834 N PRO B 85 3478 1523 2477 871 15 -646 N ATOM 3835 CA PRO B 85 10.998 57.782 57.902 0.05 20.84 C ANISOU 3835 CA PRO B 85 3719 1582 2616 960 1 -730 C ATOM 3836 C PRO B 85 12.315 58.522 58.208 0.05 21.39 C ANISOU 3836 C PRO B 85 3898 1556 2671 918 -96 -826 C ATOM 3837 O PRO B 85 13.237 57.903 58.669 0.05 21.23 O ANISOU 3837 O PRO B 85 3891 1574 2602 866 -134 -845 O ATOM 3838 CB PRO B 85 10.200 57.619 59.198 0.05 21.74 C ANISOU 3838 CB PRO B 85 3840 1788 2631 1094 88 -746 C ATOM 3839 CG PRO B 85 9.586 56.255 59.099 0.05 21.00 C ANISOU 3839 CG PRO B 85 3641 1829 2511 1065 152 -652 C ATOM 3840 CD PRO B 85 10.546 55.418 58.339 0.05 19.87 C ANISOU 3840 CD PRO B 85 3466 1672 2412 927 89 -618 C ATOM 3841 HA PRO B 85 10.481 58.262 57.238 0.05 20.76 H ANISOU 3841 HA PRO B 85 3692 1526 2671 964 2 -707 H ATOM 3842 HB2 PRO B 85 10.795 57.681 59.961 0.05 22.44 H ANISOU 3842 HB2 PRO B 85 4008 1865 2654 1130 68 -818 H ATOM 3843 HB3 PRO B 85 9.516 58.307 59.252 0.05 22.12 H ANISOU 3843 HB3 PRO B 85 3879 1819 2705 1158 122 -740 H ATOM 3844 HG2 PRO B 85 9.440 55.889 59.984 0.05 21.55 H ANISOU 3844 HG2 PRO B 85 3733 1956 2497 1118 184 -672 H ATOM 3845 HG3 PRO B 85 8.754 56.340 58.616 0.05 20.83 H ANISOU 3845 HG3 PRO B 85 3551 1835 2529 1085 198 -596 H ATOM 3846 HD2 PRO B 85 11.191 55.003 58.931 0.05 20.00 H ANISOU 3846 HD2 PRO B 85 3520 1706 2374 911 64 -648 H ATOM 3847 HD3 PRO B 85 10.076 54.752 57.815 0.05 19.25 H ANISOU 3847 HD3 PRO B 85 3308 1644 2362 895 121 -547 H ATOM 3848 N LEU B 86 12.395 59.834 57.937 0.05 22.16 N ANISOU 3848 N LEU B 86 4075 1526 2819 943 -141 -887 N ATOM 3849 CA LEU B 86 13.546 60.661 58.378 0.05 22.90 C ANISOU 3849 CA LEU B 86 4275 1510 2916 897 -244 -982 C ATOM 3850 C LEU B 86 13.820 60.448 59.854 0.05 23.82 C ANISOU 3850 C LEU B 86 4470 1679 2902 962 -252 -1073 C ATOM 3851 O LEU B 86 12.875 60.353 60.637 0.05 24.49 O ANISOU 3851 O LEU B 86 4574 1830 2900 1090 -175 -1095 O ATOM 3852 CB LEU B 86 13.296 62.164 58.156 0.05 23.90 C ANISOU 3852 CB LEU B 86 4485 1485 3109 942 -279 -1036 C ATOM 3853 CG LEU B 86 12.778 62.633 56.794 0.05 23.37 C ANISOU 3853 CG LEU B 86 4370 1338 3172 887 -287 -957 C ATOM 3854 CD1 LEU B 86 12.934 64.166 56.675 0.05 24.68 C ANISOU 3854 CD1 LEU B 86 4651 1324 3400 913 -352 -1032 C ATOM 3855 CD2 LEU B 86 13.486 61.956 55.645 0.05 22.20 C ANISOU 3855 CD2 LEU B 86 4144 1204 3084 737 -327 -881 C ATOM 3856 H LEU B 86 11.805 60.267 57.493 0.05 22.33 H ANISOU 3856 H LEU B 86 4089 1518 2876 985 -117 -872 H ATOM 3857 HA LEU B 86 14.337 60.394 57.878 0.05 22.29 H ANISOU 3857 HA LEU B 86 4166 1421 2881 798 -289 -952 H ATOM 3858 HB2 LEU B 86 12.643 62.456 58.811 0.05 24.53 H ANISOU 3858 HB2 LEU B 86 4591 1582 3145 1048 -229 -1064 H ATOM 3859 HB3 LEU B 86 14.129 62.636 58.319 0.05 24.51 H ANISOU 3859 HB3 LEU B 86 4637 1491 3185 911 -350 -1105 H ATOM 3860 HG LEU B 86 11.836 62.413 56.727 0.05 23.10 H ANISOU 3860 HG LEU B 86 4283 1355 3139 941 -223 -907 H ATOM 3861 HD11 LEU B 86 12.215 64.509 56.123 0.05 24.66 H ANISOU 3861 HD11 LEU B 86 4627 1290 3451 944 -325 -987 H ATOM 3862 HD12 LEU B 86 12.898 64.567 57.559 0.05 25.60 H ANISOU 3862 HD12 LEU B 86 4842 1426 3457 994 -351 -1113 H ATOM 3863 HD13 LEU B 86 13.790 64.368 56.263 0.05 24.67 H ANISOU 3863 HD13 LEU B 86 4669 1258 3445 821 -421 -1040 H ATOM 3864 HD21 LEU B 86 13.463 62.523 54.861 0.05 22.18 H ANISOU 3864 HD21 LEU B 86 4141 1127 3160 699 -351 -851 H ATOM 3865 HD22 LEU B 86 14.401 61.791 55.912 0.05 22.35 H ANISOU 3865 HD22 LEU B 86 4194 1217 3082 689 -378 -923 H ATOM 3866 HD23 LEU B 86 13.048 61.110 55.460 0.05 21.39 H ANISOU 3866 HD23 LEU B 86 3964 1198 2964 732 -277 -820 H ATOM 3867 N ASP B 87 15.096 60.381 60.238 0.05 23.97 N ANISOU 3867 N ASP B 87 4532 1673 2903 879 -345 -1122 N ATOM 3868 CA ASP B 87 15.495 60.519 61.656 0.05 25.17 C ANISOU 3868 CA ASP B 87 4788 1847 2929 936 -385 -1231 C ATOM 3869 C ASP B 87 15.328 59.120 62.287 0.05 24.62 C ANISOU 3869 C ASP B 87 4652 1949 2755 963 -313 -1171 C ATOM 3870 O ASP B 87 15.230 58.977 63.515 0.05 25.58 O ANISOU 3870 O ASP B 87 4840 2136 2742 1045 -304 -1234 O ATOM 3871 CB ASP B 87 14.641 61.588 62.428 0.05 26.76 C ANISOU 3871 CB ASP B 87 5110 1995 3064 1088 -361 -1340 C ATOM 3872 CG ASP B 87 15.349 63.009 62.640 0.05 27.93 C ANISOU 3872 CG ASP B 87 5379 1950 3284 1069 -469 -1448 C ATOM 3873 OD1 ASP B 87 14.715 64.110 62.397 0.05 28.36 O ANISOU 3873 OD1 ASP B 87 5458 1908 3407 1131 -440 -1453 O ATOM 3874 OD2 ASP B 87 16.483 63.082 63.180 0.05 28.68 O ANISOU 3874 OD2 ASP B 87 5554 1986 3358 1007 -583 -1535 O ATOM 3875 H ASP B 87 15.757 60.262 59.701 0.05 23.45 H ANISOU 3875 H ASP B 87 4434 1582 2893 789 -389 -1092 H ATOM 3876 HA ASP B 87 16.426 60.787 61.715 0.05 25.40 H ANISOU 3876 HA ASP B 87 4851 1822 2977 864 -472 -1271 H ATOM 3877 HB2 ASP B 87 13.818 61.786 61.974 0.05 26.63 H ANISOU 3877 HB2 ASP B 87 5058 2005 3057 1156 -282 -1300 H ATOM 3878 HB3 ASP B 87 14.435 61.238 63.308 0.05 27.38 H ANISOU 3878 HB3 ASP B 87 5234 2133 3036 1140 -358 -1389 H ATOM 3879 N SER B 88 15.223 58.099 61.438 0.05 23.22 N ANISOU 3879 N SER B 88 4347 1839 2636 901 -260 -1048 N ATOM 3880 CA SER B 88 15.008 56.734 61.928 0.05 22.70 C ANISOU 3880 CA SER B 88 4211 1921 2493 916 -190 -976 C ATOM 3881 C SER B 88 16.221 55.875 61.820 0.05 21.81 C ANISOU 3881 C SER B 88 4043 1835 2409 794 -249 -927 C ATOM 3882 O SER B 88 16.852 55.802 60.747 0.05 20.90 O ANISOU 3882 O SER B 88 3869 1666 2406 694 -282 -879 O ATOM 3883 CB SER B 88 13.967 56.025 61.083 0.05 21.95 C ANISOU 3883 CB SER B 88 4011 1892 2439 950 -78 -871 C ATOM 3884 OG SER B 88 14.628 55.306 60.051 0.05 20.67 O ANISOU 3884 OG SER B 88 3757 1702 2397 844 -90 -788 O ATOM 3885 H SER B 88 15.272 58.163 60.584 0.05 22.60 H ANISOU 3885 H SER B 88 4224 1723 2641 849 -264 -1005 H ATOM 3886 HA SER B 88 14.715 56.740 62.853 0.05 23.50 H ANISOU 3886 HA SER B 88 4366 2068 2495 987 -176 -1021 H ATOM 3887 HB2 SER B 88 13.479 55.402 61.643 0.05 21.94 H ANISOU 3887 HB2 SER B 88 3978 1981 2375 978 -28 -834 H ATOM 3888 HB3 SER B 88 13.360 56.681 60.710 0.05 22.50 H ANISOU 3888 HB3 SER B 88 4106 1932 2510 1022 -47 -898 H ATOM 3889 HG SER B 88 14.773 54.518 60.295 0.05 20.24 H ANISOU 3889 HG SER B 88 3679 1667 2343 785 -117 -767 H ATOM 3890 N AGLU B 89 16.551 55.206 62.915 0.03 22.16 N ANISOU 3890 N AGLU B 89 4107 1966 2348 808 -260 -936 N ATOM 3891 N BGLU B 89 16.533 55.149 62.893 0.02 22.13 N ANISOU 3891 N BGLU B 89 4098 1964 2344 807 -258 -932 N ATOM 3892 CA AGLU B 89 17.552 54.159 62.830 0.03 21.33 C ANISOU 3892 CA AGLU B 89 3934 1906 2265 711 -297 -872 C ATOM 3893 CA BGLU B 89 17.532 54.070 62.823 0.02 21.31 C ANISOU 3893 CA BGLU B 89 3930 1903 2264 707 -300 -871 C ATOM 3894 C AGLU B 89 16.923 52.993 62.072 0.03 20.11 C ANISOU 3894 C AGLU B 89 3661 1813 2168 685 -210 -748 C ATOM 3895 C BGLU B 89 16.869 52.839 62.216 0.02 20.17 C ANISOU 3895 C BGLU B 89 3670 1835 2158 689 -208 -746 C ATOM 3896 O AGLU B 89 15.766 52.616 62.293 0.03 20.13 O ANISOU 3896 O AGLU B 89 3633 1876 2141 757 -113 -704 O ATOM 3897 O BGLU B 89 15.644 52.720 62.213 0.02 20.27 O ANISOU 3897 O BGLU B 89 3658 1905 2137 766 -112 -708 O ATOM 3898 CB AGLU B 89 18.141 53.741 64.188 0.03 22.11 C ANISOU 3898 CB AGLU B 89 4082 2085 2234 738 -334 -904 C ATOM 3899 CB BGLU B 89 18.124 53.713 64.205 0.02 22.15 C ANISOU 3899 CB BGLU B 89 4093 2078 2244 729 -349 -913 C ATOM 3900 CG AGLU B 89 19.265 54.700 64.671 0.03 23.26 C ANISOU 3900 CG AGLU B 89 4336 2154 2346 725 -458 -1029 C ATOM 3901 CG BGLU B 89 17.117 53.167 65.220 0.02 22.79 C ANISOU 3901 CG BGLU B 89 4194 2277 2187 845 -257 -894 C ATOM 3902 CD AGLU B 89 20.047 54.167 65.853 0.03 24.01 C ANISOU 3902 CD AGLU B 89 4473 2323 2326 728 -525 -1059 C ATOM 3903 CD BGLU B 89 17.727 52.863 66.590 0.02 23.78 C ANISOU 3903 CD BGLU B 89 4388 2472 2175 872 -315 -938 C ATOM 3904 OE1AGLU B 89 21.011 54.834 66.306 0.03 24.96 O ANISOU 3904 OE1AGLU B 89 4670 2383 2428 698 -644 -1158 O ATOM 3905 OE1BGLU B 89 16.975 52.459 67.506 0.02 24.49 O ANISOU 3905 OE1BGLU B 89 4504 2665 2136 970 -243 -922 O ATOM 3906 OE2AGLU B 89 19.698 53.075 66.318 0.03 23.74 O ANISOU 3906 OE2AGLU B 89 4394 2404 2223 755 -468 -982 O ATOM 3907 OE2BGLU B 89 18.951 53.037 66.758 0.02 23.93 O ANISOU 3907 OE2BGLU B 89 4432 2447 2214 796 -434 -985 O ATOM 3908 H AGLU B 89 16.210 55.323 63.691 0.05 22.91 H ANISOU 3908 H AGLU B 89 4253 2096 2357 877 -245 -976 H ATOM 3909 H BGLU B 89 16.170 55.243 63.662 0.05 22.84 H ANISOU 3909 H BGLU B 89 4235 2095 2348 877 -238 -967 H ATOM 3910 HA AGLU B 89 18.285 54.501 62.315 0.05 21.14 H ANISOU 3910 HA AGLU B 89 3910 1814 2309 640 -363 -889 H ATOM 3911 HA BGLU B 89 18.263 54.336 62.242 0.05 21.02 H ANISOU 3911 HA BGLU B 89 3885 1799 2304 633 -360 -879 H ATOM 3912 HB2AGLU B 89 17.437 53.732 64.853 0.05 22.56 H ANISOU 3912 HB2AGLU B 89 4158 2204 2209 819 -272 -900 H ATOM 3913 HB2BGLU B 89 18.801 53.030 64.080 0.05 21.61 H ANISOU 3913 HB2BGLU B 89 3975 2035 2201 666 -376 -866 H ATOM 3914 HB3AGLU B 89 18.523 52.855 64.097 0.05 21.53 H ANISOU 3914 HB3AGLU B 89 3954 2049 2178 684 -346 -847 H ATOM 3915 HB3BGLU B 89 18.534 54.507 64.588 0.05 22.91 H ANISOU 3915 HB3BGLU B 89 4263 2121 2321 732 -419 -997 H ATOM 3916 HG2AGLU B 89 19.894 54.854 63.951 0.05 22.89 H ANISOU 3916 HG2AGLU B 89 4269 2037 2393 646 -514 -1030 H ATOM 3917 HG2BGLU B 89 16.425 53.831 65.358 0.05 23.36 H ANISOU 3917 HG2BGLU B 89 4309 2332 2233 917 -222 -937 H ATOM 3918 HG3AGLU B 89 18.860 55.539 64.940 0.05 23.99 H ANISOU 3918 HG3AGLU B 89 4496 2217 2403 794 -444 -1092 H ATOM 3919 HG3BGLU B 89 16.728 52.347 64.872 0.05 22.09 H ANISOU 3919 HG3BGLU B 89 4031 2241 2123 834 -194 -807 H ATOM 3920 N AHIS B 90 17.686 52.480 61.124 0.03 19.15 N ANISOU 3920 N AHIS B 90 3471 1672 2133 581 -246 -694 N ATOM 3921 N BHIS B 90 17.664 51.894 61.733 0.02 19.21 N ANISOU 3921 N BHIS B 90 3476 1714 2109 591 -238 -684 N ATOM 3922 CA AHIS B 90 17.275 51.322 60.356 0.03 18.09 C ANISOU 3922 CA AHIS B 90 3235 1582 2055 550 -178 -589 C ATOM 3923 CA BHIS B 90 17.066 50.699 61.211 0.02 18.28 C ANISOU 3923 CA BHIS B 90 3261 1660 2024 572 -163 -575 C ATOM 3924 C AHIS B 90 18.457 50.442 60.053 0.03 17.48 C ANISOU 3924 C AHIS B 90 3108 1527 2005 468 -220 -542 C ATOM 3925 C BHIS B 90 18.042 49.550 61.011 0.02 17.78 C ANISOU 3925 C BHIS B 90 3147 1646 1961 511 -187 -516 C ATOM 3926 O AHIS B 90 19.588 50.908 59.887 0.03 17.51 O ANISOU 3926 O AHIS B 90 3124 1483 2046 404 -303 -575 O ATOM 3927 O BHIS B 90 19.240 49.746 60.864 0.02 17.81 O ANISOU 3927 O BHIS B 90 3162 1622 1982 454 -270 -542 O ATOM 3928 CB AHIS B 90 16.602 51.762 59.052 0.03 17.53 C ANISOU 3928 CB AHIS B 90 3127 1446 2086 530 -154 -567 C ATOM 3929 CB BHIS B 90 16.325 51.000 59.915 0.02 17.46 C ANISOU 3929 CB BHIS B 90 3098 1503 2034 537 -131 -535 C ATOM 3930 CG AHIS B 90 17.328 52.850 58.312 0.03 17.51 C ANISOU 3930 CG AHIS B 90 3153 1339 2162 465 -232 -610 C ATOM 3931 CG BHIS B 90 17.204 51.548 58.848 0.02 16.87 C ANISOU 3931 CG BHIS B 90 3002 1353 2055 441 -199 -535 C ATOM 3932 ND1AHIS B 90 17.402 54.154 58.765 0.03 18.45 N ANISOU 3932 ND1AHIS B 90 3361 1378 2269 491 -286 -700 N ATOM 3933 ND1BHIS B 90 17.502 52.887 58.738 0.02 17.22 N ANISOU 3933 ND1BHIS B 90 3093 1302 2146 421 -254 -593 N ATOM 3934 CD2AHIS B 90 17.942 52.841 57.103 0.03 16.76 C ANISOU 3934 CD2AHIS B 90 3005 1202 2162 378 -259 -568 C ATOM 3935 CD2BHIS B 90 17.868 50.928 57.851 0.02 16.06 C ANISOU 3935 CD2BHIS B 90 2832 1257 2011 362 -213 -478 C ATOM 3936 CE1AHIS B 90 18.075 54.877 57.891 0.03 18.26 C ANISOU 3936 CE1AHIS B 90 3334 1267 2338 411 -346 -703 C ATOM 3937 CE1BHIS B 90 18.303 53.069 57.704 0.02 16.65 C ANISOU 3937 CE1BHIS B 90 2979 1189 2156 330 -297 -565 C ATOM 3938 NE2AHIS B 90 18.400 54.115 56.866 0.03 17.24 N ANISOU 3938 NE2AHIS B 90 3117 1165 2270 345 -325 -621 N ATOM 3939 NE2BHIS B 90 18.550 51.892 57.159 0.02 15.93 N ANISOU 3939 NE2BHIS B 90 2820 1163 2071 298 -271 -498 N ATOM 3940 H AHIS B 90 18.451 52.796 60.894 0.05 19.15 H ANISOU 3940 H AHIS B 90 3482 1633 2161 529 -309 -717 H ATOM 3941 H BHIS B 90 18.522 51.910 61.708 0.05 19.14 H ANISOU 3941 H BHIS B 90 3471 1667 2132 536 -300 -701 H ATOM 3942 HA AHIS B 90 16.641 50.799 60.870 0.05 18.25 H ANISOU 3942 HA AHIS B 90 3245 1666 2025 602 -119 -560 H ATOM 3943 HA BHIS B 90 16.439 50.435 61.887 0.05 18.64 H ANISOU 3943 HA BHIS B 90 3312 1758 2012 636 -107 -563 H ATOM 3944 HB2AHIS B 90 16.556 50.994 58.463 0.05 16.84 H ANISOU 3944 HB2AHIS B 90 2977 1384 2039 497 -125 -505 H ATOM 3945 HB2BHIS B 90 15.949 50.174 59.569 0.05 17.01 H ANISOU 3945 HB2BHIS B 90 2983 1491 1989 534 -82 -471 H ATOM 3946 HB3AHIS B 90 15.708 52.079 59.249 0.05 17.93 H ANISOU 3946 HB3AHIS B 90 3197 1500 2114 595 -113 -582 H ATOM 3947 HB3BHIS B 90 15.617 51.637 60.080 0.05 17.85 H ANISOU 3947 HB3BHIS B 90 3177 1527 2080 585 -114 -567 H ATOM 3948 HD2AHIS B 90 18.048 52.108 56.545 0.05 16.12 H ANISOU 3948 HD2AHIS B 90 2866 1150 2107 345 -236 -513 H ATOM 3949 HD2BHIS B 90 17.865 50.012 57.675 0.05 15.71 H ANISOU 3949 HD2BHIS B 90 2749 1261 1960 355 -188 -431 H ATOM 3950 HE1AHIS B 90 18.267 55.791 57.972 0.05 18.83 H ANISOU 3950 HE1AHIS B 90 3458 1268 2430 404 -393 -754 H ATOM 3951 HE1BHIS B 90 18.644 53.889 57.421 0.05 16.79 H ANISOU 3951 HE1BHIS B 90 3014 1143 2222 297 -336 -585 H ATOM 3952 N AHIS B 91 18.149 49.155 59.980 0.03 17.05 N ANISOU 3952 N AHIS B 91 2996 1549 1935 473 -162 -462 N ATOM 3953 N BHIS B 91 17.500 48.336 61.035 0.02 17.45 N ANISOU 3953 N BHIS B 91 3048 1676 1904 528 -114 -431 N ATOM 3954 CA AHIS B 91 19.060 48.159 59.494 0.03 16.41 C ANISOU 3954 CA AHIS B 91 2855 1483 1896 405 -184 -404 C ATOM 3955 CA BHIS B 91 18.290 47.143 60.914 0.02 16.93 C ANISOU 3955 CA BHIS B 91 2930 1642 1861 473 -128 -364 C ATOM 3956 C AHIS B 91 18.229 46.916 59.109 0.03 15.81 C ANISOU 3956 C AHIS B 91 2708 1451 1848 406 -103 -311 C ATOM 3957 C BHIS B 91 17.657 46.271 59.853 0.02 16.05 C ANISOU 3957 C BHIS B 91 2736 1529 1835 439 -67 -282 C ATOM 3958 O AHIS B 91 17.020 46.868 59.347 0.03 16.03 O ANISOU 3958 O AHIS B 91 2728 1513 1849 460 -33 -288 O ATOM 3959 O BHIS B 91 16.446 46.182 59.788 0.02 16.11 O ANISOU 3959 O BHIS B 91 2720 1558 1842 477 4 -252 O ATOM 3960 CB AHIS B 91 20.170 47.875 60.529 0.03 17.02 C ANISOU 3960 CB AHIS B 91 2968 1599 1899 405 -249 -426 C ATOM 3961 CB BHIS B 91 18.319 46.336 62.214 0.02 17.59 C ANISOU 3961 CB BHIS B 91 3032 1813 1837 520 -112 -331 C ATOM 3962 CG AHIS B 91 19.729 47.065 61.707 0.03 17.50 C ANISOU 3962 CG AHIS B 91 3037 1750 1860 467 -202 -383 C ATOM 3963 CG BHIS B 91 18.438 47.143 63.475 0.02 18.74 C ANISOU 3963 CG BHIS B 91 3271 1986 1862 585 -150 -411 C ATOM 3964 ND1AHIS B 91 19.064 47.610 62.784 0.03 18.53 N ANISOU 3964 ND1AHIS B 91 3241 1926 1872 548 -190 -429 N ATOM 3965 ND1BHIS B 91 19.148 46.687 64.568 0.02 19.37 N ANISOU 3965 ND1BHIS B 91 3383 2122 1854 597 -200 -411 N ATOM 3966 CD2AHIS B 91 19.878 45.748 61.987 0.03 17.21 C ANISOU 3966 CD2AHIS B 91 2950 1767 1823 460 -165 -294 C ATOM 3967 CD2BHIS B 91 17.898 48.330 63.851 0.02 19.49 C ANISOU 3967 CD2BHIS B 91 3440 2065 1903 649 -147 -494 C ATOM 3968 CE1AHIS B 91 18.813 46.664 63.672 0.03 18.84 C ANISOU 3968 CE1AHIS B 91 3270 2052 1838 588 -144 -362 C ATOM 3969 CE1BHIS B 91 19.058 47.570 65.548 0.02 20.47 C ANISOU 3969 CE1BHIS B 91 3614 2278 1884 660 -231 -497 C ATOM 3970 NE2AHIS B 91 19.289 45.519 63.208 0.03 18.05 N ANISOU 3970 NE2AHIS B 91 3094 1952 1813 533 -129 -277 N ATOM 3971 NE2BHIS B 91 18.315 48.578 65.132 0.02 20.57 N ANISOU 3971 NE2BHIS B 91 3656 2244 1917 694 -198 -552 N ATOM 3972 H AHIS B 91 17.387 48.834 60.219 0.05 17.20 H ANISOU 3972 H AHIS B 91 3008 1608 1921 518 -107 -438 H ATOM 3973 H BHIS B 91 16.661 48.185 61.119 0.05 17.57 H ANISOU 3973 H BHIS B 91 3054 1720 1902 569 -57 -409 H ATOM 3974 HA AHIS B 91 19.484 48.504 58.688 0.05 16.03 H ANISOU 3974 HA AHIS B 91 2791 1385 1915 355 -216 -412 H ATOM 3975 HA BHIS B 91 19.191 47.368 60.649 0.05 16.77 H ANISOU 3975 HA BHIS B 91 2912 1587 1874 426 -188 -387 H ATOM 3976 HB2AHIS B 91 20.898 47.413 60.088 0.05 16.66 H ANISOU 3976 HB2AHIS B 91 2888 1542 1900 353 -283 -406 H ATOM 3977 HB2BHIS B 91 17.507 45.811 62.265 0.05 17.56 H ANISOU 3977 HB2BHIS B 91 3000 1847 1824 546 -45 -277 H ATOM 3978 HB3AHIS B 91 20.481 48.722 60.867 0.05 17.59 H ANISOU 3978 HB3AHIS B 91 3095 1647 1941 419 -292 -492 H ATOM 3979 HB3BHIS B 91 19.090 45.744 62.180 0.05 17.35 H ANISOU 3979 HB3BHIS B 91 2980 1786 1826 481 -147 -306 H ATOM 3980 HD2AHIS B 91 20.286 45.121 61.437 0.05 16.62 H ANISOU 3980 HD2AHIS B 91 2826 1677 1813 417 -163 -252 H ATOM 3981 HD2BHIS B 91 17.362 48.898 63.346 0.05 19.39 H ANISOU 3981 HD2BHIS B 91 3426 2016 1925 663 -120 -513 H ATOM 3982 HE1AHIS B 91 18.370 46.778 64.480 0.05 19.57 H ANISOU 3982 HE1AHIS B 91 3402 2193 1839 648 -123 -372 H ATOM 3983 HE1BHIS B 91 19.456 47.507 66.388 0.05 21.13 H ANISOU 3983 HE1BHIS B 91 3738 2401 1888 681 -271 -517 H ATOM 3984 N AVAL B 92 18.885 45.919 58.505 0.03 15.16 N ANISOU 3984 N AVAL B 92 2572 1366 1824 346 -116 -260 N ATOM 3985 N BVAL B 92 18.496 45.655 59.023 0.02 15.37 N ANISOU 3985 N BVAL B 92 2603 1418 1819 370 -97 -248 N ATOM 3986 CA AVAL B 92 18.247 44.720 57.937 0.03 14.60 C ANISOU 3986 CA AVAL B 92 2435 1310 1802 327 -60 -181 C ATOM 3987 CA BVAL B 92 18.094 44.624 58.082 0.02 14.66 C ANISOU 3987 CA BVAL B 92 2444 1326 1802 334 -53 -176 C ATOM 3988 C AVAL B 92 18.810 43.405 58.533 0.03 14.69 C ANISOU 3988 C AVAL B 92 2428 1362 1790 321 -62 -124 C ATOM 3989 C BVAL B 92 18.780 43.392 58.551 0.02 14.71 C ANISOU 3989 C BVAL B 92 2432 1367 1790 323 -61 -124 C ATOM 3990 O AVAL B 92 20.022 43.220 58.537 0.03 14.64 O ANISOU 3990 O AVAL B 92 2423 1347 1793 292 -119 -135 O ATOM 3991 O BVAL B 92 20.001 43.253 58.514 0.02 14.67 O ANISOU 3991 O BVAL B 92 2429 1351 1793 294 -120 -137 O ATOM 3992 CB AVAL B 92 18.468 44.733 56.408 0.03 13.82 C ANISOU 3992 CB AVAL B 92 2297 1153 1803 265 -76 -178 C ATOM 3993 CB BVAL B 92 18.516 44.907 56.642 0.02 13.94 C ANISOU 3993 CB BVAL B 92 2322 1171 1804 272 -81 -186 C ATOM 3994 CG1AVAL B 92 17.740 43.622 55.757 0.03 13.35 C ANISOU 3994 CG1AVAL B 92 2180 1098 1794 242 -32 -112 C ATOM 3995 CG1BVAL B 92 17.954 43.856 55.714 0.02 13.37 C ANISOU 3995 CG1BVAL B 92 2189 1097 1794 241 -42 -122 C ATOM 3996 CG2AVAL B 92 18.077 46.096 55.812 0.03 13.83 C ANISOU 3996 CG2AVAL B 92 2321 1108 1828 272 -82 -226 C ATOM 3997 CG2BVAL B 92 18.066 46.294 56.234 0.02 14.00 C ANISOU 3997 CG2BVAL B 92 2356 1134 1831 282 -88 -237 C ATOM 3998 H AVAL B 92 19.737 45.925 58.386 0.05 15.10 H ANISOU 3998 H AVAL B 92 2563 1342 1831 314 -161 -272 H ATOM 3999 H BVAL B 92 19.332 45.832 58.982 0.05 15.37 H ANISOU 3999 H BVAL B 92 2611 1402 1826 343 -146 -268 H ATOM 4000 HA AVAL B 92 17.296 44.728 58.125 0.05 14.76 H ANISOU 4000 HA AVAL B 92 2449 1351 1808 360 -12 -163 H ATOM 4001 HA BVAL B 92 17.139 44.461 58.128 0.05 14.74 H ANISOU 4001 HA BVAL B 92 2439 1355 1807 360 -3 -151 H ATOM 4002 HB AVAL B 92 19.412 44.607 56.235 0.05 13.74 H ANISOU 4002 HB AVAL B 92 2286 1128 1805 236 -117 -188 H ATOM 4003 HB BVAL B 92 19.482 44.873 56.581 0.05 13.91 H ANISOU 4003 HB BVAL B 92 2321 1156 1808 245 -124 -199 H ATOM 4004 HG11AVAL B 92 17.326 43.939 54.942 0.05 13.07 H ANISOU 4004 HG11AVAL B 92 2129 1039 1799 229 -22 -114 H ATOM 4005 HG11BVAL B 92 18.222 44.053 54.803 0.05 13.11 H ANISOU 4005 HG11BVAL B 92 2142 1050 1790 209 -66 -114 H ATOM 4006 HG12AVAL B 92 18.372 42.917 55.558 0.05 13.14 H ANISOU 4006 HG12AVAL B 92 2140 1065 1790 215 -52 -97 H ATOM 4007 HG12BVAL B 92 18.297 42.989 55.976 0.05 13.58 H ANISOU 4007 HG12BVAL B 92 2206 1156 1796 262 -9 -85 H ATOM 4008 HG13AVAL B 92 17.062 43.311 56.375 0.05 13.62 H ANISOU 4008 HG13AVAL B 92 2208 1167 1800 269 3 -81 H ATOM 4009 HG13BVAL B 92 16.989 43.871 55.788 0.05 13.15 H ANISOU 4009 HG13BVAL B 92 2149 1049 1800 235 -27 -125 H ATOM 4010 HG21AVAL B 92 18.164 46.055 54.850 0.05 13.45 H ANISOU 4010 HG21AVAL B 92 2241 1043 1825 254 -63 -205 H ATOM 4011 HG21BVAL B 92 17.888 46.312 55.284 0.05 13.61 H ANISOU 4011 HG21BVAL B 92 2276 1064 1830 262 -70 -218 H ATOM 4012 HG22AVAL B 92 17.165 46.313 56.058 0.05 14.26 H ANISOU 4012 HG22AVAL B 92 2401 1179 1839 318 -61 -243 H ATOM 4013 HG22BVAL B 92 17.265 46.515 56.733 0.05 14.43 H ANISOU 4013 HG22BVAL B 92 2435 1208 1841 329 -64 -251 H ATOM 4014 HG23AVAL B 92 18.683 46.761 56.168 0.05 13.89 H ANISOU 4014 HG23AVAL B 92 2348 1085 1844 250 -127 -260 H ATOM 4015 HG23BVAL B 92 18.774 46.914 56.462 0.05 14.11 H ANISOU 4015 HG23BVAL B 92 2392 1118 1850 262 -135 -274 H ATOM 4016 N ILE B 93 17.938 42.504 58.998 0.05 14.90 N ANISOU 4016 N ILE B 93 2433 1434 1795 348 0 -58 N ATOM 4017 CA ILE B 93 18.368 41.276 59.668 0.05 15.14 C ANISOU 4017 CA ILE B 93 2451 1499 1802 350 4 8 C ATOM 4018 C ILE B 93 18.008 40.114 58.782 0.05 14.61 C ANISOU 4018 C ILE B 93 2326 1399 1826 306 35 71 C ATOM 4019 O ILE B 93 16.851 39.908 58.466 0.05 14.54 O ANISOU 4019 O ILE B 93 2287 1387 1850 303 85 98 O ATOM 4020 CB ILE B 93 17.629 41.150 61.004 0.05 16.00 C ANISOU 4020 CB ILE B 93 2585 1683 1814 415 56 45 C ATOM 4021 CG1 ILE B 93 17.916 42.395 61.871 0.05 16.70 C ANISOU 4021 CG1 ILE B 93 2745 1802 1797 469 22 -34 C ATOM 4022 CG2 ILE B 93 17.991 39.829 61.689 0.05 16.33 C ANISOU 4022 CG2 ILE B 93 2613 1757 1836 417 64 130 C ATOM 4023 CD1 ILE B 93 17.092 42.466 63.156 0.05 17.62 C ANISOU 4023 CD1 ILE B 93 2890 1996 1810 549 91 -11 C ATOM 4024 H AILE B 93 17.092 42.566 58.922 0.05 14.96 H ANISOU 4024 H AILE B 93 2430 1451 1805 365 41 -44 H ATOM 4025 H BILE B 93 17.092 42.558 58.915 0.05 14.95 H ANISOU 4025 H BILE B 93 2427 1448 1805 364 41 -44 H ATOM 4026 HA ILE B 93 19.320 41.302 59.824 0.05 15.18 H ANISOU 4026 HA ILE B 93 2470 1500 1797 340 -44 -11 H ATOM 4027 HB ILE B 93 16.680 41.132 60.821 0.05 16.01 H ANISOU 4027 HB ILE B 93 2563 1690 1831 424 106 68 H ATOM 4028 HG12 ILE B 93 18.857 42.422 62.100 0.05 16.88 H ANISOU 4028 HG12 ILE B 93 2789 1834 1791 465 -27 -44 H ATOM 4029 HG13 ILE B 93 17.694 43.183 61.354 0.05 16.47 H ANISOU 4029 HG13 ILE B 93 2728 1736 1794 460 3 -90 H ATOM 4030 HG21 ILE B 93 18.912 39.609 61.486 0.05 16.25 H ANISOU 4030 HG21 ILE B 93 2612 1734 1827 403 12 113 H ATOM 4031 HG22 ILE B 93 17.870 39.938 62.644 0.05 16.97 H ANISOU 4031 HG22 ILE B 93 2716 1892 1842 462 92 150 H ATOM 4032 HG23 ILE B 93 17.404 39.137 61.352 0.05 16.06 H ANISOU 4032 HG23 ILE B 93 2538 1700 1863 390 94 180 H ATOM 4033 HD11 ILE B 93 17.271 43.315 63.586 0.05 18.13 H ANISOU 4033 HD11 ILE B 93 3009 2077 1802 585 62 -69 H ATOM 4034 HD12 ILE B 93 16.150 42.404 62.933 0.05 17.52 H ANISOU 4034 HD12 ILE B 93 2854 1977 1826 558 138 -5 H ATOM 4035 HD13 ILE B 93 17.346 41.742 63.749 0.05 17.89 H ANISOU 4035 HD13 ILE B 93 2908 2067 1821 556 117 56 H ATOM 4036 N ASN B 94 19.011 39.333 58.376 0.05 14.35 N ANISOU 4036 N ASN B 94 2276 1339 1836 274 2 93 N ATOM 4037 CA ASN B 94 18.766 38.105 57.616 0.05 14.05 C ANISOU 4037 CA ASN B 94 2196 1263 1878 240 27 149 C ATOM 4038 C ASN B 94 19.117 36.874 58.440 0.05 14.55 C ANISOU 4038 C ASN B 94 2259 1346 1924 256 34 224 C ATOM 4039 O ASN B 94 20.283 36.571 58.638 0.05 14.61 O ANISOU 4039 O ASN B 94 2274 1350 1927 259 -9 223 O ATOM 4040 CB ASN B 94 19.588 38.134 56.339 0.05 13.42 C ANISOU 4040 CB ASN B 94 2101 1129 1869 199 -11 111 C ATOM 4041 CG ASN B 94 19.347 36.941 55.471 0.05 13.21 C ANISOU 4041 CG ASN B 94 2044 1055 1919 168 7 150 C ATOM 4042 OD1 ASN B 94 18.422 36.171 55.721 0.05 13.48 O ANISOU 4042 OD1 ASN B 94 2065 1089 1970 165 44 204 O ATOM 4043 ND2 ASN B 94 20.175 36.767 54.464 0.05 12.83 N ANISOU 4043 ND2 ASN B 94 1987 967 1919 146 -20 122 N ATOM 4044 H ASN B 94 19.836 39.506 58.513 0.05 14.38 H ANISOU 4044 H ASN B 94 2293 1344 1828 273 -36 72 H ATOM 4045 HA ASN B 94 17.834 38.035 57.376 0.05 14.03 H ANISOU 4045 HA ASN B 94 2177 1259 1896 234 62 167 H ATOM 4046 HB2 ASN B 94 19.352 38.925 55.833 0.05 13.17 H ANISOU 4046 HB2 ASN B 94 2071 1086 1845 190 -16 70 H ATOM 4047 HB3 ASN B 94 20.527 38.178 56.564 0.05 13.49 H ANISOU 4047 HB3 ASN B 94 2118 1144 1865 203 -45 101 H ATOM 4048 HD21 ASN B 94 19.924 36.317 53.786 0.05 12.70 H ANISOU 4048 HD21 ASN B 94 1960 921 1944 129 -12 129 H ATOM 4049 HD22 ASN B 94 20.964 37.084 54.493 0.05 12.77 H ANISOU 4049 HD22 ASN B 94 1984 966 1901 150 -45 99 H ATOM 4050 N ASN B 95 18.075 36.201 58.921 0.05 15.02 N ANISOU 4050 N ASN B 95 2305 1427 1974 267 90 296 N ATOM 4051 CA ASN B 95 18.250 34.950 59.680 0.05 15.62 C ANISOU 4051 CA ASN B 95 2378 1512 2044 278 107 388 C ATOM 4052 C ASN B 95 18.255 33.690 58.828 0.05 15.47 C ANISOU 4052 C ASN B 95 2328 1418 2131 233 113 435 C ATOM 4053 O ASN B 95 18.463 32.596 59.403 0.05 16.07 O ANISOU 4053 O ASN B 95 2396 1489 2223 233 144 526 O ATOM 4054 CB ASN B 95 17.122 34.797 60.708 0.05 16.39 C ANISOU 4054 CB ASN B 95 2472 1672 2084 309 173 459 C ATOM 4055 CG ASN B 95 17.126 35.882 61.781 0.05 16.84 C ANISOU 4055 CG ASN B 95 2572 1811 2017 370 176 419 C ATOM 4056 OD1 ASN B 95 18.173 36.291 62.305 0.05 16.97 O ANISOU 4056 OD1 ASN B 95 2629 1849 1967 397 122 375 O ATOM 4057 ND2 ASN B 95 15.945 36.306 62.145 0.05 17.24 N ANISOU 4057 ND2 ASN B 95 2612 1908 2032 396 240 437 N ATOM 4058 H ASN B 95 17.256 36.421 58.818 0.05 15.07 H ANISOU 4058 H ASN B 95 2300 1444 1980 267 121 299 H ATOM 4059 HA ASN B 95 19.092 35.006 60.153 0.05 15.77 H ANISOU 4059 HA ASN B 95 2418 1547 2026 298 73 381 H ATOM 4060 HB2 ASN B 95 16.261 34.826 60.260 0.05 16.29 H ANISOU 4060 HB2 ASN B 95 2431 1647 2113 288 205 468 H ATOM 4061 HB3 ASN B 95 17.230 33.941 61.154 0.05 16.83 H ANISOU 4061 HB3 ASN B 95 2527 1731 2138 314 184 527 H ATOM 4062 HD21 ASN B 95 15.756 37.142 62.095 0.05 17.11 H ANISOU 4062 HD21 ASN B 95 2604 1899 1996 410 239 383 H ATOM 4063 HD22 ASN B 95 15.357 35.749 62.430 0.05 17.69 H ANISOU 4063 HD22 ASN B 95 2648 1985 2087 401 283 505 H ATOM 4064 N ASN B 96 18.034 33.822 57.520 0.05 14.81 N ANISOU 4064 N ASN B 96 2235 1274 2120 197 85 380 N ATOM 4065 CA ASN B 96 17.850 32.753 56.525 0.05 14.80 C ANISOU 4065 CA ASN B 96 2214 1195 2213 158 88 411 C ATOM 4066 C ASN B 96 19.187 32.307 55.932 0.05 14.51 C ANISOU 4066 C ASN B 96 2188 1110 2214 159 45 374 C ATOM 4067 O ASN B 96 20.123 33.095 55.806 0.05 14.27 O ANISOU 4067 O ASN B 96 2168 1111 2144 182 13 329 O ATOM 4068 CB ASN B 96 17.028 33.267 55.326 0.05 14.48 C ANISOU 4068 CB ASN B 96 2147 1131 2224 116 102 383 C ATOM 4069 CG ASN B 96 15.579 33.660 55.656 0.05 14.87 C ANISOU 4069 CG ASN B 96 2174 1239 2239 124 151 423 C ATOM 4070 OD1 ASN B 96 15.084 34.704 55.230 0.05 14.59 O ANISOU 4070 OD1 ASN B 96 2126 1230 2187 126 159 378 O ATOM 4071 ND2 ASN B 96 14.907 32.840 56.349 0.05 15.61 N ANISOU 4071 ND2 ASN B 96 2261 1358 2310 139 187 511 N ATOM 4072 H ASN B 96 17.988 34.597 57.152 0.05 14.44 H ANISOU 4072 H ASN B 96 2192 1227 2066 196 63 325 H ATOM 4073 HA ASN B 96 17.417 31.986 56.932 0.05 15.30 H ANISOU 4073 HA ASN B 96 2274 1254 2286 159 108 477 H ATOM 4074 HB2 ASN B 96 17.472 34.040 54.953 0.05 14.01 H ANISOU 4074 HB2 ASN B 96 2093 1072 2159 115 83 322 H ATOM 4075 HB3 ASN B 96 16.988 32.557 54.663 0.05 14.58 H ANISOU 4075 HB3 ASN B 96 2150 1091 2298 87 100 401 H ATOM 4076 HD21 ASN B 96 14.169 32.542 56.033 0.05 15.86 H ANISOU 4076 HD21 ASN B 96 2301 1445 2282 170 208 524 H ATOM 4077 HD22 ASN B 96 15.192 32.610 57.126 0.05 15.88 H ANISOU 4077 HD22 ASN B 96 2288 1356 2390 118 190 556 H ATOM 4078 N GLN B 97 19.242 31.070 55.452 0.05 14.63 N ANISOU 4078 N GLN B 97 2199 1049 2312 133 45 394 N ATOM 4079 CA GLN B 97 20.382 30.506 54.714 0.05 14.53 C ANISOU 4079 CA GLN B 97 2197 977 2347 141 16 364 C ATOM 4080 C GLN B 97 20.389 30.830 53.242 0.05 13.94 C ANISOU 4080 C GLN B 97 2120 878 2298 122 0 281 C ATOM 4081 O GLN B 97 20.948 30.097 52.430 0.05 13.89 O ANISOU 4081 O GLN B 97 2121 840 2318 140 -17 249 O ATOM 4082 CB GLN B 97 20.350 28.963 54.785 0.05 15.13 C ANISOU 4082 CB GLN B 97 2281 967 2501 126 22 419 C ATOM 4083 CG GLN B 97 20.636 28.376 56.129 0.05 15.82 C ANISOU 4083 CG GLN B 97 2378 1057 2575 162 27 504 C ATOM 4084 CD GLN B 97 19.485 28.422 57.102 0.05 16.41 C ANISOU 4084 CD GLN B 97 2444 1141 2651 139 63 593 C ATOM 4085 OE1 GLN B 97 18.900 27.408 57.468 0.05 16.92 O ANISOU 4085 OE1 GLN B 97 2505 1124 2798 98 73 639 O ATOM 4086 NE2 GLN B 97 19.215 29.577 57.614 0.05 16.53 N ANISOU 4086 NE2 GLN B 97 2454 1250 2575 166 83 625 N ATOM 4087 H GLN B 97 18.599 30.507 55.544 0.05 14.86 H ANISOU 4087 H GLN B 97 2219 1056 2371 111 63 426 H ATOM 4088 HA GLN B 97 21.208 30.801 55.118 0.05 14.62 H ANISOU 4088 HA GLN B 97 2212 1014 2327 173 2 369 H ATOM 4089 HB2 GLN B 97 19.470 28.679 54.504 0.05 15.25 H ANISOU 4089 HB2 GLN B 97 2286 968 2540 92 38 437 H ATOM 4090 HB3 GLN B 97 21.011 28.607 54.178 0.05 15.03 H ANISOU 4090 HB3 GLN B 97 2278 908 2526 127 6 381 H ATOM 4091 HG2 GLN B 97 20.864 27.443 55.999 0.05 16.07 H ANISOU 4091 HG2 GLN B 97 2423 1030 2655 171 16 511 H ATOM 4092 HG3 GLN B 97 21.369 28.857 56.543 0.05 15.74 H ANISOU 4092 HG3 GLN B 97 2368 1104 2508 193 18 500 H ATOM 4093 HE21 GLN B 97 18.633 29.645 58.237 0.05 16.45 H ANISOU 4093 HE21 GLN B 97 2432 1275 2544 153 104 624 H ATOM 4094 HE22 GLN B 97 19.656 30.270 57.360 0.05 16.71 H ANISOU 4094 HE22 GLN B 97 2488 1302 2558 200 72 642 H ATOM 4095 N GLU B 98 19.727 31.932 52.885 0.05 13.57 N ANISOU 4095 N GLU B 98 2062 857 2238 93 9 250 N ATOM 4096 CA GLU B 98 19.683 32.455 51.520 0.05 13.08 C ANISOU 4096 CA GLU B 98 1997 782 2189 72 -3 181 C ATOM 4097 C GLU B 98 19.945 33.976 51.567 0.05 12.65 C ANISOU 4097 C GLU B 98 1941 788 2076 89 -12 139 C ATOM 4098 O GLU B 98 19.284 34.730 52.316 0.05 12.73 O ANISOU 4098 O GLU B 98 1952 849 2036 103 -4 156 O ATOM 4099 CB GLU B 98 18.313 32.237 50.895 0.05 13.13 C ANISOU 4099 CB GLU B 98 1987 779 2222 31 10 189 C ATOM 4100 CG GLU B 98 18.017 30.780 50.441 0.05 13.66 C ANISOU 4100 CG GLU B 98 2053 775 2360 -2 7 224 C ATOM 4101 CD GLU B 98 18.601 30.491 49.081 0.05 13.57 C ANISOU 4101 CD GLU B 98 2066 706 2386 -11 -21 164 C ATOM 4102 OE1 GLU B 98 19.466 31.376 48.737 0.05 13.16 O ANISOU 4102 OE1 GLU B 98 2025 674 2301 16 -29 112 O ATOM 4103 OE2 GLU B 98 18.119 29.538 48.364 0.05 14.00 O ANISOU 4103 OE2 GLU B 98 2125 696 2498 -46 -36 166 O ATOM 4104 H GLU B 98 19.279 32.401 53.447 0.05 13.67 H ANISOU 4104 H GLU B 98 2067 898 2229 90 25 273 H ATOM 4105 HA GLU B 98 20.360 32.045 50.967 0.05 13.08 H ANISOU 4105 HA GLU B 98 2007 746 2218 74 -14 159 H ATOM 4106 HB2 GLU B 98 17.639 32.516 51.530 0.05 13.22 H ANISOU 4106 HB2 GLU B 98 1988 830 2207 36 28 217 H ATOM 4107 HB3 GLU B 98 18.236 32.800 50.108 0.05 12.82 H ANISOU 4107 HB3 GLU B 98 1946 742 2182 20 0 146 H ATOM 4108 HG2 GLU B 98 18.411 30.169 51.085 0.05 14.00 H ANISOU 4108 HG2 GLU B 98 2103 806 2410 11 15 267 H ATOM 4109 HG3 GLU B 98 17.051 30.649 50.398 0.05 13.79 H ANISOU 4109 HG3 GLU B 98 2049 798 2393 -29 15 242 H ATOM 4110 N ASP B 99 20.871 34.426 50.736 0.05 12.31 N ANISOU 4110 N ASP B 99 1899 740 2039 88 -28 88 N ATOM 4111 CA ASP B 99 21.104 35.889 50.585 0.05 11.96 C ANISOU 4111 CA ASP B 99 1851 735 1958 86 -38 49 C ATOM 4112 C ASP B 99 19.798 36.634 50.533 0.05 11.82 C ANISOU 4112 C ASP B 99 1833 730 1929 69 -25 43 C ATOM 4113 O ASP B 99 18.842 36.240 49.932 0.05 11.84 O ANISOU 4113 O ASP B 99 1828 708 1961 48 -16 47 O ATOM 4114 CB ASP B 99 21.763 36.142 49.241 0.05 11.72 C ANISOU 4114 CB ASP B 99 1817 690 1946 79 -45 9 C ATOM 4115 CG ASP B 99 23.199 35.782 49.182 0.05 11.89 C ANISOU 4115 CG ASP B 99 1826 718 1974 102 -55 10 C ATOM 4116 OD1 ASP B 99 23.943 35.893 50.179 0.05 12.10 O ANISOU 4116 OD1 ASP B 99 1842 773 1982 119 -71 30 O ATOM 4117 OD2 ASP B 99 23.580 35.385 48.076 0.05 11.90 O ANISOU 4117 OD2 ASP B 99 1826 699 1998 107 -46 -10 O ATOM 4118 H ASP B 99 21.373 33.944 50.249 0.05 12.34 H ANISOU 4118 H ASP B 99 1906 717 2067 91 -31 77 H ATOM 4119 HA ASP B 99 21.668 36.210 51.302 0.05 12.06 H ANISOU 4119 HA ASP B 99 1864 775 1944 101 -48 55 H ATOM 4120 HB2 ASP B 99 21.304 35.624 48.565 0.05 11.73 H ANISOU 4120 HB2 ASP B 99 1823 663 1969 69 -39 2 H ATOM 4121 HB3 ASP B 99 21.684 37.087 49.019 0.05 11.52 H ANISOU 4121 HB3 ASP B 99 1791 682 1905 69 -50 -11 H ATOM 4122 N PHE B 100 19.799 37.790 51.168 0.05 11.77 N ANISOU 4122 N PHE B 100 1833 759 1880 80 -30 27 N ATOM 4123 CA PHE B 100 18.672 38.729 51.100 0.05 11.70 C ANISOU 4123 CA PHE B 100 1824 763 1857 78 -18 13 C ATOM 4124 C PHE B 100 19.058 39.902 50.207 0.05 11.40 C ANISOU 4124 C PHE B 100 1794 717 1821 68 -37 -31 C ATOM 4125 O PHE B 100 20.038 40.595 50.476 0.05 11.42 O ANISOU 4125 O PHE B 100 1806 726 1806 71 -60 -52 O ATOM 4126 CB PHE B 100 18.287 39.245 52.492 0.05 12.04 C ANISOU 4126 CB PHE B 100 1881 849 1846 111 -5 25 C ATOM 4127 CG PHE B 100 17.155 40.228 52.447 0.05 12.09 C ANISOU 4127 CG PHE B 100 1885 868 1839 123 13 10 C ATOM 4128 CD1 PHE B 100 15.888 39.805 52.182 0.05 12.20 C ANISOU 4128 CD1 PHE B 100 1869 886 1881 116 42 42 C ATOM 4129 CD2 PHE B 100 17.371 41.601 52.675 0.05 12.12 C ANISOU 4129 CD2 PHE B 100 1918 877 1810 142 -4 -36 C ATOM 4130 CE1 PHE B 100 14.842 40.699 52.116 0.05 12.33 C ANISOU 4130 CE1 PHE B 100 1874 919 1890 135 60 33 C ATOM 4131 CE2 PHE B 100 16.302 42.495 52.621 0.05 12.26 C ANISOU 4131 CE2 PHE B 100 1936 901 1819 165 15 -49 C ATOM 4132 CZ PHE B 100 15.073 42.080 52.345 0.05 12.34 C ANISOU 4132 CZ PHE B 100 1911 924 1855 166 48 -14 C ATOM 4133 H PHE B 100 20.448 38.048 51.654 0.05 11.85 H ANISOU 4133 H PHE B 100 1848 784 1869 92 -43 23 H ATOM 4134 HA PHE B 100 17.893 38.306 50.714 0.05 11.72 H ANISOU 4134 HA PHE B 100 1814 754 1884 66 -6 27 H ATOM 4135 HB2 PHE B 100 17.962 38.498 53.014 0.05 12.29 H ANISOU 4135 HB2 PHE B 100 1904 888 1876 116 12 63 H ATOM 4136 HB3 PHE B 100 19.058 39.651 52.907 0.05 12.10 H ANISOU 4136 HB3 PHE B 100 1903 865 1827 120 -26 7 H ATOM 4137 HD1 PHE B 100 15.734 38.905 52.020 0.05 12.25 H ANISOU 4137 HD1 PHE B 100 1859 881 1916 97 48 71 H ATOM 4138 HD2 PHE B 100 18.232 41.885 52.858 0.05 12.12 H ANISOU 4138 HD2 PHE B 100 1934 873 1797 140 -29 -56 H ATOM 4139 HE1 PHE B 100 13.986 40.393 51.931 0.05 12.47 H ANISOU 4139 HE1 PHE B 100 1862 943 1931 128 77 59 H ATOM 4140 HE2 PHE B 100 16.458 43.401 52.772 0.05 12.35 H ANISOU 4140 HE2 PHE B 100 1973 906 1812 180 2 -81 H ATOM 4141 HZ PHE B 100 14.365 42.679 52.311 0.05 12.49 H ANISOU 4141 HZ PHE B 100 1924 951 1871 186 62 -19 H ATOM 4142 N HIS B 101 18.293 40.084 49.136 0.05 11.23 N ANISOU 4142 N HIS B 101 1764 680 1824 52 -33 -40 N ATOM 4143 CA HIS B 101 18.571 41.162 48.165 0.05 11.04 C ANISOU 4143 CA HIS B 101 1747 646 1802 42 -48 -69 C ATOM 4144 C HIS B 101 17.489 42.238 48.241 0.05 11.11 C ANISOU 4144 C HIS B 101 1759 661 1801 55 -42 -76 C ATOM 4145 O HIS B 101 16.305 41.952 48.276 0.05 11.23 O ANISOU 4145 O HIS B 101 1756 685 1825 61 -27 -58 O ATOM 4146 CB HIS B 101 18.569 40.675 46.718 0.05 10.91 C ANISOU 4146 CB HIS B 101 1724 612 1809 22 -51 -74 C ATOM 4147 CG HIS B 101 19.631 39.683 46.375 0.05 10.93 C ANISOU 4147 CG HIS B 101 1726 604 1823 21 -51 -75 C ATOM 4148 ND1 HIS B 101 20.569 39.924 45.406 0.05 10.90 N ANISOU 4148 ND1 HIS B 101 1723 600 1819 17 -52 -89 N ATOM 4149 CD2 HIS B 101 19.822 38.389 46.779 0.05 11.09 C ANISOU 4149 CD2 HIS B 101 1743 612 1857 28 -46 -60 C ATOM 4150 CE1 HIS B 101 21.339 38.852 45.265 0.05 11.04 C ANISOU 4150 CE1 HIS B 101 1737 609 1847 29 -46 -88 C ATOM 4151 NE2 HIS B 101 20.886 37.911 46.076 0.05 11.14 N ANISOU 4151 NE2 HIS B 101 1751 610 1872 35 -45 -71 N ATOM 4152 H HIS B 101 17.595 39.642 48.958 0.05 11.29 H ANISOU 4152 H HIS B 101 1760 684 1846 46 -24 -26 H ATOM 4153 HA HIS B 101 19.435 41.548 48.347 0.05 11.04 H ANISOU 4153 HA HIS B 101 1754 647 1794 42 -59 -79 H ATOM 4154 HB2 HIS B 101 17.702 40.293 46.542 0.05 10.97 H ANISOU 4154 HB2 HIS B 101 1723 616 1828 18 -47 -66 H ATOM 4155 HB3 HIS B 101 18.713 41.406 46.108 0.05 10.84 H ANISOU 4155 HB3 HIS B 101 1720 601 1798 18 -57 -85 H ATOM 4156 HD2 HIS B 101 19.326 37.919 47.415 0.05 11.20 H ANISOU 4156 HD2 HIS B 101 1755 626 1874 30 -41 -41 H ATOM 4157 HE1 HIS B 101 22.063 38.773 44.688 0.05 11.11 H ANISOU 4157 HE1 HIS B 101 1744 622 1856 35 -40 -94 H ATOM 4158 N PHE B 102 17.932 43.511 48.192 0.05 11.13 N ANISOU 4158 N PHE B 102 1782 653 1794 59 -58 -99 N ATOM 4159 CA PHE B 102 16.997 44.644 48.105 0.05 11.28 C ANISOU 4159 CA PHE B 102 1812 665 1810 80 -56 -108 C ATOM 4160 C PHE B 102 17.718 45.744 47.376 0.05 11.28 C ANISOU 4160 C PHE B 102 1830 634 1821 64 -78 -123 C ATOM 4161 O PHE B 102 18.928 45.830 47.369 0.05 11.27 O ANISOU 4161 O PHE B 102 1834 623 1824 41 -95 -129 O ATOM 4162 CB PHE B 102 16.466 45.071 49.472 0.05 11.63 C ANISOU 4162 CB PHE B 102 1873 726 1821 120 -42 -118 C ATOM 4163 CG PHE B 102 17.480 45.686 50.391 0.05 11.85 C ANISOU 4163 CG PHE B 102 1938 745 1821 126 -67 -150 C ATOM 4164 CD1 PHE B 102 18.383 44.913 51.093 0.05 11.89 C ANISOU 4164 CD1 PHE B 102 1942 770 1805 119 -77 -146 C ATOM 4165 CD2 PHE B 102 17.485 47.074 50.613 0.05 12.16 C ANISOU 4165 CD2 PHE B 102 2015 751 1855 141 -88 -186 C ATOM 4166 CE1 PHE B 102 19.280 45.483 51.942 0.05 12.22 C ANISOU 4166 CE1 PHE B 102 2015 807 1819 122 -112 -177 C ATOM 4167 CE2 PHE B 102 18.380 47.634 51.465 0.05 12.51 C ANISOU 4167 CE2 PHE B 102 2095 781 1876 140 -123 -222 C ATOM 4168 CZ PHE B 102 19.277 46.860 52.145 0.05 12.54 C ANISOU 4168 CZ PHE B 102 2095 814 1857 129 -138 -219 C ATOM 4169 H PHE B 102 18.751 43.741 48.146 0.05 11.11 H ANISOU 4169 H PHE B 102 1786 643 1792 49 -71 -107 H ATOM 4170 HA PHE B 102 16.239 44.350 47.579 0.05 11.25 H ANISOU 4170 HA PHE B 102 1789 666 1818 79 -47 -94 H ATOM 4171 HB2 PHE B 102 15.748 45.708 49.339 0.05 11.78 H ANISOU 4171 HB2 PHE B 102 1893 741 1841 141 -35 -121 H ATOM 4172 HB3 PHE B 102 16.104 44.286 49.916 0.05 11.68 H ANISOU 4172 HB3 PHE B 102 1862 755 1820 126 -24 -98 H ATOM 4173 HD1 PHE B 102 18.392 43.996 50.951 0.05 11.75 H ANISOU 4173 HD1 PHE B 102 1903 765 1795 111 -64 -121 H ATOM 4174 HD2 PHE B 102 16.873 47.602 50.159 0.05 12.19 H ANISOU 4174 HD2 PHE B 102 2019 740 1874 151 -81 -185 H ATOM 4175 HE1 PHE B 102 19.889 44.953 52.396 0.05 12.29 H ANISOU 4175 HE1 PHE B 102 2021 834 1814 119 -123 -171 H ATOM 4176 HE2 PHE B 102 18.365 48.554 51.590 0.05 12.78 H ANISOU 4176 HE2 PHE B 102 2159 784 1914 148 -140 -249 H ATOM 4177 HZ PHE B 102 19.889 47.254 52.719 0.05 12.84 H ANISOU 4177 HZ PHE B 102 2156 845 1879 127 -169 -245 H ATOM 4178 N TYR B 103 16.901 46.633 46.783 0.05 11.39 N ANISOU 4178 N TYR B 103 1851 633 1845 77 -79 -121 N ATOM 4179 CA TYR B 103 17.428 47.851 46.135 0.05 11.55 C ANISOU 4179 CA TYR B 103 1893 614 1880 65 -99 -125 C ATOM 4180 C TYR B 103 16.997 49.042 46.949 0.05 11.96 C ANISOU 4180 C TYR B 103 1980 636 1928 100 -107 -151 C ATOM 4181 O TYR B 103 15.822 49.170 47.219 0.05 12.12 O ANISOU 4181 O TYR B 103 1998 670 1938 144 -88 -152 O ATOM 4182 CB TYR B 103 16.884 47.988 44.707 0.05 11.51 C ANISOU 4182 CB TYR B 103 1876 608 1888 60 -98 -98 C ATOM 4183 CG TYR B 103 17.842 48.792 43.851 0.05 11.63 C ANISOU 4183 CG TYR B 103 1906 596 1918 31 -111 -83 C ATOM 4184 CD1 TYR B 103 17.799 50.178 43.816 0.05 12.02 C ANISOU 4184 CD1 TYR B 103 1983 596 1986 37 -126 -80 C ATOM 4185 CD2 TYR B 103 18.827 48.186 43.105 0.05 11.49 C ANISOU 4185 CD2 TYR B 103 1872 597 1898 -1 -105 -68 C ATOM 4186 CE1 TYR B 103 18.721 50.880 43.110 0.05 12.25 C ANISOU 4186 CE1 TYR B 103 2020 597 2036 3 -135 -54 C ATOM 4187 CE2 TYR B 103 19.743 48.872 42.379 0.05 11.72 C ANISOU 4187 CE2 TYR B 103 1904 610 1941 -27 -107 -43 C ATOM 4188 CZ TYR B 103 19.685 50.255 42.395 0.05 12.11 C ANISOU 4188 CZ TYR B 103 1978 610 2014 -31 -123 -32 C ATOM 4189 OH TYR B 103 20.636 50.988 41.707 0.05 12.46 O ANISOU 4189 OH TYR B 103 2019 635 2080 -67 -124 6 O ATOM 4190 H TYR B 103 16.055 46.579 46.767 0.05 11.45 H ANISOU 4190 H TYR B 103 1847 651 1853 94 -68 -113 H ATOM 4191 HA TYR B 103 18.393 47.818 46.118 0.05 11.51 H ANISOU 4191 HA TYR B 103 1891 603 1881 41 -109 -127 H ATOM 4192 HB2 TYR B 103 16.811 47.097 44.321 0.05 11.32 H ANISOU 4192 HB2 TYR B 103 1834 608 1860 50 -91 -90 H ATOM 4193 HB3 TYR B 103 16.016 48.413 44.737 0.05 11.67 H ANISOU 4193 HB3 TYR B 103 1899 625 1911 86 -96 -96 H ATOM 4194 HD1 TYR B 103 17.164 50.618 44.327 0.05 12.18 H ANISOU 4194 HD1 TYR B 103 2019 603 2008 66 -128 -93 H ATOM 4195 HD2 TYR B 103 18.879 47.258 43.124 0.05 11.30 H ANISOU 4195 HD2 TYR B 103 1834 596 1864 -1 -96 -73 H ATOM 4196 HE1 TYR B 103 18.689 51.803 43.111 0.05 12.57 H ANISOU 4196 HE1 TYR B 103 2083 597 2096 4 -147 -49 H ATOM 4197 HE2 TYR B 103 20.405 48.433 41.904 0.05 11.69 H ANISOU 4197 HE2 TYR B 103 1886 626 1932 -42 -96 -32 H ATOM 4198 HH TYR B 103 20.703 50.714 40.914 0.05 12.44 H ANISOU 4198 HH TYR B 103 2007 656 2063 -67 -109 29 H ATOM 4199 N THR B 104 17.952 49.903 47.315 0.05 12.23 N ANISOU 4199 N THR B 104 2047 629 1973 82 -135 -172 N ATOM 4200 CA THR B 104 17.640 51.139 48.016 0.05 12.78 C ANISOU 4200 CA THR B 104 2164 652 2040 116 -151 -207 C ATOM 4201 C THR B 104 17.784 52.324 47.061 0.05 13.07 C ANISOU 4201 C THR B 104 2221 626 2120 98 -171 -191 C ATOM 4202 O THR B 104 18.677 52.397 46.262 0.05 13.00 O ANISOU 4202 O THR B 104 2198 604 2138 47 -183 -163 O ATOM 4203 CB THR B 104 18.538 51.362 49.231 0.05 13.12 C ANISOU 4203 CB THR B 104 2240 681 2063 108 -183 -252 C ATOM 4204 OG1 THR B 104 18.153 52.628 49.787 0.05 13.78 O ANISOU 4204 OG1 THR B 104 2383 706 2148 144 -203 -294 O ATOM 4205 CG2 THR B 104 20.015 51.368 48.884 0.05 13.10 C ANISOU 4205 CG2 THR B 104 2223 663 2090 41 -217 -241 C ATOM 4206 H THR B 104 18.779 49.803 47.161 0.05 12.19 H ANISOU 4206 H THR B 104 2035 617 1977 50 -147 -167 H ATOM 4207 HA THR B 104 16.722 51.095 48.311 0.05 12.85 H ANISOU 4207 HA THR B 104 2173 677 2034 157 -131 -210 H ATOM 4208 HB THR B 104 18.388 50.655 49.880 0.05 13.02 H ANISOU 4208 HB THR B 104 2220 710 2018 127 -168 -258 H ATOM 4209 HG1 THR B 104 17.342 52.584 49.975 0.05 13.85 H ANISOU 4209 HG1 THR B 104 2396 731 2136 187 -180 -300 H ATOM 4210 HG21 THR B 104 20.560 51.279 49.682 0.05 13.30 H ANISOU 4210 HG21 THR B 104 2261 694 2100 36 -240 -267 H ATOM 4211 HG22 THR B 104 20.233 50.630 48.292 0.05 12.71 H ANISOU 4211 HG22 THR B 104 2136 647 2045 23 -199 -211 H ATOM 4212 HG23 THR B 104 20.255 52.191 48.429 0.05 13.34 H ANISOU 4212 HG23 THR B 104 2266 649 2153 21 -234 -236 H ATOM 4213 N AILE B 105 16.830 53.244 47.190 0.03 13.50 N ANISOU 4213 N AILE B 105 2307 644 2179 150 -168 -203 N ATOM 4214 N BILE B 105 16.822 53.238 47.193 0.02 13.50 N ANISOU 4214 N BILE B 105 2307 644 2179 150 -169 -204 N ATOM 4215 CA AILE B 105 16.804 54.536 46.482 0.03 13.98 C ANISOU 4215 CA AILE B 105 2400 629 2283 148 -189 -188 C ATOM 4216 CA BILE B 105 16.763 54.536 46.509 0.02 13.98 C ANISOU 4216 CA BILE B 105 2401 630 2283 150 -189 -189 C ATOM 4217 C AILE B 105 16.726 55.609 47.565 0.03 14.73 C ANISOU 4217 C AILE B 105 2562 655 2379 187 -214 -249 C ATOM 4218 C BILE B 105 16.745 55.602 47.593 0.02 14.73 C ANISOU 4218 C BILE B 105 2562 655 2379 187 -214 -250 C ATOM 4219 O AILE B 105 15.914 55.535 48.452 0.03 14.92 O ANISOU 4219 O AILE B 105 2602 702 2366 254 -194 -286 O ATOM 4220 O BILE B 105 15.939 55.532 48.496 0.02 14.92 O ANISOU 4220 O BILE B 105 2602 702 2366 253 -194 -287 O ATOM 4221 CB AILE B 105 15.631 54.609 45.519 0.03 13.94 C ANISOU 4221 CB AILE B 105 2372 640 2285 187 -167 -145 C ATOM 4222 CB BILE B 105 15.463 54.710 45.766 0.02 13.99 C ANISOU 4222 CB BILE B 105 2382 645 2290 195 -166 -150 C ATOM 4223 CG1AILE B 105 15.751 53.528 44.428 0.03 13.34 C ANISOU 4223 CG1AILE B 105 2241 629 2198 148 -152 -97 C ATOM 4224 CG1BILE B 105 15.117 53.510 44.887 0.02 13.37 C ANISOU 4224 CG1BILE B 105 2245 640 2197 169 -147 -105 C ATOM 4225 CG2AILE B 105 15.527 55.991 44.947 0.03 14.58 C ANISOU 4225 CG2AILE B 105 2494 636 2409 197 -189 -127 C ATOM 4226 CG2BILE B 105 15.496 56.006 44.982 0.02 14.58 C ANISOU 4226 CG2BILE B 105 2494 637 2409 197 -189 -126 C ATOM 4227 CD1AILE B 105 16.786 53.822 43.387 0.03 13.36 C ANISOU 4227 CD1AILE B 105 2242 611 2222 91 -164 -55 C ATOM 4228 CD1BILE B 105 15.933 53.338 43.677 0.02 13.26 C ANISOU 4228 CD1BILE B 105 2221 618 2198 112 -157 -63 C ATOM 4229 H AILE B 105 16.163 53.145 47.700 0.05 13.58 H ANISOU 4229 H AILE B 105 2320 672 2169 191 -153 -218 H ATOM 4230 H BILE B 105 16.155 53.121 47.701 0.05 13.58 H ANISOU 4230 H BILE B 105 2320 672 2169 191 -153 -219 H ATOM 4231 HA AILE B 105 17.628 54.625 45.984 0.05 13.94 H ANISOU 4231 HA AILE B 105 2389 609 2300 99 -204 -168 H ATOM 4232 HA BILE B 105 17.511 54.641 45.907 0.05 13.94 H ANISOU 4232 HA BILE B 105 2388 609 2300 101 -203 -166 H ATOM 4233 HB AILE B 105 14.822 54.433 46.018 0.05 14.00 H ANISOU 4233 HB AILE B 105 2374 671 2274 234 -149 -160 H ATOM 4234 HB BILE B 105 14.763 54.788 46.432 0.05 14.14 H ANISOU 4234 HB BILE B 105 2405 677 2291 245 -151 -172 H ATOM 4235 HG12AILE B 105 16.007 52.707 44.867 0.05 13.02 H ANISOU 4235 HG12AILE B 105 2182 626 2138 135 -143 -112 H ATOM 4236 HG12BILE B 105 15.179 52.702 45.414 0.05 13.07 H ANISOU 4236 HG12BILE B 105 2187 640 2137 161 -136 -120 H ATOM 4237 HG13AILE B 105 14.904 53.421 43.967 0.05 13.34 H ANISOU 4237 HG13AILE B 105 2222 651 2194 177 -142 -77 H ATOM 4238 HG13BILE B 105 14.204 53.639 44.585 0.05 13.45 H ANISOU 4238 HG13BILE B 105 2239 665 2206 202 -137 -87 H ATOM 4239 HG21AILE B 105 14.750 56.394 45.348 0.05 14.96 H ANISOU 4239 HG21AILE B 105 2569 659 2456 247 -188 -156 H ATOM 4240 HG21BILE B 105 16.270 56.010 44.404 0.05 14.51 H ANISOU 4240 HG21BILE B 105 2480 616 2417 146 -200 -100 H ATOM 4241 HG22AILE B 105 16.340 56.454 45.186 0.05 14.73 H ANISOU 4241 HG22AILE B 105 2531 616 2448 153 -210 -130 H ATOM 4242 HG22BILE B 105 14.685 56.086 44.461 0.05 14.64 H ANISOU 4242 HG22BILE B 105 2488 656 2418 231 -177 -99 H ATOM 4243 HG23AILE B 105 15.420 55.969 43.985 0.05 14.52 H ANISOU 4243 HG23AILE B 105 2467 642 2408 198 -183 -83 H ATOM 4244 HG23BILE B 105 15.563 56.736 45.612 0.05 15.03 H ANISOU 4244 HG23BILE B 105 2594 642 2476 217 -203 -162 H ATOM 4245 HD11AILE B 105 17.524 53.212 43.505 0.05 13.26 H ANISOU 4245 HD11AILE B 105 2227 599 2211 56 -170 -67 H ATOM 4246 HD11BILE B 105 16.502 52.558 43.784 0.05 13.22 H ANISOU 4246 HD11BILE B 105 2221 603 2198 77 -165 -74 H ATOM 4247 HD12AILE B 105 16.394 53.712 42.504 0.05 13.13 H ANISOU 4247 HD12AILE B 105 2187 622 2179 87 -153 -28 H ATOM 4248 HD12BILE B 105 15.320 53.201 42.939 0.05 12.95 H ANISOU 4248 HD12BILE B 105 2152 627 2142 106 -145 -44 H ATOM 4249 HD13AILE B 105 17.117 54.728 43.490 0.05 13.78 H ANISOU 4249 HD13AILE B 105 2321 613 2300 96 -177 -41 H ATOM 4250 HD13BILE B 105 16.475 54.119 43.517 0.05 13.61 H ANISOU 4250 HD13BILE B 105 2284 624 2263 118 -166 -40 H ATOM 4251 N TRP B 106 17.594 56.623 47.480 0.05 15.27 N ANISOU 4251 N TRP B 106 2672 638 2492 145 -258 -259 N ATOM 4252 CA TRP B 106 17.642 57.683 48.474 0.05 16.14 C ANISOU 4252 CA TRP B 106 2858 666 2607 177 -295 -328 C ATOM 4253 C TRP B 106 17.699 59.021 47.726 0.05 16.84 C ANISOU 4253 C TRP B 106 2988 643 2767 162 -324 -305 C ATOM 4254 O TRP B 106 18.196 59.123 46.622 0.05 16.70 O ANISOU 4254 O TRP B 106 2940 613 2793 102 -327 -237 O ATOM 4255 CB TRP B 106 18.804 57.516 49.460 0.05 16.34 C ANISOU 4255 CB TRP B 106 2905 691 2614 133 -339 -383 C ATOM 4256 CG TRP B 106 20.181 57.648 48.888 0.05 16.40 C ANISOU 4256 CG TRP B 106 2887 668 2674 33 -381 -352 C ATOM 4257 CD1 TRP B 106 20.863 58.815 48.663 0.05 17.25 C ANISOU 4257 CD1 TRP B 106 3039 673 2844 -19 -442 -369 C ATOM 4258 CD2 TRP B 106 21.083 56.585 48.493 0.05 15.71 C ANISOU 4258 CD2 TRP B 106 2723 653 2591 -29 -365 -297 C ATOM 4259 NE1 TRP B 106 22.094 58.554 48.128 0.05 17.16 N ANISOU 4259 NE1 TRP B 106 2971 671 2876 -111 -462 -319 N ATOM 4260 CE2 TRP B 106 22.268 57.194 48.029 0.05 16.21 C ANISOU 4260 CE2 TRP B 106 2779 662 2719 -113 -413 -276 C ATOM 4261 CE3 TRP B 106 21.004 55.195 48.488 0.05 14.83 C ANISOU 4261 CE3 TRP B 106 2552 643 2441 -19 -317 -263 C ATOM 4262 CZ2 TRP B 106 23.364 56.448 47.577 0.05 15.87 C ANISOU 4262 CZ2 TRP B 106 2662 672 2695 -178 -405 -222 C ATOM 4263 CZ3 TRP B 106 22.122 54.467 48.076 0.05 14.50 C ANISOU 4263 CZ3 TRP B 106 2451 642 2417 -80 -314 -218 C ATOM 4264 CH2 TRP B 106 23.258 55.100 47.595 0.05 15.02 C ANISOU 4264 CH2 TRP B 106 2504 662 2540 -155 -353 -197 C ATOM 4265 H ATRP B 106 18.164 56.716 46.851 0.05 15.21 H ANISOU 4265 H ATRP B 106 2650 617 2513 98 -269 -228 H ATOM 4266 H BTRP B 106 18.147 56.728 46.837 0.05 15.22 H ANISOU 4266 H BTRP B 106 2651 617 2513 98 -269 -227 H ATOM 4267 HA TRP B 106 16.827 57.639 48.982 0.05 16.24 H ANISOU 4267 HA TRP B 106 2884 698 2588 242 -271 -352 H ATOM 4268 HB2 TRP B 106 18.700 58.156 50.177 0.05 16.97 H ANISOU 4268 HB2 TRP B 106 3040 722 2685 165 -363 -437 H ATOM 4269 HB3 TRP B 106 18.745 56.616 49.832 0.05 15.89 H ANISOU 4269 HB3 TRP B 106 2818 707 2513 144 -316 -385 H ATOM 4270 HD1 TRP B 106 20.518 59.665 48.803 0.05 17.89 H ANISOU 4270 HD1 TRP B 106 3176 683 2937 7 -466 -408 H ATOM 4271 HE1 TRP B 106 22.680 59.145 47.913 0.05 17.67 H ANISOU 4271 HE1 TRP B 106 3045 682 2988 -161 -500 -316 H ATOM 4272 HE3 TRP B 106 20.245 54.760 48.807 0.05 14.56 H ANISOU 4272 HE3 TRP B 106 2516 644 2372 29 -287 -270 H ATOM 4273 HZ2 TRP B 106 24.138 56.864 47.274 0.05 16.28 H ANISOU 4273 HZ2 TRP B 106 2701 692 2793 -235 -433 -202 H ATOM 4274 HZ3 TRP B 106 22.083 53.540 48.042 0.05 14.00 H ANISOU 4274 HZ3 TRP B 106 2353 636 2329 -71 -284 -200 H ATOM 4275 HH2 TRP B 106 23.972 54.581 47.298 0.05 14.83 H ANISOU 4275 HH2 TRP B 106 2434 674 2527 -189 -344 -163 H ATOM 4276 N TRP B 107 17.168 60.060 48.385 0.05 17.71 N ANISOU 4276 N TRP B 107 3175 671 2885 225 -343 -362 N ATOM 4277 CA TRP B 107 17.031 61.384 47.753 0.05 18.52 C ANISOU 4277 CA TRP B 107 3325 654 3059 228 -369 -338 C ATOM 4278 C TRP B 107 16.838 62.427 48.840 0.05 19.64 C ANISOU 4278 C TRP B 107 3566 693 3204 286 -406 -433 C ATOM 4279 O TRP B 107 16.393 62.143 49.931 0.05 19.75 O ANISOU 4279 O TRP B 107 3607 748 3152 354 -392 -505 O ATOM 4280 CB TRP B 107 15.866 61.426 46.750 0.05 18.32 C ANISOU 4280 CB TRP B 107 3267 655 3040 289 -323 -269 C ATOM 4281 CG TRP B 107 14.526 61.273 47.334 0.05 18.41 C ANISOU 4281 CG TRP B 107 3281 711 3004 403 -282 -305 C ATOM 4282 CD1 TRP B 107 13.625 62.264 47.629 0.05 19.33 C ANISOU 4282 CD1 TRP B 107 3454 755 3135 500 -279 -336 C ATOM 4283 CD2 TRP B 107 13.872 60.037 47.737 0.05 17.68 C ANISOU 4283 CD2 TRP B 107 3127 748 2844 439 -232 -309 C ATOM 4284 NE1 TRP B 107 12.481 61.756 48.144 0.05 19.23 N ANISOU 4284 NE1 TRP B 107 3412 826 3069 594 -227 -354 N ATOM 4285 CE2 TRP B 107 12.600 60.379 48.226 0.05 18.23 C ANISOU 4285 CE2 TRP B 107 3210 823 2892 553 -198 -335 C ATOM 4286 CE3 TRP B 107 14.240 58.670 47.720 0.05 16.73 C ANISOU 4286 CE3 TRP B 107 2939 732 2684 386 -212 -288 C ATOM 4287 CZ2 TRP B 107 11.711 59.440 48.728 0.05 17.89 C ANISOU 4287 CZ2 TRP B 107 3111 892 2793 608 -144 -336 C ATOM 4288 CZ3 TRP B 107 13.352 57.778 48.213 0.05 16.40 C ANISOU 4288 CZ3 TRP B 107 2853 786 2591 439 -165 -293 C ATOM 4289 CH2 TRP B 107 12.109 58.127 48.684 0.05 16.95 C ANISOU 4289 CH2 TRP B 107 2930 867 2644 543 -131 -311 C ATOM 4290 H TRP B 107 16.875 60.045 49.187 0.05 17.93 H ANISOU 4290 H TRP B 107 3230 706 2878 269 -341 -413 H ATOM 4291 HA TRP B 107 17.850 61.583 47.278 0.05 18.59 H ANISOU 4291 HA TRP B 107 3324 629 3109 156 -394 -305 H ATOM 4292 HB2 TRP B 107 15.896 62.271 46.273 0.05 18.86 H ANISOU 4292 HB2 TRP B 107 3365 645 3157 284 -341 -243 H ATOM 4293 HB3 TRP B 107 15.983 60.713 46.103 0.05 17.66 H ANISOU 4293 HB3 TRP B 107 3126 640 2944 255 -302 -220 H ATOM 4294 HD1 TRP B 107 13.775 63.164 47.455 0.05 19.99 H ANISOU 4294 HD1 TRP B 107 3587 743 3264 501 -307 -338 H ATOM 4295 HE1 TRP B 107 11.794 62.187 48.396 0.05 19.75 H ANISOU 4295 HE1 TRP B 107 3499 873 3132 669 -212 -373 H ATOM 4296 HE3 TRP B 107 15.071 58.420 47.401 0.05 16.41 H ANISOU 4296 HE3 TRP B 107 2886 694 2657 318 -230 -271 H ATOM 4297 HZ2 TRP B 107 10.873 59.677 49.050 0.05 18.32 H ANISOU 4297 HZ2 TRP B 107 3168 957 2837 686 -117 -348 H ATOM 4298 HZ3 TRP B 107 13.583 56.876 48.198 0.05 15.83 H ANISOU 4298 HZ3 TRP B 107 2740 775 2498 404 -154 -278 H ATOM 4299 HH2 TRP B 107 11.528 57.481 49.006 0.05 16.77 H ANISOU 4299 HH2 TRP B 107 2868 914 2590 572 -96 -305 H ATOM 4300 N ASP B 108 17.185 63.675 48.482 0.05 20.59 N ANISOU 4300 N ASP B 108 3746 673 3404 258 -455 -427 N ATOM 4301 CA ASP B 108 16.869 64.808 49.327 0.05 21.85 C ANISOU 4301 CA ASP B 108 4013 711 3577 322 -494 -518 C ATOM 4302 C ASP B 108 16.759 66.027 48.458 0.05 22.70 C ANISOU 4302 C ASP B 108 4164 681 3782 314 -519 -467 C ATOM 4303 O ASP B 108 16.757 65.989 47.247 0.05 22.33 O ANISOU 4303 O ASP B 108 4063 646 3775 280 -496 -361 O ATOM 4304 CB ASP B 108 17.892 64.979 50.461 0.05 22.43 C ANISOU 4304 CB ASP B 108 4143 744 3635 272 -564 -616 C ATOM 4305 CG ASP B 108 19.334 64.942 49.982 0.05 22.60 C ANISOU 4305 CG ASP B 108 4143 709 3737 126 -629 -576 C ATOM 4306 OD1 ASP B 108 19.559 65.159 48.780 0.05 22.17 O ANISOU 4306 OD1 ASP B 108 4023 662 3737 64 -608 -468 O ATOM 4307 OD2 ASP B 108 20.253 64.707 50.809 0.05 23.36 O ANISOU 4307 OD2 ASP B 108 4289 747 3839 77 -706 -655 O ATOM 4308 H ASP B 108 17.597 63.873 47.759 0.05 20.58 H ANISOU 4308 H ASP B 108 3726 645 3449 204 -465 -372 H ATOM 4309 HA ASP B 108 16.001 64.644 49.724 0.05 21.83 H ANISOU 4309 HA ASP B 108 4019 749 3528 412 -456 -546 H ATOM 4310 HB2 ASP B 108 17.754 65.835 50.899 0.05 23.35 H ANISOU 4310 HB2 ASP B 108 4339 775 3757 321 -590 -682 H ATOM 4311 HB3 ASP B 108 17.754 64.284 51.115 0.05 21.92 H ANISOU 4311 HB3 ASP B 108 4054 772 3504 289 -543 -643 H ATOM 4312 N LYS B 109 16.668 67.173 49.158 0.05 23.79 N ANISOU 4312 N LYS B 109 4780 1152 3109 -29 88 -228 N ATOM 4313 CA LYS B 109 16.629 68.498 48.523 0.05 23.16 C ANISOU 4313 CA LYS B 109 4658 1022 3120 18 116 -353 C ATOM 4314 C LYS B 109 17.846 68.686 47.645 0.05 21.77 C ANISOU 4314 C LYS B 109 4328 797 3145 -101 -131 -394 C ATOM 4315 O LYS B 109 17.722 69.046 46.466 0.05 20.46 O ANISOU 4315 O LYS B 109 3981 641 3154 -100 -72 -390 O ATOM 4316 CB LYS B 109 16.580 69.588 49.608 0.05 25.81 C ANISOU 4316 CB LYS B 109 5388 1250 3170 127 170 -484 C ATOM 4317 CG LYS B 109 15.236 69.734 50.332 0.05 27.94 C ANISOU 4317 CG LYS B 109 5745 1592 3279 325 574 -444 C ATOM 4318 CD LYS B 109 15.279 70.560 51.661 0.05 31.69 C ANISOU 4318 CD LYS B 109 6752 1945 3342 492 666 -600 C ATOM 4319 CE LYS B 109 15.613 69.696 52.903 0.05 33.95 C ANISOU 4319 CE LYS B 109 7452 2213 3234 433 516 -577 C ATOM 4320 NZ LYS B 109 15.908 70.509 54.127 0.05 37.57 N ANISOU 4320 NZ LYS B 109 8525 2461 3287 534 353 -814 N ATOM 4321 H LYS B 109 16.620 67.199 50.011 0.05 25.45 H ANISOU 4321 H LYS B 109 5221 1340 3108 -1 99 -229 H ATOM 4322 HA LYS B 109 15.839 68.568 47.967 0.05 22.56 H ANISOU 4322 HA LYS B 109 4414 997 3162 69 268 -315 H ATOM 4323 HB2 LYS B 109 17.248 69.375 50.274 0.05 26.99 H ANISOU 4323 HB2 LYS B 109 5748 1350 3157 77 -4 -513 H ATOM 4324 HB3 LYS B 109 16.779 70.438 49.188 0.05 25.60 H ANISOU 4324 HB3 LYS B 109 5365 1138 3225 131 116 -565 H ATOM 4325 HG2 LYS B 109 14.618 70.168 49.728 0.05 27.34 H ANISOU 4325 HG2 LYS B 109 5464 1540 3385 394 698 -436 H ATOM 4326 HG3 LYS B 109 14.910 68.847 50.548 0.05 28.13 H ANISOU 4326 HG3 LYS B 109 5697 1707 3284 288 665 -317 H ATOM 4327 HD2 LYS B 109 15.927 71.273 51.590 0.05 31.79 H ANISOU 4327 HD2 LYS B 109 6890 1817 3371 489 497 -735 H ATOM 4328 HD3 LYS B 109 14.400 70.945 51.811 0.05 33.26 H ANISOU 4328 HD3 LYS B 109 6940 2201 3496 661 995 -576 H ATOM 4329 HE2 LYS B 109 14.849 69.135 53.100 0.05 35.25 H ANISOU 4329 HE2 LYS B 109 7634 2482 3276 498 794 -453 H ATOM 4330 HE3 LYS B 109 16.387 69.146 52.714 0.05 32.38 H ANISOU 4330 HE3 LYS B 109 7130 2011 3160 273 229 -532 H ATOM 4331 HZ1 LYS B 109 16.175 69.981 54.791 0.05 38.99 H ANISOU 4331 HZ1 LYS B 109 8961 2613 3241 481 168 -806 H ATOM 4332 HZ2 LYS B 109 16.551 71.099 53.950 0.05 36.78 H ANISOU 4332 HZ2 LYS B 109 8390 2244 3339 465 130 -918 H ATOM 4333 HZ3 LYS B 109 15.177 70.947 54.384 0.05 39.60 H ANISOU 4333 HZ3 LYS B 109 8953 2718 3374 721 652 -861 H ATOM 4334 N GLU B 110 19.015 68.396 48.199 0.05 22.67 N ANISOU 4334 N GLU B 110 4498 867 3248 -195 -398 -404 N ATOM 4335 CA GLU B 110 20.272 68.551 47.471 0.05 22.46 C ANISOU 4335 CA GLU B 110 4237 815 3482 -311 -581 -408 C ATOM 4336 C GLU B 110 20.312 67.749 46.194 0.05 20.64 C ANISOU 4336 C GLU B 110 3700 687 3454 -277 -449 -337 C ATOM 4337 O GLU B 110 20.681 68.228 45.132 0.05 20.24 O ANISOU 4337 O GLU B 110 3493 646 3551 -305 -361 -328 O ATOM 4338 CB GLU B 110 21.475 68.143 48.336 0.05 24.66 C ANISOU 4338 CB GLU B 110 4540 1040 3790 -396 -943 -407 C ATOM 4339 CG GLU B 110 22.752 67.888 47.503 0.05 25.25 C ANISOU 4339 CG GLU B 110 4205 1138 4252 -493 -1074 -355 C ATOM 4340 CD GLU B 110 23.979 67.592 48.348 0.05 28.17 C ANISOU 4340 CD GLU B 110 4491 1462 4749 -552 -1496 -328 C ATOM 4341 OE1 GLU B 110 24.062 68.101 49.469 0.05 30.50 O ANISOU 4341 OE1 GLU B 110 5101 1633 4853 -626 -1810 -396 O ATOM 4342 OE2 GLU B 110 24.842 66.805 47.884 0.05 28.68 O ANISOU 4342 OE2 GLU B 110 4197 1602 5098 -492 -1533 -246 O ATOM 4343 H GLU B 110 19.112 68.121 49.005 0.05 23.84 H ANISOU 4343 H GLU B 110 4806 1002 3252 -190 -477 -396 H ATOM 4344 HA GLU B 110 20.384 69.488 47.242 0.05 22.81 H ANISOU 4344 HA GLU B 110 4315 789 3561 -351 -572 -454 H ATOM 4345 HB2 GLU B 110 21.661 68.853 48.967 0.05 26.28 H ANISOU 4345 HB2 GLU B 110 4973 1147 3865 -438 -1080 -478 H ATOM 4346 HB3 GLU B 110 21.260 67.325 48.810 0.05 24.75 H ANISOU 4346 HB3 GLU B 110 4605 1087 3711 -339 -971 -356 H ATOM 4347 HG2 GLU B 110 22.631 67.127 46.918 0.05 24.00 H ANISOU 4347 HG2 GLU B 110 3871 1063 4185 -417 -919 -308 H ATOM 4348 HG3 GLU B 110 22.940 68.681 46.974 0.05 25.61 H ANISOU 4348 HG3 GLU B 110 4202 1134 4393 -582 -1041 -374 H ATOM 4349 N SER B 111 19.952 66.474 46.301 0.05 20.14 N ANISOU 4349 N SER B 111 3615 672 3368 -213 -433 -280 N ATOM 4350 CA SER B 111 20.101 65.587 45.127 0.05 19.23 C ANISOU 4350 CA SER B 111 3302 595 3411 -156 -366 -258 C ATOM 4351 C SER B 111 19.151 66.028 44.018 0.05 18.08 C ANISOU 4351 C SER B 111 3143 475 3249 -128 -190 -278 C ATOM 4352 O SER B 111 19.459 65.907 42.849 0.05 17.97 O ANISOU 4352 O SER B 111 3052 480 3298 -86 -125 -295 O ATOM 4353 CB SER B 111 19.931 64.103 45.486 0.05 19.61 C ANISOU 4353 CB SER B 111 3388 604 3458 -109 -444 -198 C ATOM 4354 OG SER B 111 18.631 63.819 45.905 0.05 19.45 O ANISOU 4354 OG SER B 111 3484 578 3327 -140 -342 -135 O ATOM 4355 H SER B 111 19.633 66.115 47.012 0.05 20.67 H ANISOU 4355 H SER B 111 3807 729 3319 -201 -458 -253 H ATOM 4356 HA SER B 111 20.998 65.684 44.777 0.05 19.80 H ANISOU 4356 HA SER B 111 3242 674 3607 -159 -405 -266 H ATOM 4357 HB2 SER B 111 20.152 63.574 44.709 0.05 19.49 H ANISOU 4357 HB2 SER B 111 3284 579 3544 -53 -429 -218 H ATOM 4358 HB3 SER B 111 20.548 63.922 46.208 0.05 20.67 H ANISOU 4358 HB3 SER B 111 3560 712 3582 -115 -588 -173 H ATOM 4359 HG SER B 111 18.115 63.786 45.253 0.05 18.86 H ANISOU 4359 HG SER B 111 3351 515 3301 -135 -273 -149 H ATOM 4360 N ATHR B 112 17.986 66.501 44.417 0.02 17.90 N ANISOU 4360 N ATHR B 112 3213 455 3134 -121 -112 -265 N ATOM 4361 N BTHR B 112 17.978 66.492 44.411 0.03 17.90 N ANISOU 4361 N BTHR B 112 3212 455 3133 -121 -111 -265 N ATOM 4362 CA ATHR B 112 16.978 66.943 43.472 0.02 17.51 C ANISOU 4362 CA ATHR B 112 3128 419 3107 -73 -25 -264 C ATOM 4363 CA BTHR B 112 16.963 66.933 43.465 0.03 17.50 C ANISOU 4363 CA BTHR B 112 3124 417 3107 -72 -26 -264 C ATOM 4364 C ATHR B 112 17.394 68.253 42.784 0.02 17.62 C ANISOU 4364 C ATHR B 112 3188 393 3112 -67 9 -289 C ATOM 4365 C BTHR B 112 17.385 68.254 42.783 0.03 17.61 C ANISOU 4365 C BTHR B 112 3188 393 3112 -68 9 -289 C ATOM 4366 O ATHR B 112 17.362 68.335 41.561 0.02 17.61 O ANISOU 4366 O ATHR B 112 3185 392 3113 -32 25 -273 O ATOM 4367 O BTHR B 112 17.364 68.334 41.560 0.03 17.61 O ANISOU 4367 O BTHR B 112 3185 392 3113 -33 26 -274 O ATOM 4368 CB ATHR B 112 15.611 67.026 44.151 0.02 18.26 C ANISOU 4368 CB ATHR B 112 3213 538 3189 -34 78 -216 C ATOM 4369 CB BTHR B 112 15.586 66.995 44.155 0.03 18.23 C ANISOU 4369 CB BTHR B 112 3199 534 3193 -34 73 -215 C ATOM 4370 OG1ATHR B 112 15.697 67.805 45.356 0.02 19.24 O ANISOU 4370 OG1ATHR B 112 3505 638 3167 -3 159 -249 O ATOM 4371 OG1BTHR B 112 15.334 65.746 44.812 0.03 18.78 O ANISOU 4371 OG1BTHR B 112 3228 616 3291 -94 67 -133 O ATOM 4372 CG2ATHR B 112 15.171 65.653 44.524 0.02 18.77 C ANISOU 4372 CG2ATHR B 112 3205 615 3312 -95 62 -129 C ATOM 4373 CG2BTHR B 112 14.470 67.218 43.173 0.03 18.52 C ANISOU 4373 CG2BTHR B 112 3121 579 3337 29 64 -194 C ATOM 4374 H ATHR B 112 17.754 66.577 45.238 0.05 18.41 H ANISOU 4374 H ATHR B 112 3359 515 3123 -126 -106 -251 H ATOM 4375 H BTHR B 112 17.740 66.564 45.231 0.05 18.40 H ANISOU 4375 H BTHR B 112 3357 514 3122 -126 -104 -250 H ATOM 4376 HA ATHR B 112 16.916 66.270 42.783 0.05 17.32 H ANISOU 4376 HA ATHR B 112 3056 399 3128 -63 -63 -261 H ATOM 4377 HA BTHR B 112 16.904 66.260 42.775 0.05 17.31 H ANISOU 4377 HA BTHR B 112 3054 397 3127 -63 -64 -262 H ATOM 4378 HB ATHR B 112 14.950 67.387 43.545 0.05 18.41 H ANISOU 4378 HB ATHR B 112 3170 561 3266 14 95 -209 H ATOM 4379 HB BTHR B 112 15.575 67.704 44.819 0.05 18.79 H ANISOU 4379 HB BTHR B 112 3366 592 3182 -4 139 -237 H ATOM 4380 HG1ATHR B 112 16.221 67.441 45.899 0.05 19.38 H ANISOU 4380 HG1ATHR B 112 3591 646 3125 -46 98 -250 H ATOM 4381 HG1BTHR B 112 14.516 65.664 44.964 0.05 19.59 H ANISOU 4381 HG1BTHR B 112 3276 744 3423 -85 158 -80 H ATOM 4382 HG21ATHR B 112 14.364 65.677 45.051 0.05 19.80 H ANISOU 4382 HG21ATHR B 112 3300 776 3448 -85 180 -67 H ATOM 4383 HG21BTHR B 112 14.267 66.378 42.738 0.05 18.18 H ANISOU 4383 HG21BTHR B 112 3067 523 3317 7 -37 -206 H ATOM 4384 HG22ATHR B 112 15.013 65.142 43.717 0.05 18.58 H ANISOU 4384 HG22ATHR B 112 3106 573 3382 -112 -22 -130 H ATOM 4385 HG22BTHR B 112 13.678 67.527 43.638 0.05 19.43 H ANISOU 4385 HG22BTHR B 112 3127 724 3531 40 116 -138 H ATOM 4386 HG23ATHR B 112 15.873 65.229 45.034 0.05 18.75 H ANISOU 4386 HG23ATHR B 112 3279 590 3254 -126 8 -127 H ATOM 4387 HG23BTHR B 112 14.717 67.881 42.509 0.05 18.65 H ANISOU 4387 HG23BTHR B 112 3196 568 3324 87 93 -220 H ATOM 4388 N LEU B 113 17.812 69.231 43.576 0.05 18.33 N ANISOU 4388 N LEU B 113 3376 416 3171 -116 -10 -321 N ATOM 4389 CA LEU B 113 18.307 70.474 43.011 0.05 19.10 C ANISOU 4389 CA LEU B 113 3538 414 3305 -168 0 -314 C ATOM 4390 C LEU B 113 19.497 70.214 42.101 0.05 19.46 C ANISOU 4390 C LEU B 113 3443 496 3455 -253 37 -250 C ATOM 4391 O LEU B 113 19.613 70.833 41.030 0.05 20.20 O ANISOU 4391 O LEU B 113 3581 547 3545 -268 135 -180 O ATOM 4392 CB LEU B 113 18.709 71.482 44.099 0.05 20.59 C ANISOU 4392 CB LEU B 113 3906 460 3457 -234 -99 -385 C ATOM 4393 CG LEU B 113 17.679 72.189 44.978 0.05 21.30 C ANISOU 4393 CG LEU B 113 4197 477 3418 -67 -12 -450 C ATOM 4394 CD1 LEU B 113 18.413 73.018 46.064 0.05 23.44 C ANISOU 4394 CD1 LEU B 113 4774 592 3541 -78 -115 -579 C ATOM 4395 CD2 LEU B 113 16.755 73.098 44.148 0.05 21.70 C ANISOU 4395 CD2 LEU B 113 4284 432 3530 31 57 -406 C ATOM 4396 H ALEU B 113 17.819 69.198 44.435 0.05 18.74 H ANISOU 4396 H ALEU B 113 3490 456 3173 -130 -46 -342 H ATOM 4397 H BLEU B 113 17.829 69.197 44.435 0.05 18.74 H ANISOU 4397 H BLEU B 113 3490 456 3173 -130 -46 -342 H ATOM 4398 HA LEU B 113 17.604 70.869 42.475 0.05 19.08 H ANISOU 4398 HA LEU B 113 3578 391 3281 -93 51 -297 H ATOM 4399 HB2 LEU B 113 19.315 71.033 44.708 0.05 20.86 H ANISOU 4399 HB2 LEU B 113 3939 517 3470 -278 -193 -411 H ATOM 4400 HB3 LEU B 113 19.197 72.187 43.652 0.05 21.45 H ANISOU 4400 HB3 LEU B 113 4027 479 3645 -328 -130 -361 H ATOM 4401 HG LEU B 113 17.127 71.522 45.418 0.05 20.71 H ANISOU 4401 HG LEU B 113 4050 511 3309 11 65 -433 H ATOM 4402 HD11 LEU B 113 18.446 72.504 46.883 0.05 23.46 H ANISOU 4402 HD11 LEU B 113 4792 668 3453 -88 -150 -589 H ATOM 4403 HD12 LEU B 113 19.311 73.203 45.751 0.05 24.29 H ANISOU 4403 HD12 LEU B 113 4925 581 3723 -214 -257 -591 H ATOM 4404 HD13 LEU B 113 17.936 73.851 46.222 0.05 24.40 H ANISOU 4404 HD13 LEU B 113 5040 646 3584 67 -14 -630 H ATOM 4405 HD21 LEU B 113 15.893 73.157 44.586 0.05 22.95 H ANISOU 4405 HD21 LEU B 113 4597 482 3639 136 84 -468 H ATOM 4406 HD22 LEU B 113 17.164 73.972 44.108 0.05 22.00 H ANISOU 4406 HD22 LEU B 113 4333 400 3628 -83 11 -361 H ATOM 4407 HD23 LEU B 113 16.656 72.748 43.250 0.05 20.92 H ANISOU 4407 HD23 LEU B 113 4056 433 3458 104 105 -354 H ATOM 4408 N ASN B 114 20.394 69.322 42.527 0.05 19.60 N ANISOU 4408 N ASN B 114 3296 587 3562 -281 -13 -254 N ATOM 4409 CA ASN B 114 21.584 69.058 41.751 0.05 20.82 C ANISOU 4409 CA ASN B 114 3256 802 3851 -300 107 -190 C ATOM 4410 C ASN B 114 21.183 68.464 40.392 0.05 20.58 C ANISOU 4410 C ASN B 114 3309 828 3682 -162 283 -181 C ATOM 4411 O ASN B 114 21.774 68.764 39.388 0.05 22.23 O ANISOU 4411 O ASN B 114 3502 1063 3881 -158 490 -104 O ATOM 4412 CB ASN B 114 22.547 68.128 42.502 0.05 21.50 C ANISOU 4412 CB ASN B 114 3132 950 4086 -262 13 -205 C ATOM 4413 CG ASN B 114 23.336 68.843 43.640 0.05 22.48 C ANISOU 4413 CG ASN B 114 3215 1014 4311 -381 -255 -216 C ATOM 4414 OD1 ASN B 114 24.213 68.231 44.239 0.05 22.48 O ANISOU 4414 OD1 ASN B 114 3230 1018 4292 -322 -436 -240 O ATOM 4415 ND2 ASN B 114 23.059 70.137 43.901 0.05 24.04 N ANISOU 4415 ND2 ASN B 114 3398 1121 4616 -563 -327 -187 N ATOM 4416 H ASN B 114 20.327 68.870 43.253 0.05 19.38 H ANISOU 4416 H ASN B 114 3271 573 3522 -272 -100 -283 H ATOM 4417 HA ASN B 114 22.036 69.901 41.583 0.05 22.07 H ANISOU 4417 HA ASN B 114 3372 913 4100 -410 136 -135 H ATOM 4418 HB2 ASN B 114 22.037 67.405 42.897 0.05 20.60 H ANISOU 4418 HB2 ASN B 114 3075 857 3897 -158 0 -245 H ATOM 4419 HB3 ASN B 114 23.193 67.776 41.872 0.05 22.91 H ANISOU 4419 HB3 ASN B 114 3146 1169 4391 -264 134 -155 H ATOM 4420 HD21 ASN B 114 22.581 70.353 44.584 0.05 25.18 H ANISOU 4420 HD21 ASN B 114 3539 1207 4820 -649 -529 -204 H ATOM 4421 HD22 ASN B 114 23.381 70.741 43.387 0.05 24.24 H ANISOU 4421 HD22 ASN B 114 3437 1124 4648 -604 -193 -147 H ATOM 4422 N PHE B 115 20.195 67.560 40.351 0.05 19.27 N ANISOU 4422 N PHE B 115 3240 673 3408 -54 193 -253 N ATOM 4423 CA PHE B 115 19.677 67.111 39.066 0.05 19.63 C ANISOU 4423 CA PHE B 115 3440 724 3296 64 236 -281 C ATOM 4424 C PHE B 115 19.197 68.264 38.124 0.05 20.37 C ANISOU 4424 C PHE B 115 3706 781 3254 57 298 -205 C ATOM 4425 O PHE B 115 19.494 68.286 36.947 0.05 22.04 O ANISOU 4425 O PHE B 115 4072 1003 3301 126 435 -170 O ATOM 4426 CB PHE B 115 18.554 66.073 39.314 0.05 18.72 C ANISOU 4426 CB PHE B 115 3371 572 3170 96 38 -344 C ATOM 4427 CG PHE B 115 17.669 65.881 38.151 0.05 19.59 C ANISOU 4427 CG PHE B 115 3666 641 3138 166 -62 -375 C ATOM 4428 CD1 PHE B 115 18.080 65.020 37.109 0.05 21.23 C ANISOU 4428 CD1 PHE B 115 4059 812 3194 284 -45 -463 C ATOM 4429 CD2 PHE B 115 16.425 66.481 38.065 0.05 19.61 C ANISOU 4429 CD2 PHE B 115 3683 621 3148 151 -202 -332 C ATOM 4430 CE1 PHE B 115 17.280 64.843 35.995 0.05 22.84 C ANISOU 4430 CE1 PHE B 115 4531 945 3201 350 -216 -516 C ATOM 4431 CE2 PHE B 115 15.639 66.324 36.980 0.05 21.19 C ANISOU 4431 CE2 PHE B 115 4054 765 3231 211 -399 -355 C ATOM 4432 CZ PHE B 115 16.040 65.467 35.937 0.05 22.81 C ANISOU 4432 CZ PHE B 115 4516 919 3231 294 -441 -455 C ATOM 4433 H PHE B 115 19.805 67.231 41.040 0.05 18.56 H ANISOU 4433 H PHE B 115 3145 573 3333 -64 94 -278 H ATOM 4434 HA PHE B 115 20.388 66.659 38.590 0.05 20.69 H ANISOU 4434 HA PHE B 115 3557 885 3420 130 341 -296 H ATOM 4435 HB2 PHE B 115 18.987 65.227 39.490 0.05 18.91 H ANISOU 4435 HB2 PHE B 115 3359 587 3240 126 17 -381 H ATOM 4436 HB3 PHE B 115 18.014 66.325 40.074 0.05 18.00 H ANISOU 4436 HB3 PHE B 115 3230 477 3131 42 -14 -320 H ATOM 4437 HD1 PHE B 115 18.915 64.634 37.162 0.05 21.64 H ANISOU 4437 HD1 PHE B 115 4068 882 3272 333 78 -488 H ATOM 4438 HD2 PHE B 115 16.149 67.044 38.750 0.05 18.98 H ANISOU 4438 HD2 PHE B 115 3502 555 3154 116 -176 -291 H ATOM 4439 HE1 PHE B 115 17.553 64.295 35.302 0.05 24.37 H ANISOU 4439 HE1 PHE B 115 4921 1096 3244 449 -204 -598 H ATOM 4440 HE2 PHE B 115 14.808 66.734 36.946 0.05 21.60 H ANISOU 4440 HE2 PHE B 115 4065 803 3337 213 -524 -313 H ATOM 4441 HZ PHE B 115 15.493 65.353 35.197 0.05 24.30 H ANISOU 4441 HZ PHE B 115 4880 1051 3304 333 -625 -485 H ATOM 4442 N LEU B 116 18.410 69.158 38.707 0.05 19.64 N ANISOU 4442 N LEU B 116 3626 628 3209 7 202 -180 N ATOM 4443 CA LEU B 116 17.914 70.320 37.955 0.05 20.70 C ANISOU 4443 CA LEU B 116 3941 674 3250 32 203 -95 C ATOM 4444 C LEU B 116 19.007 71.267 37.423 0.05 22.52 C ANISOU 4444 C LEU B 116 4242 845 3469 -73 393 34 C ATOM 4445 O LEU B 116 18.943 71.671 36.292 0.05 24.25 O ANISOU 4445 O LEU B 116 4677 1027 3509 -26 470 138 O ATOM 4446 CB LEU B 116 17.004 71.059 38.895 0.05 20.15 C ANISOU 4446 CB LEU B 116 3847 528 3282 48 103 -118 C ATOM 4447 CG LEU B 116 15.561 70.580 39.056 0.05 20.05 C ANISOU 4447 CG LEU B 116 3778 544 3294 177 -41 -143 C ATOM 4448 CD1 LEU B 116 14.992 71.056 40.390 0.05 19.82 C ANISOU 4448 CD1 LEU B 116 3631 515 3386 218 -12 -185 C ATOM 4449 CD2 LEU B 116 14.752 71.215 37.912 0.05 21.80 C ANISOU 4449 CD2 LEU B 116 4180 665 3439 282 -133 -54 C ATOM 4450 H LEU B 116 18.143 69.127 39.519 0.05 18.91 H ANISOU 4450 H LEU B 116 3465 530 3189 -20 144 -208 H ATOM 4451 HA LEU B 116 17.389 70.028 37.195 0.05 21.20 H ANISOU 4451 HA LEU B 116 4113 742 3200 115 136 -95 H ATOM 4452 HB2 LEU B 116 17.424 71.048 39.768 0.05 19.57 H ANISOU 4452 HB2 LEU B 116 3689 467 3279 -11 116 -163 H ATOM 4453 HB3 LEU B 116 16.965 71.975 38.586 0.05 21.12 H ANISOU 4453 HB3 LEU B 116 4081 549 3393 41 121 -61 H ATOM 4454 HG LEU B 116 15.509 69.620 38.989 0.05 19.78 H ANISOU 4454 HG LEU B 116 3701 571 3243 175 -96 -170 H ATOM 4455 HD11 LEU B 116 15.569 70.771 41.114 0.05 19.20 H ANISOU 4455 HD11 LEU B 116 3541 454 3301 143 45 -223 H ATOM 4456 HD12 LEU B 116 14.937 72.021 40.377 0.05 20.71 H ANISOU 4456 HD12 LEU B 116 3821 537 3510 287 0 -172 H ATOM 4457 HD13 LEU B 116 14.106 70.680 40.503 0.05 19.96 H ANISOU 4457 HD13 LEU B 116 3523 589 3470 259 -63 -180 H ATOM 4458 HD21 LEU B 116 14.370 70.491 37.385 0.05 22.32 H ANISOU 4458 HD21 LEU B 116 4179 747 3553 365 -273 -55 H ATOM 4459 HD22 LEU B 116 14.045 71.765 38.287 0.05 22.28 H ANISOU 4459 HD22 LEU B 116 4296 630 3539 294 -91 -30 H ATOM 4460 HD23 LEU B 116 15.332 71.757 37.355 0.05 22.40 H ANISOU 4460 HD23 LEU B 116 4393 738 3379 256 -102 -13 H ATOM 4461 N THR B 117 20.051 71.412 38.211 0.05 22.68 N ANISOU 4461 N THR B 117 4070 865 3684 -222 452 40 N ATOM 4462 CA THR B 117 21.186 72.233 37.823 0.05 25.17 C ANISOU 4462 CA THR B 117 4333 1116 4114 -399 627 196 C ATOM 4463 C THR B 117 21.939 71.649 36.641 0.05 27.12 C ANISOU 4463 C THR B 117 4540 1497 4266 -340 930 289 C ATOM 4464 O THR B 117 22.259 72.338 35.690 0.05 29.77 O ANISOU 4464 O THR B 117 5018 1791 4503 -392 1160 471 O ATOM 4465 CB THR B 117 22.067 72.475 39.042 0.05 25.60 C ANISOU 4465 CB THR B 117 4141 1125 4461 -594 505 165 C ATOM 4466 OG1 THR B 117 21.282 73.180 40.020 0.05 24.75 O ANISOU 4466 OG1 THR B 117 4214 854 4335 -606 269 62 O ATOM 4467 CG2 THR B 117 23.308 73.286 38.676 0.05 29.16 C ANISOU 4467 CG2 THR B 117 4397 1514 5168 -848 663 360 C ATOM 4468 H THR B 117 20.114 71.086 38.998 0.05 21.77 H ANISOU 4468 H THR B 117 3847 773 3653 -241 370 -31 H ATOM 4469 HA THR B 117 20.842 73.092 37.541 0.05 25.98 H ANISOU 4469 HA THR B 117 4612 1093 4165 -425 613 269 H ATOM 4470 HB THR B 117 22.354 71.631 39.422 0.05 24.81 H ANISOU 4470 HB THR B 117 3886 1133 4406 -543 470 93 H ATOM 4471 HG1 THR B 117 21.731 73.294 40.717 0.05 25.53 H ANISOU 4471 HG1 THR B 117 4249 893 4558 -724 170 42 H ATOM 4472 HG21 THR B 117 23.077 74.226 38.606 0.05 30.14 H ANISOU 4472 HG21 THR B 117 4659 1460 5333 -971 585 409 H ATOM 4473 HG22 THR B 117 23.978 73.185 39.369 0.05 29.74 H ANISOU 4473 HG22 THR B 117 4223 1630 5448 -931 583 336 H ATOM 4474 HG23 THR B 117 23.692 72.993 37.837 0.05 30.43 H ANISOU 4474 HG23 THR B 117 4539 1755 5267 -809 914 469 H ATOM 4475 N ARG B 118 22.171 70.335 36.668 0.05 26.35 N ANISOU 4475 N ARG B 118 4312 1543 4157 -197 957 167 N ATOM 4476 CA ARG B 118 22.878 69.692 35.570 0.05 29.01 C ANISOU 4476 CA ARG B 118 4622 1998 4401 -76 1300 218 C ATOM 4477 C ARG B 118 22.077 69.700 34.259 0.05 29.99 C ANISOU 4477 C ARG B 118 5207 2107 4082 106 1363 207 C ATOM 4478 O ARG B 118 22.647 69.857 33.197 0.05 33.39 O ANISOU 4478 O ARG B 118 5803 2586 4298 183 1718 321 O ATOM 4479 CB ARG B 118 23.302 68.270 35.963 0.05 28.67 C ANISOU 4479 CB ARG B 118 4290 2054 4550 40 1281 86 C ATOM 4480 CG ARG B 118 24.521 68.248 36.892 0.05 29.02 C ANISOU 4480 CG ARG B 118 3915 2091 5018 -175 1163 153 C ATOM 4481 CD ARG B 118 24.166 68.204 38.388 0.05 27.85 C ANISOU 4481 CD ARG B 118 3546 1964 5073 -122 899 34 C ATOM 4482 NE ARG B 118 23.191 67.121 38.678 0.05 25.11 N ANISOU 4482 NE ARG B 118 3453 1581 4507 29 697 -125 N ATOM 4483 CZ ARG B 118 23.355 66.123 39.580 0.05 24.17 C ANISOU 4483 CZ ARG B 118 3250 1440 4493 74 454 -201 C ATOM 4484 NH1 ARG B 118 24.414 66.108 40.372 0.05 25.50 N ANISOU 4484 NH1 ARG B 118 3127 1619 4944 -5 312 -153 N ATOM 4485 NH2 ARG B 118 22.435 65.144 39.725 0.05 22.38 N ANISOU 4485 NH2 ARG B 118 3247 1156 4100 164 307 -298 N ATOM 4486 H ARG B 118 21.925 69.819 37.304 0.05 24.72 H ANISOU 4486 H ARG B 118 4054 1350 3987 -157 798 61 H ATOM 4487 HA ARG B 118 23.696 70.186 35.401 0.05 31.18 H ANISOU 4487 HA ARG B 118 4770 2278 4798 -193 1503 365 H ATOM 4488 HB2 ARG B 118 22.560 67.843 36.412 0.05 26.67 H ANISOU 4488 HB2 ARG B 118 4142 1772 4220 113 1066 -39 H ATOM 4489 HB3 ARG B 118 23.532 67.776 35.160 0.05 30.84 H ANISOU 4489 HB3 ARG B 118 4549 2400 4768 170 1537 99 H ATOM 4490 HG2 ARG B 118 25.052 67.461 36.692 0.05 31.70 H ANISOU 4490 HG2 ARG B 118 4052 2484 5510 -222 1399 274 H ATOM 4491 HG3 ARG B 118 25.050 69.045 36.739 0.05 28.09 H ANISOU 4491 HG3 ARG B 118 3881 1881 4911 -321 1010 179 H ATOM 4492 HD2 ARG B 118 24.983 68.022 38.874 0.05 29.85 H ANISOU 4492 HD2 ARG B 118 3574 2291 5478 -31 1047 58 H ATOM 4493 HD3 ARG B 118 23.834 69.071 38.648 0.05 27.57 H ANISOU 4493 HD3 ARG B 118 3417 1874 5186 -282 704 55 H ATOM 4494 HE ARG B 118 22.407 67.206 38.335 0.05 24.05 H ANISOU 4494 HE ARG B 118 3531 1414 4195 34 675 -146 H ATOM 4495 HH11 ARG B 118 25.023 66.705 40.297 0.05 27.07 H ANISOU 4495 HH11 ARG B 118 3145 1842 5300 -94 380 -79 H ATOM 4496 HH12 ARG B 118 24.503 65.484 40.953 0.05 25.16 H ANISOU 4496 HH12 ARG B 118 3073 1549 4939 28 135 -186 H ATOM 4497 HH21 ARG B 118 21.728 65.139 39.241 0.05 21.88 H ANISOU 4497 HH21 ARG B 118 3353 1077 3885 199 342 -328 H ATOM 4498 HH22 ARG B 118 22.542 64.541 40.327 0.05 22.04 H ANISOU 4498 HH22 ARG B 118 3177 1083 4114 176 163 -318 H ATOM 4499 N LEU B 119 20.755 69.576 34.327 0.05 27.76 N ANISOU 4499 N LEU B 119 5137 1747 3663 165 1011 96 N ATOM 4500 CA LEU B 119 19.954 69.726 33.116 0.05 29.26 C ANISOU 4500 CA LEU B 119 5770 1879 3471 295 919 111 C ATOM 4501 C LEU B 119 20.034 71.180 32.592 0.05 31.51 C ANISOU 4501 C LEU B 119 6250 2073 3649 199 1068 356 C ATOM 4502 O LEU B 119 19.890 71.435 31.398 0.05 34.87 O ANISOU 4502 O LEU B 119 7040 2495 3716 285 1272 475 O ATOM 4503 CB LEU B 119 18.489 69.319 33.365 0.05 27.12 C ANISOU 4503 CB LEU B 119 5542 1537 3225 336 463 -11 C ATOM 4504 CG LEU B 119 17.735 68.351 32.447 0.05 27.80 C ANISOU 4504 CG LEU B 119 5853 1593 3117 474 166 -170 C ATOM 4505 CD1 LEU B 119 16.246 68.591 32.562 0.05 27.46 C ANISOU 4505 CD1 LEU B 119 5817 1469 3149 469 -241 -148 C ATOM 4506 CD2 LEU B 119 18.221 68.395 30.991 0.05 31.49 C ANISOU 4506 CD2 LEU B 119 6795 2047 3124 644 285 -204 C ATOM 4507 H LEU B 119 20.308 69.420 35.043 0.05 25.81 H ANISOU 4507 H LEU B 119 4776 1482 3549 131 818 25 H ATOM 4508 HA LEU B 119 20.317 69.147 32.429 0.05 30.96 H ANISOU 4508 HA LEU B 119 6144 2137 3484 421 1049 62 H ATOM 4509 HB2 LEU B 119 18.443 68.936 34.255 0.05 25.14 H ANISOU 4509 HB2 LEU B 119 5033 1304 3214 266 403 -59 H ATOM 4510 HB3 LEU B 119 17.974 70.142 33.357 0.05 27.57 H ANISOU 4510 HB3 LEU B 119 5707 1523 3244 319 376 83 H ATOM 4511 HG LEU B 119 17.881 67.451 32.766 0.05 26.57 H ANISOU 4511 HG LEU B 119 5525 1461 3109 462 130 -274 H ATOM 4512 HD11 LEU B 119 15.783 67.746 32.452 0.05 27.96 H ANISOU 4512 HD11 LEU B 119 5933 1503 3188 503 -479 -246 H ATOM 4513 HD12 LEU B 119 16.053 68.957 33.439 0.05 25.66 H ANISOU 4513 HD12 LEU B 119 5324 1253 3172 397 -243 -127 H ATOM 4514 HD13 LEU B 119 15.980 69.217 31.873 0.05 29.09 H ANISOU 4514 HD13 LEU B 119 6241 1626 3185 511 -261 -47 H ATOM 4515 HD21 LEU B 119 17.615 67.869 30.447 0.05 31.86 H ANISOU 4515 HD21 LEU B 119 6946 2052 3108 710 85 -352 H ATOM 4516 HD22 LEU B 119 18.233 69.314 30.681 0.05 33.04 H ANISOU 4516 HD22 LEU B 119 7238 2192 3122 668 204 -109 H ATOM 4517 HD23 LEU B 119 19.113 68.017 30.949 0.05 32.40 H ANISOU 4517 HD23 LEU B 119 6874 2228 3207 666 631 -168 H ATOM 4518 N GLU B 120 20.261 72.133 33.490 0.05 30.25 N ANISOU 4518 N GLU B 120 5916 1809 3770 28 966 435 N ATOM 4519 CA GLU B 120 20.443 73.523 33.095 0.05 32.76 C ANISOU 4519 CA GLU B 120 6436 1964 4049 -92 1070 679 C ATOM 4520 C GLU B 120 21.733 73.674 32.323 0.05 36.44 C ANISOU 4520 C GLU B 120 6867 2492 4488 -215 1556 896 C ATOM 4521 O GLU B 120 21.776 74.278 31.258 0.05 40.02 O ANISOU 4521 O GLU B 120 7660 2861 4685 -234 1760 1137 O ATOM 4522 CB GLU B 120 20.519 74.429 34.332 0.05 31.35 C ANISOU 4522 CB GLU B 120 6083 1615 4215 -254 881 674 C ATOM 4523 CG GLU B 120 19.944 75.788 34.120 0.05 33.24 C ANISOU 4523 CG GLU B 120 6649 1591 4388 -255 752 834 C ATOM 4524 CD GLU B 120 18.546 75.667 33.614 0.05 33.21 C ANISOU 4524 CD GLU B 120 6922 1577 4120 13 484 795 C ATOM 4525 OE1 GLU B 120 17.839 74.763 34.117 0.05 30.79 O ANISOU 4525 OE1 GLU B 120 6450 1406 3845 150 284 590 O ATOM 4526 OE2 GLU B 120 18.190 76.399 32.674 0.05 36.23 O ANISOU 4526 OE2 GLU B 120 7686 1808 4272 70 455 996 O ATOM 4527 H GLU B 120 20.309 72.001 34.337 0.05 28.32 H ANISOU 4527 H GLU B 120 5475 1561 3722 -16 834 348 H ATOM 4528 HA GLU B 120 19.715 73.795 32.517 0.05 33.72 H ANISOU 4528 HA GLU B 120 6856 2023 3934 19 949 720 H ATOM 4529 HB2 GLU B 120 20.041 74.008 35.064 0.05 29.03 H ANISOU 4529 HB2 GLU B 120 5671 1357 4001 -183 689 511 H ATOM 4530 HB3 GLU B 120 21.451 74.548 34.574 0.05 32.05 H ANISOU 4530 HB3 GLU B 120 5973 1705 4499 -423 1024 727 H ATOM 4531 HG2 GLU B 120 19.926 76.261 34.966 0.05 32.46 H ANISOU 4531 HG2 GLU B 120 6469 1371 4493 -314 622 778 H ATOM 4532 HG3 GLU B 120 20.479 76.266 33.467 0.05 35.84 H ANISOU 4532 HG3 GLU B 120 7106 1860 4653 -362 954 1028 H ATOM 4533 N GLN B 121 22.791 73.127 32.899 0.05 36.21 N ANISOU 4533 N GLN B 121 6405 2609 4742 -289 1751 838 N ATOM 4534 CA GLN B 121 24.133 73.334 32.399 0.05 40.42 C ANISOU 4534 CA GLN B 121 6737 3239 5384 -402 2260 1061 C ATOM 4535 C GLN B 121 24.437 72.360 31.264 0.05 43.34 C ANISOU 4535 C GLN B 121 7375 3774 5319 -121 2650 1056 C ATOM 4536 O GLN B 121 24.680 72.780 30.124 0.05 48.16 O ANISOU 4536 O GLN B 121 8169 4408 5720 -142 3123 1321 O ATOM 4537 CB GLN B 121 25.133 73.180 33.549 0.05 39.91 C ANISOU 4537 CB GLN B 121 6052 3263 5848 -551 2259 1004 C ATOM 4538 CG GLN B 121 24.678 73.844 34.872 0.05 38.09 C ANISOU 4538 CG GLN B 121 5658 2834 5979 -828 1853 983 C ATOM 4539 CD GLN B 121 25.638 74.900 35.402 0.05 41.92 C ANISOU 4539 CD GLN B 121 5730 3249 6948 -1187 1983 1211 C ATOM 4540 OE1 GLN B 121 26.830 74.893 35.086 0.05 45.90 O ANISOU 4540 OE1 GLN B 121 5913 3906 7622 -1232 2419 1404 O ATOM 4541 NE2 GLN B 121 25.117 75.817 36.220 0.05 41.45 N ANISOU 4541 NE2 GLN B 121 5675 2940 7136 -1441 1601 1188 N ATOM 4542 H GLN B 121 22.751 72.630 33.600 0.05 34.02 H ANISOU 4542 H GLN B 121 5927 2379 4619 -270 1596 688 H ATOM 4543 HA GLN B 121 24.209 74.237 32.054 0.05 42.51 H ANISOU 4543 HA GLN B 121 7098 3382 5673 -565 2353 1269 H ATOM 4544 HB2 GLN B 121 25.255 72.234 33.724 0.05 37.99 H ANISOU 4544 HB2 GLN B 121 5736 3117 5582 -384 2156 813 H ATOM 4545 HB3 GLN B 121 25.975 73.573 33.276 0.05 43.24 H ANISOU 4545 HB3 GLN B 121 6270 3759 6399 -622 2607 1170 H ATOM 4546 HG2 GLN B 121 23.822 74.278 34.740 0.05 37.49 H ANISOU 4546 HG2 GLN B 121 5888 2610 5747 -839 1715 1007 H ATOM 4547 HG3 GLN B 121 24.601 73.160 35.552 0.05 35.52 H ANISOU 4547 HG3 GLN B 121 5208 2551 5739 -764 1616 796 H ATOM 4548 HE21 GLN B 121 24.323 76.116 36.086 0.05 39.74 H ANISOU 4548 HE21 GLN B 121 5745 2594 6759 -1392 1405 1109 H ATOM 4549 HE22 GLN B 121 25.580 76.106 36.886 0.05 43.23 H ANISOU 4549 HE22 GLN B 121 5620 3122 7683 -1646 1541 1247 H TER 4550 GLN B 121 HETATM 4551 NI NI A 201 8.682 53.912 29.445 0.03 16.25 NI ANISOU 4551 NI NI A 201 2759 1121 2296 44 -321 513 NI HETATM 4552 NA NA A 202 7.726 32.465 39.988 0.02 9.08 NA ANISOU 4552 NA NA A 202 1409 424 1618 -71 2 -110 NA HETATM 4553 NI NI B 201 19.717 54.476 55.184 0.04 16.78 NI ANISOU 4553 NI NI B 201 3017 1032 2328 241 -370 -583 NI HETATM 4554 O HOH A 301 -1.430 39.377 32.905 0.05 15.36 O ANISOU 4554 O HOH A 301 1846 1504 2485 -131 -293 -126 O HETATM 4555 O HOH A 302 0.471 41.221 27.225 0.05 15.92 O ANISOU 4555 O HOH A 302 2209 1666 2172 -121 -482 -25 O HETATM 4556 O HOH A 303 0.443 48.889 37.075 0.05 14.68 O ANISOU 4556 O HOH A 303 1915 1154 2507 307 -260 84 O HETATM 4557 O HOH A 304 2.929 40.308 30.374 0.05 14.34 O ANISOU 4557 O HOH A 304 1989 1348 2112 -121 -319 -58 O HETATM 4558 O HOH A 305 -3.879 36.690 40.155 0.05 16.14 O ANISOU 4558 O HOH A 305 1825 1483 2823 -254 169 -141 O HETATM 4559 O HOH A 306 6.749 64.599 42.085 0.05 19.06 O ANISOU 4559 O HOH A 306 3024 835 3383 -159 -36 156 O HETATM 4560 O HOH A 307 -0.413 49.643 39.757 0.05 15.04 O ANISOU 4560 O HOH A 307 1905 1171 2638 365 -122 -9 O HETATM 4561 O HOH A 308 2.502 37.025 40.005 0.05 12.97 O ANISOU 4561 O HOH A 308 1808 922 2198 -114 92 -15 O HETATM 4562 O HOH A 309 4.335 55.390 40.772 0.05 15.30 O ANISOU 4562 O HOH A 309 2327 822 2664 384 -143 29 O HETATM 4563 O HOH A 310 3.545 33.524 38.770 0.05 13.56 O ANISOU 4563 O HOH A 310 1960 880 2313 -210 129 -54 O HETATM 4564 O HOH A 311 16.166 35.125 38.042 0.05 12.38 O ANISOU 4564 O HOH A 311 1854 749 2099 126 38 -46 O HETATM 4565 O HOH A 312 2.863 33.584 35.943 0.05 13.95 O ANISOU 4565 O HOH A 312 1950 1000 2350 -263 41 -151 O HETATM 4566 O HOH A 313 8.937 68.529 32.851 0.05 24.93 O ANISOU 4566 O HOH A 313 4460 870 4140 222 -260 745 O HETATM 4567 O HOH A 314 16.457 57.885 30.811 0.05 17.55 O ANISOU 4567 O HOH A 314 3048 1006 2615 -369 24 465 O HETATM 4568 O HOH A 315 6.382 58.397 54.489 0.05 19.72 O ANISOU 4568 O HOH A 315 3192 1432 2868 296 245 -785 O HETATM 4569 O HOH A 316 20.134 59.016 28.036 0.05 21.53 O ANISOU 4569 O HOH A 316 3806 1412 2961 -668 223 731 O HETATM 4570 O HOH A 317 18.916 59.303 30.376 0.05 19.27 O ANISOU 4570 O HOH A 317 3316 1145 2862 -575 153 497 O HETATM 4571 O HOH A 318 -3.380 40.987 35.561 0.05 15.77 O ANISOU 4571 O HOH A 318 1750 1558 2685 -32 -222 -106 O HETATM 4572 O HOH A 319 14.548 34.675 23.635 0.05 16.34 O ANISOU 4572 O HOH A 319 2562 1614 2034 -285 246 -433 O HETATM 4573 O HOH A 320 6.666 28.537 34.545 0.05 14.72 O ANISOU 4573 O HOH A 320 2231 860 2502 -269 143 -231 O HETATM 4574 O HOH A 321 -0.417 51.124 44.019 0.05 15.61 O ANISOU 4574 O HOH A 321 2043 1155 2734 433 29 -121 O HETATM 4575 O HOH A 322 8.503 70.048 55.345 0.05 36.76 O ANISOU 4575 O HOH A 322 7601 3059 3306 -635 1041 -527 O HETATM 4576 O HOH A 323 11.867 35.207 32.181 0.05 12.75 O ANISOU 4576 O HOH A 323 1971 878 1997 -98 65 -184 O HETATM 4577 O HOH A 324 12.503 57.548 29.039 0.05 18.99 O ANISOU 4577 O HOH A 324 3403 1210 2602 -220 -128 715 O HETATM 4578 O HOH A 325 0.747 56.313 54.268 0.05 20.32 O ANISOU 4578 O HOH A 325 2975 1666 3079 495 504 -719 O HETATM 4579 O HOH A 326 3.176 46.682 45.356 0.05 13.27 O ANISOU 4579 O HOH A 326 1922 953 2166 205 106 -76 O HETATM 4580 O HOH A 327 8.327 31.986 23.655 0.05 17.60 O ANISOU 4580 O HOH A 327 2720 1730 2238 -424 -6 -617 O HETATM 4581 O HOH A 328 0.083 39.316 30.539 0.05 15.36 O ANISOU 4581 O HOH A 328 1969 1530 2337 -157 -364 -124 O HETATM 4582 O HOH A 329 0.057 45.194 47.467 0.05 14.47 O ANISOU 4582 O HOH A 329 1971 1186 2343 186 256 -115 O HETATM 4583 O HOH A 330 0.941 33.105 25.598 0.05 17.63 O ANISOU 4583 O HOH A 330 2434 1884 2379 -432 -366 -431 O HETATM 4584 O HOH A 331 -4.586 49.317 31.729 0.05 18.73 O ANISOU 4584 O HOH A 331 2132 1829 3156 500 -596 147 O HETATM 4585 O HOH A 332 4.502 56.375 22.623 0.05 22.74 O ANISOU 4585 O HOH A 332 3854 2041 2747 232 -781 987 O HETATM 4586 O HOH A 333 21.642 37.211 37.784 0.05 13.71 O ANISOU 4586 O HOH A 333 1773 1081 2354 154 40 -136 O HETATM 4587 O HOH A 334 7.410 52.395 29.750 0.05 15.10 O ANISOU 4587 O HOH A 334 2517 1067 2152 33 -296 411 O HETATM 4588 O HOH A 335 9.471 29.858 26.643 0.05 17.11 O ANISOU 4588 O HOH A 335 2621 1402 2480 -387 95 -645 O HETATM 4589 O HOH A 336 7.567 36.829 24.206 0.05 16.43 O ANISOU 4589 O HOH A 336 2541 1726 1974 -338 -192 -303 O HETATM 4590 O HOH A 337 5.913 39.360 55.847 0.05 16.69 O ANISOU 4590 O HOH A 337 2899 1515 1929 59 303 254 O HETATM 4591 O HOH A 338 11.682 73.468 52.286 0.05 32.29 O ANISOU 4591 O HOH A 338 6793 1895 3582 -623 159 -831 O HETATM 4592 O HOH A 339 1.685 55.668 39.161 0.05 16.52 O ANISOU 4592 O HOH A 339 2412 957 2907 507 -215 87 O HETATM 4593 O HOH A 340 5.053 33.988 22.731 0.05 18.55 O ANISOU 4593 O HOH A 340 2750 2074 2226 -471 -321 -507 O HETATM 4594 O HOH A 341 6.999 61.842 41.279 0.05 18.76 O ANISOU 4594 O HOH A 341 3066 737 3324 400 -112 -52 O HETATM 4595 O HOH A 342 13.909 33.010 33.337 0.05 13.42 O ANISOU 4595 O HOH A 342 2059 872 2167 -47 141 -248 O HETATM 4596 O HOH A 343 2.321 39.758 24.347 0.05 17.52 O ANISOU 4596 O HOH A 343 2512 1997 2150 -249 -536 -132 O HETATM 4597 O HOH A 344 24.136 40.118 35.126 0.05 13.63 O ANISOU 4597 O HOH A 344 1744 1143 2292 17 86 -148 O HETATM 4598 O HOH A 345 12.584 66.716 32.134 0.05 27.51 O ANISOU 4598 O HOH A 345 5693 1700 3060 -156 508 63 O HETATM 4599 O HOH A 346 11.278 57.084 25.905 0.05 19.61 O ANISOU 4599 O HOH A 346 3517 1403 2530 -138 -245 803 O HETATM 4600 O HOH A 347 7.991 67.520 54.567 0.05 34.90 O ANISOU 4600 O HOH A 347 7143 2934 3184 -751 952 -86 O HETATM 4601 O HOH A 348 15.320 35.500 27.702 0.05 14.68 O ANISOU 4601 O HOH A 348 2267 1305 2006 -193 204 -318 O HETATM 4602 O HOH A 349 6.544 48.484 27.654 0.05 15.47 O ANISOU 4602 O HOH A 349 2494 1365 2020 -4 -392 342 O HETATM 4603 O HOH A 350 -1.242 44.487 45.177 0.05 14.93 O ANISOU 4603 O HOH A 350 1840 1290 2542 164 206 -106 O HETATM 4604 O HOH A 351 -2.326 46.585 28.046 0.05 18.25 O ANISOU 4604 O HOH A 351 2302 1952 2681 216 -750 192 O HETATM 4605 O HOH A 352 -2.033 50.531 29.268 0.05 19.08 O ANISOU 4605 O HOH A 352 2466 1926 2857 390 -802 331 O HETATM 4606 O HOH A 353 3.805 38.465 21.403 0.05 18.86 O ANISOU 4606 O HOH A 353 2805 2262 2100 -334 -548 -197 O HETATM 4607 O HOH A 354 1.888 33.762 30.248 0.05 15.64 O ANISOU 4607 O HOH A 354 2124 1410 2409 -370 -169 -334 O HETATM 4608 O HOH A 355 21.347 39.174 21.001 0.05 18.94 O ANISOU 4608 O HOH A 355 2886 2160 2149 -443 605 -346 O HETATM 4609 O HOH A 356 18.342 32.785 34.117 0.05 13.71 O ANISOU 4609 O HOH A 356 2033 839 2338 120 151 -194 O HETATM 4610 O HOH A 357 -2.257 51.718 39.946 0.05 16.63 O ANISOU 4610 O HOH A 357 2039 1318 2962 513 -183 -6 O HETATM 4611 O HOH A 358 6.209 38.405 22.243 0.05 17.83 O ANISOU 4611 O HOH A 358 2747 2042 1984 -356 -353 -245 O HETATM 4612 O HOH A 359 20.387 57.873 26.345 0.05 21.12 O ANISOU 4612 O HOH A 359 3266 2087 2670 29 146 1037 O HETATM 4613 O HOH A 360 -5.953 45.780 35.638 0.05 17.76 O ANISOU 4613 O HOH A 360 1825 1834 3090 279 -366 -47 O HETATM 4614 O HOH A 361 0.618 52.309 51.488 0.05 16.92 O ANISOU 4614 O HOH A 361 2461 1364 2603 362 346 -398 O HETATM 4615 O HOH A 362 10.850 48.927 21.281 0.05 19.00 O ANISOU 4615 O HOH A 362 3312 1989 1917 -287 -232 480 O HETATM 4616 O HOH A 363 0.317 38.310 47.157 0.05 14.87 O ANISOU 4616 O HOH A 363 2062 1220 2369 -97 397 35 O HETATM 4617 O HOH A 364 -1.538 53.285 45.713 0.05 17.08 O ANISOU 4617 O HOH A 364 2212 1290 2987 530 136 -242 O HETATM 4618 O HOH A 365 1.962 59.914 47.026 0.05 19.53 O ANISOU 4618 O HOH A 365 2867 1118 3437 649 111 -394 O HETATM 4619 O HOH A 366 8.019 61.319 52.434 0.05 20.42 O ANISOU 4619 O HOH A 366 3351 1236 3173 263 152 -808 O HETATM 4620 O HOH A 367 -0.159 46.760 44.570 0.05 14.31 O ANISOU 4620 O HOH A 367 1831 1147 2459 237 83 -78 O HETATM 4621 O HOH A 368 -1.532 54.293 40.777 0.05 17.34 O ANISOU 4621 O HOH A 368 2230 1246 3113 610 -148 -34 O HETATM 4622 O HOH A 369 12.055 49.741 19.116 0.05 20.68 O ANISOU 4622 O HOH A 369 3667 2253 1937 -384 -157 557 O HETATM 4623 O HOH A 370 -4.025 51.607 41.697 0.05 18.11 O ANISOU 4623 O HOH A 370 2029 1574 3279 591 -137 -84 O HETATM 4624 O HOH A 371 7.813 34.337 23.042 0.05 17.54 O ANISOU 4624 O HOH A 371 2703 1844 2117 -421 -129 -504 O HETATM 4625 O HOH A 372 5.310 61.270 45.957 0.05 18.77 O ANISOU 4625 O HOH A 372 3002 846 3285 436 1 -304 O HETATM 4626 O HOH A 373 -3.349 41.432 38.215 0.05 15.41 O ANISOU 4626 O HOH A 373 1711 1461 2684 2 -76 -99 O HETATM 4627 O HOH A 374 15.892 57.952 21.153 0.05 23.46 O ANISOU 4627 O HOH A 374 4308 1992 2613 -573 100 1008 O HETATM 4628 O HOH A 375 7.626 66.227 51.733 0.05 30.90 O ANISOU 4628 O HOH A 375 6136 2401 3203 -707 815 194 O HETATM 4629 O HOH A 376 3.932 71.048 37.692 0.05 29.31 O ANISOU 4629 O HOH A 376 4203 2132 4800 1212 -851 447 O HETATM 4630 O HOH A 377 -1.323 60.375 47.938 0.05 21.67 O ANISOU 4630 O HOH A 377 2903 1516 3815 828 302 -571 O HETATM 4631 O HOH A 378 5.790 60.547 40.070 0.05 18.28 O ANISOU 4631 O HOH A 378 2973 759 3214 417 -193 125 O HETATM 4632 O HOH A 379 17.462 60.160 24.048 0.05 23.80 O ANISOU 4632 O HOH A 379 4335 1713 2995 -681 212 991 O HETATM 4633 O HOH A 380 23.586 36.514 35.114 0.05 14.68 O ANISOU 4633 O HOH A 380 1833 1221 2522 154 153 -230 O HETATM 4634 O HOH A 381 7.363 34.897 39.514 0.05 12.34 O ANISOU 4634 O HOH A 381 1892 719 2078 -80 82 -2 O HETATM 4635 O HOH A 382 18.662 34.127 41.635 0.05 13.41 O ANISOU 4635 O HOH A 382 1969 852 2274 283 -66 50 O HETATM 4636 O HOH A 383 0.977 60.596 44.087 0.05 19.79 O ANISOU 4636 O HOH A 383 2880 1065 3574 722 -29 -209 O HETATM 4637 O HOH A 384 23.883 46.782 21.344 0.05 20.25 O ANISOU 4637 O HOH A 384 3107 2278 2307 -695 710 36 O HETATM 4638 O HOH A 385 6.389 50.436 30.352 0.05 14.70 O ANISOU 4638 O HOH A 385 2344 1129 2113 85 -358 337 O HETATM 4639 O HOH A 386 -4.004 55.336 41.629 0.05 19.57 O ANISOU 4639 O HOH A 386 2377 1483 3574 798 -190 -54 O HETATM 4640 O HOH A 387 -1.696 47.892 41.672 0.05 15.13 O ANISOU 4640 O HOH A 387 1846 1246 2656 319 -5 -73 O HETATM 4641 O HOH A 388 6.103 72.044 36.381 0.05 29.04 O ANISOU 4641 O HOH A 388 5107 1643 4285 1115 -845 717 O HETATM 4642 O HOH A 389 -0.080 56.491 40.151 0.05 17.64 O ANISOU 4642 O HOH A 389 2423 1120 3161 632 -189 15 O HETATM 4643 O HOH A 390 -4.032 53.613 44.186 0.05 18.67 O ANISOU 4643 O HOH A 390 2212 1529 3351 647 125 -261 O HETATM 4644 O HOH A 391 4.559 65.155 40.472 0.05 22.73 O ANISOU 4644 O HOH A 391 2999 1615 4025 -73 -248 81 O HETATM 4645 O HOH A 392 -0.517 45.775 50.736 0.05 16.11 O ANISOU 4645 O HOH A 392 2234 1460 2428 170 465 -187 O HETATM 4646 O HOH A 393 15.790 37.421 41.796 0.05 11.88 O ANISOU 4646 O HOH A 393 1837 724 1953 151 -55 66 O HETATM 4647 O HOH A 394 14.524 57.987 19.294 0.05 25.42 O ANISOU 4647 O HOH A 394 4731 2273 2655 -569 38 1176 O HETATM 4648 O HOH A 395 23.974 46.271 37.102 0.05 12.79 O ANISOU 4648 O HOH A 395 1957 948 1956 -38 51 80 O HETATM 4649 O HOH A 396 -1.109 39.888 38.819 0.05 14.23 O ANISOU 4649 O HOH A 396 1722 1236 2449 -59 -21 -72 O HETATM 4650 O HOH A 397 -6.251 51.863 37.950 0.05 19.15 O ANISOU 4650 O HOH A 397 2037 1774 3464 634 -278 -40 O HETATM 4651 O HOH A 398 10.934 34.045 37.069 0.05 12.28 O ANISOU 4651 O HOH A 398 1913 695 2057 -39 66 -66 O HETATM 4652 O HOH A 399 6.208 72.115 41.205 0.05 24.66 O ANISOU 4652 O HOH A 399 4035 1094 4241 994 -48 204 O HETATM 4653 O HOH A 400 0.653 46.424 53.265 0.05 16.89 O ANISOU 4653 O HOH A 400 2486 1587 2345 168 528 -231 O HETATM 4654 O HOH A 401 14.875 66.933 30.282 0.05 33.20 O ANISOU 4654 O HOH A 401 6728 2455 3433 -397 1314 -21 O HETATM 4655 O HOH B 301 10.527 33.987 43.796 0.05 13.68 O ANISOU 4655 O HOH B 301 1890 845 2460 -202 -142 60 O HETATM 4656 O HOH B 302 4.741 46.272 47.612 0.05 15.16 O ANISOU 4656 O HOH B 302 1858 1432 2470 348 104 151 O HETATM 4657 O HOH B 303 31.608 42.766 48.737 0.05 13.93 O ANISOU 4657 O HOH B 303 1781 1168 2342 -72 -243 23 O HETATM 4658 O HOH B 304 22.860 49.783 41.289 0.05 12.44 O ANISOU 4658 O HOH B 304 1945 704 2079 -119 -91 33 O HETATM 4659 O HOH B 305 25.561 41.067 55.271 0.05 13.41 O ANISOU 4659 O HOH B 305 2066 1109 1922 114 -264 -62 O HETATM 4660 O HOH B 306 12.902 34.111 47.784 0.05 12.93 O ANISOU 4660 O HOH B 306 1819 821 2271 -102 -32 107 O HETATM 4661 O HOH B 307 17.021 57.982 59.153 0.05 20.84 O ANISOU 4661 O HOH B 307 3883 1434 2603 621 -347 -897 O HETATM 4662 O HOH B 308 16.877 35.516 53.137 0.05 12.94 O ANISOU 4662 O HOH B 308 1945 923 2049 79 56 189 O HETATM 4663 O HOH B 309 28.171 38.687 45.090 0.05 12.31 O ANISOU 4663 O HOH B 309 1741 878 2058 92 -22 -27 O HETATM 4664 O HOH B 310 21.970 64.639 42.066 0.05 19.77 O ANISOU 4664 O HOH B 310 3095 713 3702 84 -96 -330 O HETATM 4665 O HOH B 311 15.212 66.885 51.918 0.05 30.63 O ANISOU 4665 O HOH B 311 6411 2036 3191 151 508 -113 O HETATM 4666 O HOH B 312 28.473 49.065 47.595 0.05 13.93 O ANISOU 4666 O HOH B 312 2003 914 2376 -245 -311 -73 O HETATM 4667 O HOH B 313 27.209 34.900 55.928 0.05 14.49 O ANISOU 4667 O HOH B 313 2127 1235 2143 261 -195 216 O HETATM 4668 O HOH B 314 29.077 49.640 44.998 0.05 14.24 O ANISOU 4668 O HOH B 314 1976 952 2481 -297 -232 36 O HETATM 4669 O HOH B 315 26.066 56.485 45.615 0.05 16.64 O ANISOU 4669 O HOH B 315 2644 741 2939 -358 -412 -56 O HETATM 4670 O HOH B 316 16.948 30.538 61.083 0.05 17.28 O ANISOU 4670 O HOH B 316 2591 1716 2260 308 137 633 O HETATM 4671 O HOH B 317 21.538 61.786 43.283 0.05 18.80 O ANISOU 4671 O HOH B 317 3135 654 3355 -248 -381 130 O HETATM 4672 O HOH B 318 10.778 36.039 58.375 0.05 16.30 O ANISOU 4672 O HOH B 318 2254 1705 2237 268 362 440 O HETATM 4673 O HOH B 319 29.976 53.896 33.169 0.05 18.54 O ANISOU 4673 O HOH B 319 2444 1663 2938 -346 232 725 O HETATM 4674 O HOH B 320 19.672 67.950 50.873 0.05 25.92 O ANISOU 4674 O HOH B 320 4816 751 4283 174 -770 -730 O HETATM 4675 O HOH B 321 16.953 29.200 56.330 0.05 15.73 O ANISOU 4675 O HOH B 321 2291 1134 2553 51 115 537 O HETATM 4676 O HOH B 322 15.857 32.883 49.828 0.05 13.00 O ANISOU 4676 O HOH B 322 1943 727 2269 -46 -12 134 O HETATM 4677 O HOH B 323 26.308 40.860 60.724 0.05 16.41 O ANISOU 4677 O HOH B 323 2592 1705 1940 272 -401 -42 O HETATM 4678 O HOH B 324 11.984 58.152 53.390 0.05 18.69 O ANISOU 4678 O HOH B 324 3306 1152 2645 731 -83 -548 O HETATM 4679 O HOH B 325 15.478 33.296 52.519 0.05 13.82 O ANISOU 4679 O HOH B 325 2013 973 2267 22 87 303 O HETATM 4680 O HOH B 326 22.488 35.606 45.859 0.05 11.69 O ANISOU 4680 O HOH B 326 1830 629 1982 74 -34 -67 O HETATM 4681 O HOH B 327 19.844 33.778 62.901 0.05 16.83 O ANISOU 4681 O HOH B 327 2597 1754 2045 367 12 440 O HETATM 4682 O HOH B 328 25.952 46.896 38.595 0.05 12.90 O ANISOU 4682 O HOH B 328 1895 929 2077 -99 33 102 O HETATM 4683 O HOH B 329 25.203 49.296 40.776 0.05 13.12 O ANISOU 4683 O HOH B 329 1965 836 2183 -165 -45 116 O HETATM 4684 O HOH B 330 29.804 47.544 43.203 0.05 14.23 O ANISOU 4684 O HOH B 330 1862 1080 2466 -252 -110 123 O HETATM 4685 O HOH B 331 25.672 40.408 62.200 0.05 17.98 O ANISOU 4685 O HOH B 331 2890 2017 1925 365 -434 -44 O HETATM 4686 O HOH B 332 13.444 36.212 61.015 0.05 17.43 O ANISOU 4686 O HOH B 332 2501 1885 2236 312 352 580 O HETATM 4687 O HOH B 333 13.486 41.063 67.348 0.05 20.82 O ANISOU 4687 O HOH B 333 3302 2696 1913 775 368 211 O HETATM 4688 O HOH B 334 26.872 34.753 60.781 0.05 16.51 O ANISOU 4688 O HOH B 334 2475 1683 2117 354 -279 308 O HETATM 4689 O HOH B 335 20.793 37.364 61.464 0.05 16.11 O ANISOU 4689 O HOH B 335 2545 1682 1893 359 -47 226 O HETATM 4690 O HOH B 336 32.807 36.355 42.539 0.05 14.74 O ANISOU 4690 O HOH B 336 1861 1318 2420 290 141 42 O HETATM 4691 O HOH B 337 28.006 62.304 34.202 0.05 21.99 O ANISOU 4691 O HOH B 337 3155 1389 3810 -587 -48 957 O HETATM 4692 O HOH B 338 18.070 32.416 45.420 0.05 12.35 O ANISOU 4692 O HOH B 338 1936 618 2140 46 -42 -7 O HETATM 4693 O HOH B 339 24.444 62.306 40.513 0.05 26.23 O ANISOU 4693 O HOH B 339 3401 1558 5008 574 114 -375 O HETATM 4694 O HOH B 340 10.427 36.375 49.175 0.05 13.28 O ANISOU 4694 O HOH B 340 1808 953 2285 -57 40 180 O HETATM 4695 O HOH B 341 21.167 39.479 63.034 0.05 17.06 O ANISOU 4695 O HOH B 341 2755 1885 1842 416 -140 108 O HETATM 4696 O HOH B 342 29.068 46.191 35.325 0.05 15.04 O ANISOU 4696 O HOH B 342 2066 1422 2227 -13 252 243 O HETATM 4697 O HOH B 343 29.398 45.246 41.085 0.05 13.21 O ANISOU 4697 O HOH B 343 1797 1022 2201 -104 21 91 O HETATM 4698 O HOH B 344 27.981 39.816 32.072 0.05 14.92 O ANISOU 4698 O HOH B 344 2152 1426 2089 224 292 -7 O HETATM 4699 O HOH B 345 15.457 35.441 41.311 0.05 12.46 O ANISOU 4699 O HOH B 345 1899 731 2104 178 -10 33 O HETATM 4700 O HOH B 346 11.820 33.673 56.866 0.05 16.47 O ANISOU 4700 O HOH B 346 2228 1520 2510 74 296 607 O HETATM 4701 O HOH B 347 9.675 60.946 57.677 0.05 22.90 O ANISOU 4701 O HOH B 347 4084 1637 2978 1173 22 -801 O HETATM 4702 O HOH B 348 28.027 39.677 55.610 0.05 14.09 O ANISOU 4702 O HOH B 348 2066 1240 2046 123 -331 -5 O HETATM 4703 O HOH B 349 27.974 55.781 30.598 0.05 19.47 O ANISOU 4703 O HOH B 349 2694 1750 2952 -301 253 866 O HETATM 4704 O HOH B 350 15.161 58.191 56.379 0.05 19.96 O ANISOU 4704 O HOH B 350 3681 1242 2662 636 -261 -778 O HETATM 4705 O HOH B 351 19.669 66.071 33.370 0.05 23.82 O ANISOU 4705 O HOH B 351 4177 1089 3785 -769 212 554 O HETATM 4706 O HOH B 352 19.826 61.096 32.708 0.05 19.20 O ANISOU 4706 O HOH B 352 3078 1114 3102 -93 -127 732 O HETATM 4707 O HOH B 353 22.329 75.527 41.195 0.05 29.45 O ANISOU 4707 O HOH B 353 4966 962 5262 -1043 -29 105 O HETATM 4708 O HOH B 354 28.375 35.684 58.559 0.05 15.67 O ANISOU 4708 O HOH B 354 2291 1520 2145 296 -312 224 O HETATM 4709 O HOH B 355 26.678 61.358 36.820 0.05 20.35 O ANISOU 4709 O HOH B 355 3039 1104 3588 -507 -159 692 O HETATM 4710 O HOH B 356 26.121 63.603 37.852 0.05 33.23 O ANISOU 4710 O HOH B 356 3933 2750 5942 828 1207 -275 O HETATM 4711 O HOH B 357 34.177 45.836 44.401 0.05 15.77 O ANISOU 4711 O HOH B 357 1778 1461 2751 -220 -116 205 O HETATM 4712 O HOH B 358 31.070 38.615 36.528 0.05 15.17 O ANISOU 4712 O HOH B 358 2059 1457 2248 276 309 6 O HETATM 4713 O HOH B 359 21.500 38.098 29.969 0.05 14.70 O ANISOU 4713 O HOH B 359 2017 1313 2258 -86 322 -276 O HETATM 4714 O HOH B 360 6.210 37.776 47.759 0.05 14.89 O ANISOU 4714 O HOH B 360 1763 1270 2625 -104 10 267 O HETATM 4715 O HOH B 361 12.745 58.179 62.883 0.05 25.14 O ANISOU 4715 O HOH B 361 4618 2240 2693 1266 0 -1064 O HETATM 4716 O HOH B 362 8.737 52.127 63.372 0.05 22.34 O ANISOU 4716 O HOH B 362 3679 2514 2294 1210 438 -455 O HETATM 4717 O HOH B 363 27.077 59.757 37.833 0.05 19.43 O ANISOU 4717 O HOH B 363 2827 1093 3463 -548 -173 574 O HETATM 4718 O HOH B 364 26.180 54.461 61.663 0.05 22.79 O ANISOU 4718 O HOH B 364 4091 1929 2640 194 -944 -1001 O HETATM 4719 O HOH B 365 5.635 40.131 49.442 0.05 14.92 O ANISOU 4719 O HOH B 365 1775 1389 2505 75 140 275 O HETATM 4720 O HOH B 366 36.070 47.807 50.235 0.05 17.68 O ANISOU 4720 O HOH B 366 1980 1651 3087 -400 -505 113 O HETATM 4721 O HOH B 367 30.065 43.001 58.160 0.05 16.12 O ANISOU 4721 O HOH B 367 2349 1556 2219 50 -585 -128 O HETATM 4722 O HOH B 368 24.935 48.885 63.970 0.05 19.99 O ANISOU 4722 O HOH B 368 3449 2011 2133 289 -692 -602 O HETATM 4723 O HOH B 369 25.839 39.335 37.454 0.05 13.65 O ANISOU 4723 O HOH B 369 2125 1130 1933 179 147 -132 O HETATM 4724 O HOH B 370 8.132 44.804 66.545 0.05 23.59 O ANISOU 4724 O HOH B 370 3545 3207 2210 1141 764 126 O HETATM 4725 O HOH B 371 23.079 27.970 55.346 0.05 15.80 O ANISOU 4725 O HOH B 371 2383 1055 2564 245 -24 462 O HETATM 4726 O HOH B 372 18.267 34.339 48.083 0.05 12.05 O ANISOU 4726 O HOH B 372 1863 643 2071 11 -32 26 O HETATM 4727 O HOH B 373 22.926 37.491 27.825 0.05 16.30 O ANISOU 4727 O HOH B 373 2180 1586 2427 -126 479 -392 O HETATM 4728 O HOH B 374 27.689 60.460 40.424 0.05 19.71 O ANISOU 4728 O HOH B 374 2936 958 3596 -590 -324 399 O HETATM 4729 O HOH B 375 30.535 53.210 53.048 0.05 17.81 O ANISOU 4729 O HOH B 375 2661 1201 2905 -405 -741 -324 O HETATM 4730 O HOH B 376 15.590 36.179 57.415 0.05 14.64 O ANISOU 4730 O HOH B 376 2177 1330 2054 203 163 318 O HETATM 4731 O HOH B 377 26.822 32.065 60.803 0.05 17.51 O ANISOU 4731 O HOH B 377 2627 1822 2203 418 -233 463 O HETATM 4732 O HOH B 378 28.779 60.786 35.948 0.05 21.31 O ANISOU 4732 O HOH B 378 2922 1357 3818 -701 -120 782 O HETATM 4733 O HOH B 379 16.415 30.982 52.793 0.05 14.28 O ANISOU 4733 O HOH B 379 2100 905 2420 -4 54 334 O HETATM 4734 O HOH B 380 25.219 50.079 26.710 0.05 18.69 O ANISOU 4734 O HOH B 380 2811 2067 2221 88 331 585 O HETATM 4735 O HOH B 381 25.139 59.435 45.638 0.05 17.83 O ANISOU 4735 O HOH B 381 2910 708 3156 -353 -472 -89 O HETATM 4736 O HOH B 382 28.468 38.465 37.438 0.05 13.83 O ANISOU 4736 O HOH B 382 2004 1168 2082 212 196 -74 O HETATM 4737 O HOH B 383 34.731 41.790 38.899 0.05 16.56 O ANISOU 4737 O HOH B 383 1903 1773 2617 161 331 235 O HETATM 4738 O HOH B 384 35.155 44.802 46.398 0.05 16.18 O ANISOU 4738 O HOH B 384 1796 1525 2826 -235 -249 169 O HETATM 4739 O HOH B 385 13.327 67.296 53.662 0.05 26.37 O ANISOU 4739 O HOH B 385 4974 1092 3952 879 -457 -954 O HETATM 4740 O HOH B 386 22.448 33.522 44.756 0.05 15.78 O ANISOU 4740 O HOH B 386 2196 1187 2615 504 -265 145 O HETATM 4741 O HOH B 387 13.528 37.284 43.289 0.05 12.07 O ANISOU 4741 O HOH B 387 1804 700 2083 -89 -130 -65 O HETATM 4742 O HOH B 388 8.406 33.922 52.564 0.05 15.81 O ANISOU 4742 O HOH B 388 1964 1365 2679 -86 199 480 O HETATM 4743 O HOH B 389 25.834 58.191 49.585 0.05 18.15 O ANISOU 4743 O HOH B 389 2984 841 3071 -343 -630 -341 O HETATM 4744 O HOH B 390 17.860 28.770 59.285 0.05 17.39 O ANISOU 4744 O HOH B 390 2545 1467 2594 176 156 742 O HETATM 4745 O HOH B 391 13.216 58.573 64.808 0.05 26.57 O ANISOU 4745 O HOH B 391 4957 2442 2698 1298 -88 -1206 O HETATM 4746 O HOH B 392 20.023 30.438 59.305 0.05 16.40 O ANISOU 4746 O HOH B 392 2452 1400 2380 233 78 594 O HETATM 4747 O HOH B 393 8.569 54.807 62.430 0.05 23.43 O ANISOU 4747 O HOH B 393 3982 2488 2434 1316 366 -647 O HETATM 4748 O HOH B 394 30.090 53.177 39.043 0.05 16.24 O ANISOU 4748 O HOH B 394 2175 1176 2821 -407 -50 362 O HETATM 4749 O HOH B 395 27.850 46.378 31.363 0.05 15.89 O ANISOU 4749 O HOH B 395 2290 1612 2135 69 310 265 O HETATM 4750 O HOH B 396 28.127 45.620 38.358 0.05 13.77 O ANISOU 4750 O HOH B 396 1915 1153 2164 -59 134 151 O HETATM 4751 O HOH B 397 33.008 44.739 36.365 0.05 15.82 O ANISOU 4751 O HOH B 397 1935 1588 2487 -17 276 280 O ENDMDL MODEL 2 HETATM 1 N MSE A 2 2.085 58.240 57.757 0.05 22.75 N ANISOU 1 N MSE A 2 3512 1966 3166 445 598 -1009 N HETATM 2 CA MSE A 2 2.900 57.429 56.835 0.05 21.47 C ANISOU 2 CA MSE A 2 3348 1822 2987 398 509 -898 C HETATM 3 C MSE A 2 2.986 55.954 57.350 0.05 21.09 C ANISOU 3 C MSE A 2 3302 1887 2827 356 531 -840 C HETATM 4 O MSE A 2 3.696 55.707 58.293 0.05 21.57 O ANISOU 4 O MSE A 2 3424 2004 2767 321 547 -877 O HETATM 5 CB MSE A 2 4.312 58.066 56.702 0.05 21.33 C ANISOU 5 CB MSE A 2 3399 1761 2946 352 428 -918 C HETATM 6 CG MSE A 2 5.404 57.294 55.890 0.05 20.14 C ANISOU 6 CG MSE A 2 3244 1621 2788 304 333 -817 C HETATM 7 SE MSE A 2 5.895 58.098 54.172 0.04 19.51 SE ANISOU 7 SE MSE A 2 3140 1421 2850 312 256 -756 SE HETATM 8 CE MSE A 2 4.079 58.070 53.719 0.05 19.36 C ANISOU 8 CE MSE A 2 3038 1416 2902 383 309 -707 C HETATM 9 HA MSE A 2 2.480 57.452 55.962 0.05 21.06 H ANISOU 9 HA MSE A 2 3249 1737 3018 425 489 -851 H HETATM 10 HB2 MSE A 2 4.213 58.930 56.276 0.05 21.67 H ANISOU 10 HB2 MSE A 2 3444 1726 3062 377 423 -953 H HETATM 11 HB3 MSE A 2 4.669 58.193 57.593 0.05 21.82 H ANISOU 11 HB3 MSE A 2 3506 1861 2924 327 442 -969 H HETATM 12 HG2 MSE A 2 6.215 57.247 56.422 0.05 20.23 H ANISOU 12 HG2 MSE A 2 3297 1659 2732 265 305 -837 H HETATM 13 HG3 MSE A 2 5.085 56.394 55.715 0.05 19.66 H ANISOU 13 HG3 MSE A 2 3153 1608 2710 304 341 -759 H HETATM 14 HE1 MSE A 2 3.681 58.838 54.133 0.05 19.91 H ANISOU 14 HE1 MSE A 2 3105 1514 2948 402 365 -756 H HETATM 15 HE2 MSE A 2 3.995 58.101 52.756 0.05 19.46 H ANISOU 15 HE2 MSE A 2 3033 1366 2995 416 297 -697 H HETATM 16 HE3 MSE A 2 3.682 57.265 54.078 0.05 18.71 H ANISOU 16 HE3 MSE A 2 2932 1380 2796 365 292 -645 H ATOM 17 N ASN A 3 2.232 55.014 56.766 0.05 20.41 N ANISOU 17 N ASN A 3 3149 1826 2779 361 533 -754 N ATOM 18 CA ASN A 3 2.303 53.563 57.126 0.05 19.95 C ANISOU 18 CA ASN A 3 3092 1852 2637 318 543 -678 C ATOM 19 C ASN A 3 3.726 52.959 57.495 0.05 19.34 C ANISOU 19 C ASN A 3 3075 1815 2457 261 472 -615 C ATOM 20 O ASN A 3 3.992 52.636 58.659 0.05 19.42 O ANISOU 20 O ASN A 3 3109 1892 2379 232 499 -573 O ATOM 21 CB ASN A 3 1.645 52.787 55.965 0.05 19.29 C ANISOU 21 CB ASN A 3 2921 1757 2651 336 535 -605 C ATOM 22 CG ASN A 3 0.176 53.214 55.726 0.05 20.01 C ANISOU 22 CG ASN A 3 2934 1838 2832 390 610 -652 C ATOM 23 OD1 ASN A 3 -0.285 54.201 56.271 0.05 20.69 O ANISOU 23 OD1 ASN A 3 3013 1871 2976 439 627 -725 O ATOM 24 ND2 ASN A 3 -0.527 52.500 54.865 0.05 19.95 N ANISOU 24 ND2 ASN A 3 2860 1876 2845 382 651 -610 N ATOM 25 H ASN A 3 1.673 55.179 56.135 0.05 20.24 H ANISOU 25 H ASN A 3 3081 1772 2838 391 527 -737 H ATOM 26 HA ASN A 3 1.737 53.425 57.899 0.05 20.59 H ANISOU 26 HA ASN A 3 3179 1974 2671 317 612 -710 H ATOM 27 HB2 ASN A 3 2.132 52.968 55.144 0.05 18.75 H ANISOU 27 HB2 ASN A 3 2845 1646 2632 341 473 -578 H ATOM 28 HB3 ASN A 3 1.659 51.835 56.162 0.05 19.02 H ANISOU 28 HB3 ASN A 3 2885 1766 2575 307 543 -557 H ATOM 29 HD21 ASN A 3 -0.932 51.788 55.128 0.05 20.18 H ANISOU 29 HD21 ASN A 3 2901 1951 2817 355 697 -606 H ATOM 30 HD22 ASN A 3 -0.584 52.749 54.046 0.05 19.73 H ANISOU 30 HD22 ASN A 3 2778 1831 2888 401 631 -586 H ATOM 31 N AILE A 4 4.557 52.878 56.447 0.03 18.83 N ANISOU 31 N AILE A 4 3030 1707 2420 251 385 -608 N ATOM 32 N BILE A 4 4.570 52.866 56.458 0.03 18.86 N ANISOU 32 N BILE A 4 3035 1711 2420 250 386 -610 N ATOM 33 CA AILE A 4 6.000 52.495 56.382 0.03 18.31 C ANISOU 33 CA AILE A 4 3001 1665 2292 210 304 -559 C ATOM 34 CA BILE A 4 6.010 52.455 56.427 0.03 18.34 C ANISOU 34 CA BILE A 4 3007 1670 2293 209 304 -561 C ATOM 35 C AILE A 4 6.238 51.376 55.369 0.03 17.33 C ANISOU 35 C AILE A 4 2836 1547 2203 200 268 -458 C ATOM 36 C BILE A 4 6.243 51.368 55.383 0.03 17.35 C ANISOU 36 C BILE A 4 2839 1549 2203 200 268 -459 C ATOM 37 O AILE A 4 7.235 51.372 54.663 0.03 16.72 O ANISOU 37 O AILE A 4 2752 1445 2156 186 196 -425 O ATOM 38 O BILE A 4 7.242 51.369 54.680 0.03 16.74 O ANISOU 38 O BILE A 4 2757 1449 2155 186 196 -426 O ATOM 39 CB AILE A 4 6.687 52.097 57.747 0.03 19.00 C ANISOU 39 CB AILE A 4 3159 1826 2232 180 308 -579 C ATOM 40 CB BILE A 4 6.635 51.956 57.772 0.03 19.01 C ANISOU 40 CB BILE A 4 3164 1829 2231 179 306 -581 C ATOM 41 CG1AILE A 4 6.982 53.324 58.617 0.03 20.01 C ANISOU 41 CG1AILE A 4 3335 1946 2321 181 328 -693 C ATOM 42 CG1BILE A 4 7.062 53.135 58.623 0.03 19.94 C ANISOU 42 CG1BILE A 4 3332 1936 2307 174 305 -691 C ATOM 43 CG2AILE A 4 7.993 51.276 57.492 0.03 18.54 C ANISOU 43 CG2AILE A 4 3124 1795 2124 149 213 -521 C ATOM 44 CG2BILE A 4 7.882 51.047 57.499 0.03 18.42 C ANISOU 44 CG2BILE A 4 3103 1783 2114 151 218 -505 C ATOM 45 CD1AILE A 4 7.153 54.655 57.873 0.03 19.90 C ANISOU 45 CD1AILE A 4 3312 1848 2403 185 279 -744 C ATOM 46 CD1BILE A 4 7.193 52.792 60.080 0.03 21.09 C ANISOU 46 CD1BILE A 4 3523 2133 2359 179 395 -760 C ATOM 47 H AILE A 4 4.268 53.101 55.673 0.05 18.84 H ANISOU 47 H AILE A 4 3017 1656 2484 269 372 -631 H ATOM 48 H BILE A 4 4.298 53.092 55.678 0.05 18.88 H ANISOU 48 H BILE A 4 3025 1663 2485 268 372 -635 H ATOM 49 HA AILE A 4 6.480 53.242 56.010 0.05 18.22 H ANISOU 49 HA AILE A 4 2995 1613 2313 206 260 -581 H ATOM 50 HA BILE A 4 6.534 53.221 56.156 0.05 18.28 H ANISOU 50 HA BILE A 4 3006 1622 2316 205 261 -586 H ATOM 51 HB AILE A 4 6.084 51.525 58.242 0.05 19.20 H ANISOU 51 HB AILE A 4 3186 1889 2221 181 360 -558 H ATOM 52 HB BILE A 4 5.986 51.433 58.265 0.05 19.32 H ANISOU 52 HB BILE A 4 3207 1905 2230 182 363 -570 H ATOM 53 HG12AILE A 4 6.262 53.431 59.256 0.05 20.48 H ANISOU 53 HG12AILE A 4 3388 2009 2385 201 399 -727 H ATOM 54 HG12BILE A 4 7.933 53.435 58.318 0.05 19.96 H ANISOU 54 HG12BILE A 4 3364 1957 2262 149 246 -690 H ATOM 55 HG13AILE A 4 7.809 53.162 59.099 0.05 20.39 H ANISOU 55 HG13AILE A 4 3431 2040 2277 158 305 -704 H ATOM 56 HG13BILE A 4 6.414 53.848 58.524 0.05 19.88 H ANISOU 56 HG13BILE A 4 3303 1869 2382 191 304 -723 H ATOM 57 HG21AILE A 4 8.588 51.794 56.927 0.05 18.80 H ANISOU 57 HG21AILE A 4 3179 1819 2144 137 173 -568 H ATOM 58 HG21BILE A 4 8.351 50.889 58.331 0.05 18.93 H ANISOU 58 HG21BILE A 4 3213 1888 2090 136 201 -522 H ATOM 59 HG22AILE A 4 8.422 51.091 58.340 0.05 18.81 H ANISOU 59 HG22AILE A 4 3188 1880 2078 140 223 -495 H ATOM 60 HG22BILE A 4 7.596 50.197 57.129 0.05 18.04 H ANISOU 60 HG22BILE A 4 3034 1746 2073 153 230 -443 H ATOM 61 HG23AILE A 4 7.779 50.436 57.062 0.05 17.83 H ANISOU 61 HG23AILE A 4 2998 1683 2094 151 185 -469 H ATOM 62 HG23BILE A 4 8.471 51.499 56.876 0.05 18.03 H ANISOU 62 HG23BILE A 4 3033 1695 2121 148 169 -506 H ATOM 63 HD11AILE A 4 6.302 54.931 57.500 0.05 19.71 H ANISOU 63 HD11AILE A 4 3249 1776 2465 214 304 -740 H ATOM 64 HD11BILE A 4 7.897 53.332 60.467 0.05 21.67 H ANISOU 64 HD11BILE A 4 3622 2185 2425 179 396 -839 H ATOM 65 HD12AILE A 4 7.467 55.324 58.491 0.05 20.62 H ANISOU 65 HD12AILE A 4 3441 1937 2457 179 287 -818 H ATOM 66 HD12BILE A 4 6.349 52.972 60.523 0.05 21.12 H ANISOU 66 HD12BILE A 4 3490 2129 2405 202 458 -755 H ATOM 67 HD13AILE A 4 7.800 54.531 57.164 0.05 19.40 H ANISOU 67 HD13AILE A 4 3244 1780 2347 164 215 -705 H ATOM 68 HD13BILE A 4 7.419 51.852 60.163 0.05 21.29 H ANISOU 68 HD13BILE A 4 3585 2217 2288 158 388 -731 H ATOM 69 N ILE A 5 5.303 50.446 55.292 0.05 17.29 N ANISOU 69 N ILE A 5 2801 1571 2197 205 323 -417 N ATOM 70 CA ILE A 5 5.517 49.233 54.533 0.05 16.54 C ANISOU 70 CA ILE A 5 2679 1485 2120 189 297 -329 C ATOM 71 C ILE A 5 4.283 48.897 53.735 0.05 16.36 C ANISOU 71 C ILE A 5 2585 1448 2183 207 340 -311 C ATOM 72 O ILE A 5 3.172 48.929 54.230 0.05 16.98 O ANISOU 72 O ILE A 5 2637 1540 2272 222 414 -348 O ATOM 73 CB ILE A 5 6.025 48.101 55.471 0.05 16.82 C ANISOU 73 CB ILE A 5 2763 1578 2049 163 312 -286 C ATOM 74 CG1 ILE A 5 5.738 46.719 54.870 0.05 16.19 C ANISOU 74 CG1 ILE A 5 2657 1495 1999 149 299 -201 C ATOM 75 CG2 ILE A 5 5.489 48.267 56.912 0.05 17.74 C ANISOU 75 CG2 ILE A 5 2899 1735 2104 161 408 -319 C ATOM 76 CD1 ILE A 5 6.656 45.600 55.367 0.05 16.28 C ANISOU 76 CD1 ILE A 5 2725 1536 1925 131 265 -144 C ATOM 77 H AILE A 5 4.530 50.502 55.656 0.05 17.74 H ANISOU 77 H AILE A 5 2851 1642 2247 215 380 -442 H ATOM 78 H BILE A 5 4.526 50.507 55.647 0.05 17.73 H ANISOU 78 H BILE A 5 2850 1640 2248 215 380 -442 H ATOM 79 HA ILE A 5 6.214 49.376 53.885 0.05 16.05 H ANISOU 79 HA ILE A 5 2614 1402 2083 184 240 -309 H ATOM 80 HB ILE A 5 6.983 48.207 55.527 0.05 16.91 H ANISOU 80 HB ILE A 5 2814 1600 2011 155 268 -293 H ATOM 81 HG12 ILE A 5 4.825 46.468 55.075 0.05 16.35 H ANISOU 81 HG12 ILE A 5 2652 1522 2037 146 353 -193 H ATOM 82 HG13 ILE A 5 5.861 46.774 53.910 0.05 15.63 H ANISOU 82 HG13 ILE A 5 2557 1395 1989 155 257 -191 H ATOM 83 HG21 ILE A 5 4.544 48.050 56.923 0.05 17.75 H ANISOU 83 HG21 ILE A 5 2853 1726 2165 171 453 -326 H ATOM 84 HG22 ILE A 5 5.971 47.670 57.503 0.05 17.91 H ANISOU 84 HG22 ILE A 5 2953 1787 2064 142 419 -276 H ATOM 85 HG23 ILE A 5 5.613 49.176 57.217 0.05 18.22 H ANISOU 85 HG23 ILE A 5 2991 1803 2130 167 413 -375 H ATOM 86 HD11 ILE A 5 6.950 45.076 54.605 0.05 15.85 H ANISOU 86 HD11 ILE A 5 2651 1467 1905 126 250 -97 H ATOM 87 HD12 ILE A 5 7.419 45.995 55.818 0.05 16.28 H ANISOU 87 HD12 ILE A 5 2747 1538 1900 134 212 -160 H ATOM 88 HD13 ILE A 5 6.165 45.030 55.979 0.05 16.86 H ANISOU 88 HD13 ILE A 5 2831 1638 1935 122 310 -140 H ATOM 89 N AARG A 6 4.498 48.636 52.457 0.02 15.59 N ANISOU 89 N AARG A 6 2449 1323 2150 205 290 -261 N ATOM 90 N BARG A 6 4.495 48.650 52.455 0.03 15.59 N ANISOU 90 N BARG A 6 2451 1325 2148 203 291 -259 N ATOM 91 CA AARG A 6 3.467 48.071 51.598 0.02 15.39 C ANISOU 91 CA AARG A 6 2356 1297 2194 209 313 -230 C ATOM 92 CA BARG A 6 3.467 48.067 51.606 0.03 15.40 C ANISOU 92 CA BARG A 6 2358 1298 2194 209 313 -231 C ATOM 93 C AARG A 6 3.842 46.647 51.255 0.02 14.89 C ANISOU 93 C AARG A 6 2298 1250 2110 175 295 -162 C ATOM 94 C BARG A 6 3.857 46.645 51.279 0.03 14.89 C ANISOU 94 C BARG A 6 2296 1249 2112 175 295 -162 C ATOM 95 O AARG A 6 4.777 46.415 50.508 0.02 14.29 O ANISOU 95 O AARG A 6 2231 1154 2044 167 232 -130 O ATOM 96 O BARG A 6 4.814 46.415 50.569 0.03 14.27 O ANISOU 96 O BARG A 6 2225 1151 2047 168 232 -130 O ATOM 97 CB AARG A 6 3.293 48.873 50.310 0.02 15.06 C ANISOU 97 CB AARG A 6 2268 1209 2246 238 268 -231 C ATOM 98 CB BARG A 6 3.260 48.842 50.305 0.03 15.11 C ANISOU 98 CB BARG A 6 2279 1213 2247 239 268 -237 C ATOM 99 CG AARG A 6 2.101 48.427 49.472 0.02 15.01 C ANISOU 99 CG AARG A 6 2185 1212 2307 244 281 -207 C ATOM 100 CG BARG A 6 1.982 48.428 49.592 0.03 14.83 C ANISOU 100 CG BARG A 6 2177 1179 2280 242 259 -200 C ATOM 101 CD AARG A 6 1.955 49.255 48.209 0.02 14.88 C ANISOU 101 CD AARG A 6 2131 1155 2370 279 229 -203 C ATOM 102 CD BARG A 6 1.968 48.775 48.114 0.03 14.50 C ANISOU 102 CD BARG A 6 2122 1091 2297 264 193 -187 C ATOM 103 NE AARG A 6 1.320 50.548 48.460 0.02 15.54 N ANISOU 103 NE AARG A 6 2209 1206 2491 328 249 -258 N ATOM 104 NE BARG A 6 1.686 50.177 47.885 0.03 15.09 N ANISOU 104 NE BARG A 6 2177 1129 2427 315 202 -230 N ATOM 105 CZ AARG A 6 1.452 51.625 47.690 0.02 15.63 C ANISOU 105 CZ AARG A 6 2224 1159 2554 364 204 -262 C ATOM 106 CZ BARG A 6 2.299 50.953 46.994 0.03 15.10 C ANISOU 106 CZ BARG A 6 2158 1086 2492 346 155 -214 C ATOM 107 NH1AARG A 6 0.835 52.732 48.054 0.02 16.36 N ANISOU 107 NH1AARG A 6 2317 1215 2685 412 231 -317 N ATOM 108 NH1BARG A 6 1.913 52.200 46.918 0.03 15.77 N ANISOU 108 NH1BARG A 6 2229 1131 2633 400 166 -252 N ATOM 109 NH2AARG A 6 2.215 51.620 46.625 0.02 15.09 N ANISOU 109 NH2AARG A 6 2165 1066 2503 353 138 -211 N ATOM 110 NH2BARG A 6 3.294 50.532 46.215 0.03 14.53 N ANISOU 110 NH2BARG A 6 2085 1010 2425 325 99 -160 N ATOM 111 H AARG A 6 5.238 48.790 52.059 0.05 15.23 H ANISOU 111 H AARG A 6 2415 1262 2109 199 242 -247 H ATOM 112 H BARG A 6 5.227 48.824 52.052 0.05 15.22 H ANISOU 112 H BARG A 6 2417 1265 2102 196 243 -243 H ATOM 113 HA AARG A 6 2.619 48.049 52.063 0.05 15.87 H ANISOU 113 HA AARG A 6 2399 1378 2255 215 370 -251 H ATOM 114 HA BARG A 6 2.624 48.035 52.080 0.05 15.88 H ANISOU 114 HA BARG A 6 2400 1379 2256 215 370 -252 H ATOM 115 HB2AARG A 6 3.167 49.804 50.537 0.05 15.43 H ANISOU 115 HB2AARG A 6 2317 1236 2312 264 278 -273 H ATOM 116 HB2BARG A 6 3.206 49.787 50.505 0.05 15.56 H ANISOU 116 HB2BARG A 6 2330 1256 2325 266 290 -280 H ATOM 117 HB3AARG A 6 4.088 48.771 49.764 0.05 14.60 H ANISOU 117 HB3AARG A 6 2227 1135 2187 227 219 -207 H ATOM 118 HB3BARG A 6 4.001 48.672 49.705 0.05 14.75 H ANISOU 118 HB3BARG A 6 2261 1149 2195 231 221 -225 H ATOM 119 HG2AARG A 6 2.214 47.500 49.210 0.05 14.66 H ANISOU 119 HG2AARG A 6 2141 1181 2249 217 270 -169 H ATOM 120 HG2BARG A 6 1.858 47.472 49.685 0.05 14.50 H ANISOU 120 HG2BARG A 6 2140 1153 2218 214 251 -165 H ATOM 121 HG3AARG A 6 1.295 48.528 49.998 0.05 15.52 H ANISOU 121 HG3AARG A 6 2223 1296 2377 252 334 -231 H ATOM 122 HG3BARG A 6 1.239 48.890 50.015 0.05 15.26 H ANISOU 122 HG3BARG A 6 2191 1246 2361 257 300 -220 H ATOM 123 HD2AARG A 6 2.839 49.419 47.851 0.05 14.46 H ANISOU 123 HD2AARG A 6 2105 1081 2308 268 184 -181 H ATOM 124 HD2BARG A 6 2.828 48.574 47.716 0.05 14.23 H ANISOU 124 HD2BARG A 6 2127 1041 2237 251 163 -180 H ATOM 125 HD3AARG A 6 1.420 48.767 47.567 0.05 14.89 H ANISOU 125 HD3AARG A 6 2082 1169 2407 280 229 -187 H ATOM 126 HD3BARG A 6 1.277 48.254 47.677 0.05 14.27 H ANISOU 126 HD3BARG A 6 2059 1067 2294 258 175 -158 H ATOM 127 HE AARG A 6 0.734 50.582 49.087 0.05 16.00 H ANISOU 127 HE AARG A 6 2250 1282 2547 338 297 -288 H ATOM 128 HE BARG A 6 1.184 50.574 48.461 0.05 15.47 H ANISOU 128 HE BARG A 6 2242 1176 2459 324 234 -268 H ATOM 129 HH11AARG A 6 0.342 52.730 48.757 0.05 16.77 H ANISOU 129 HH11AARG A 6 2362 1286 2723 418 280 -354 H ATOM 130 HH11BARG A 6 1.282 52.483 47.426 0.05 16.19 H ANISOU 130 HH11BARG A 6 2283 1188 2680 413 207 -293 H ATOM 131 HH12AARG A 6 0.903 53.445 47.580 0.05 16.49 H ANISOU 131 HH12AARG A 6 2340 1186 2740 436 203 -317 H ATOM 132 HH12BARG A 6 2.294 52.729 46.361 0.05 15.86 H ANISOU 132 HH12BARG A 6 2232 1109 2685 424 133 -237 H ATOM 133 HH21AARG A 6 2.628 50.901 46.388 0.05 14.66 H ANISOU 133 HH21AARG A 6 2111 1033 2425 324 123 -181 H ATOM 134 HH21BARG A 6 3.565 49.717 46.227 0.05 14.13 H ANISOU 134 HH21BARG A 6 2044 983 2343 294 94 -139 H ATOM 135 HH22AARG A 6 2.290 52.334 46.150 0.05 15.22 H ANISOU 135 HH22AARG A 6 2190 1043 2551 374 113 -209 H ATOM 136 HH22BARG A 6 3.649 51.078 45.665 0.05 14.60 H ANISOU 136 HH22BARG A 6 2086 993 2467 344 68 -145 H ATOM 137 N LYS A 7 3.089 45.708 51.796 0.05 15.26 N ANISOU 137 N LYS A 7 2338 1328 2133 153 357 -143 N ATOM 138 CA LYS A 7 3.320 44.323 51.518 0.05 14.97 C ANISOU 138 CA LYS A 7 2309 1294 2087 119 351 -81 C ATOM 139 C LYS A 7 2.805 44.089 50.096 0.05 14.49 C ANISOU 139 C LYS A 7 2179 1211 2116 118 322 -68 C ATOM 140 O LYS A 7 1.802 44.667 49.676 0.05 14.70 O ANISOU 140 O LYS A 7 2143 1239 2202 136 339 -98 O ATOM 141 CB LYS A 7 2.674 43.436 52.595 0.05 15.68 C ANISOU 141 CB LYS A 7 2413 1414 2131 88 436 -63 C ATOM 142 CG LYS A 7 3.296 43.618 53.966 0.05 16.40 C ANISOU 142 CG LYS A 7 2574 1538 2117 87 476 -79 C ATOM 143 CD LYS A 7 4.682 42.976 54.111 0.05 16.28 C ANISOU 143 CD LYS A 7 2642 1525 2021 82 419 -33 C ATOM 144 CE LYS A 7 4.589 41.451 54.076 0.05 16.74 C ANISOU 144 CE LYS A 7 2747 1590 2024 49 459 36 C ATOM 145 NZ LYS A 7 5.898 40.760 53.990 0.05 16.57 N ANISOU 145 NZ LYS A 7 2788 1562 1946 62 378 80 N ATOM 146 H ALYS A 7 2.426 45.845 52.319 0.05 15.75 H ANISOU 146 H ALYS A 7 2392 1407 2185 155 407 -166 H ATOM 147 H BLYS A 7 2.414 45.846 52.303 0.05 15.75 H ANISOU 147 H BLYS A 7 2394 1407 2184 155 407 -166 H ATOM 148 HA LYS A 7 4.274 44.169 51.521 0.05 14.72 H ANISOU 148 HA LYS A 7 2316 1255 2022 117 310 -60 H ATOM 149 HB2 LYS A 7 1.738 43.673 52.672 0.05 15.93 H ANISOU 149 HB2 LYS A 7 2393 1453 2207 87 477 -84 H ATOM 150 HB3 LYS A 7 2.751 42.506 52.329 0.05 15.53 H ANISOU 150 HB3 LYS A 7 2408 1385 2106 66 428 -19 H ATOM 151 HG2 LYS A 7 3.384 44.564 54.157 0.05 16.53 H ANISOU 151 HG2 LYS A 7 2587 1558 2136 110 476 -128 H ATOM 152 HG3 LYS A 7 2.716 43.197 54.625 0.05 16.92 H ANISOU 152 HG3 LYS A 7 2640 1623 2164 66 541 -71 H ATOM 153 HD2 LYS A 7 5.249 43.262 53.379 0.05 15.70 H ANISOU 153 HD2 LYS A 7 2555 1427 1983 90 361 -19 H ATOM 154 HD3 LYS A 7 5.070 43.239 54.961 0.05 16.59 H ANISOU 154 HD3 LYS A 7 2717 1583 2005 93 414 -61 H ATOM 155 HE2 LYS A 7 4.149 41.146 54.887 0.05 17.40 H ANISOU 155 HE2 LYS A 7 2857 1702 2053 37 516 28 H ATOM 156 HE3 LYS A 7 4.072 41.185 53.303 0.05 16.54 H ANISOU 156 HE3 LYS A 7 2687 1544 2053 32 473 59 H ATOM 157 HZ1 LYS A 7 5.857 39.977 54.404 0.05 16.98 H ANISOU 157 HZ1 LYS A 7 2882 1618 1951 49 396 123 H ATOM 158 HZ2 LYS A 7 6.103 40.620 53.135 0.05 16.03 H ANISOU 158 HZ2 LYS A 7 2694 1468 1928 68 336 92 H ATOM 159 HZ3 LYS A 7 6.533 41.251 54.369 0.05 16.67 H ANISOU 159 HZ3 LYS A 7 2821 1593 1922 76 353 51 H HETATM 160 N MSE A 8 3.545 43.312 49.316 0.05 13.94 N ANISOU 160 N MSE A 8 2121 1123 2054 102 275 -27 N HETATM 161 CA MSE A 8 3.072 43.083 47.970 0.05 13.63 C ANISOU 161 CA MSE A 8 2023 1072 2084 96 250 -21 C HETATM 162 C MSE A 8 1.806 42.242 47.982 0.05 14.06 C ANISOU 162 C MSE A 8 2032 1141 2169 63 306 -16 C HETATM 163 O MSE A 8 1.690 41.308 48.766 0.05 14.36 O ANISOU 163 O MSE A 8 2104 1180 2170 31 350 11 O HETATM 164 CB MSE A 8 4.125 42.432 47.095 0.05 13.04 C ANISOU 164 CB MSE A 8 1969 975 2011 86 194 11 C HETATM 165 CG MSE A 8 3.658 42.180 45.646 0.05 12.82 C ANISOU 165 CG MSE A 8 1890 941 2041 72 169 13 C HETATM 166 SE MSE A 8 3.236 43.765 44.498 0.04 12.76 SE ANISOU 166 SE MSE A 8 1830 933 2087 110 120 -13 SE HETATM 167 CE MSE A 8 5.132 44.277 44.201 0.05 12.17 C ANISOU 167 CE MSE A 8 1817 831 1975 115 65 4 C HETATM 168 HA MSE A 8 2.859 43.939 47.556 0.05 13.61 H ANISOU 168 HA MSE A 8 1992 1065 2113 119 233 -43 H HETATM 169 HB2 MSE A 8 4.908 43.002 47.050 0.05 12.81 H ANISOU 169 HB2 MSE A 8 1956 938 1974 103 160 4 H HETATM 170 HB3 MSE A 8 4.367 41.574 47.473 0.05 13.09 H ANISOU 170 HB3 MSE A 8 2006 978 1989 71 204 34 H HETATM 171 HG2 MSE A 8 4.374 41.713 45.198 0.05 12.52 H ANISOU 171 HG2 MSE A 8 1872 891 1997 64 143 30 H HETATM 172 HG3 MSE A 8 2.862 41.622 45.678 0.05 13.10 H ANISOU 172 HG3 MSE A 8 1901 985 2093 52 202 14 H HETATM 173 HE1 MSE A 8 5.291 44.388 43.250 0.05 11.96 H ANISOU 173 HE1 MSE A 8 1784 802 1959 104 41 16 H HETATM 174 HE2 MSE A 8 5.336 45.093 44.676 0.05 12.22 H ANISOU 174 HE2 MSE A 8 1829 827 1985 134 53 -7 H HETATM 175 HE3 MSE A 8 5.694 43.556 44.530 0.05 12.13 H ANISOU 175 HE3 MSE A 8 1841 827 1940 106 77 12 H ATOM 176 N ASP A 9 0.829 42.605 47.158 0.05 14.21 N ANISOU 176 N ASP A 9 1974 1170 2254 70 302 -40 N ATOM 177 CA ASP A 9 -0.315 41.707 46.907 0.05 14.62 C ANISOU 177 CA ASP A 9 1965 1238 2351 30 338 -40 C ATOM 178 C ASP A 9 -0.260 41.475 45.424 0.05 14.23 C ANISOU 178 C ASP A 9 1881 1180 2346 26 269 -37 C ATOM 179 O ASP A 9 -0.607 42.335 44.652 0.05 14.26 O ANISOU 179 O ASP A 9 1837 1194 2388 60 228 -55 O ATOM 180 CB ASP A 9 -1.628 42.385 47.362 0.05 15.39 C ANISOU 180 CB ASP A 9 1989 1371 2489 43 397 -82 C ATOM 181 CG ASP A 9 -2.856 41.505 47.141 0.05 15.89 C ANISOU 181 CG ASP A 9 1957 1457 2622 5 413 -95 C ATOM 182 OD1 ASP A 9 -2.704 40.449 46.495 0.05 15.64 O ANISOU 182 OD1 ASP A 9 1934 1412 2599 -38 388 -73 O ATOM 183 OD2 ASP A 9 -3.967 41.820 47.638 0.05 16.61 O ANISOU 183 OD2 ASP A 9 1966 1584 2764 12 456 -132 O ATOM 184 H ASP A 9 0.818 43.321 46.692 0.05 14.12 H ANISOU 184 H ASP A 9 1943 1156 2265 97 273 -55 H ATOM 185 HA ASP A 9 -0.203 40.865 47.368 0.05 14.72 H ANISOU 185 HA ASP A 9 2009 1245 2340 -3 369 -18 H ATOM 186 HB2 ASP A 9 -1.575 42.568 48.314 0.05 15.73 H ANISOU 186 HB2 ASP A 9 2058 1422 2495 33 452 -83 H ATOM 187 HB3 ASP A 9 -1.748 43.217 46.871 0.05 15.36 H ANISOU 187 HB3 ASP A 9 1967 1365 2502 85 370 -102 H ATOM 188 N TRP A 10 0.205 40.292 45.017 0.05 13.97 N ANISOU 188 N TRP A 10 1875 1127 2306 -14 254 -12 N ATOM 189 CA TRP A 10 0.438 40.097 43.623 0.05 13.70 C ANISOU 189 CA TRP A 10 1815 1091 2300 -20 191 -17 C ATOM 190 C TRP A 10 -0.811 39.995 42.780 0.05 14.24 C ANISOU 190 C TRP A 10 1796 1188 2426 -47 189 -44 C ATOM 191 O TRP A 10 -0.658 39.928 41.587 0.05 14.14 O ANISOU 191 O TRP A 10 1770 1177 2426 -66 140 -49 O ATOM 192 CB TRP A 10 1.185 38.782 43.387 0.05 13.41 C ANISOU 192 CB TRP A 10 1828 1022 2246 -55 182 4 C ATOM 193 CG TRP A 10 2.513 38.674 44.026 0.05 13.10 C ANISOU 193 CG TRP A 10 1865 954 2159 -41 190 33 C ATOM 194 CD1 TRP A 10 2.829 37.895 45.101 0.05 13.38 C ANISOU 194 CD1 TRP A 10 1943 967 2172 -62 237 59 C ATOM 195 CD2 TRP A 10 3.724 39.329 43.655 0.05 12.58 C ANISOU 195 CD2 TRP A 10 1839 878 2061 -7 145 43 C ATOM 196 NE1 TRP A 10 4.142 38.010 45.399 0.05 13.08 N ANISOU 196 NE1 TRP A 10 1967 910 2092 -37 217 85 N ATOM 197 CE2 TRP A 10 4.725 38.879 44.528 0.05 12.58 C ANISOU 197 CE2 TRP A 10 1898 857 2024 -4 162 71 C ATOM 198 CE3 TRP A 10 4.069 40.248 42.672 0.05 12.21 C ANISOU 198 CE3 TRP A 10 1786 839 2015 20 94 34 C ATOM 199 CZ2 TRP A 10 6.034 39.321 44.459 0.05 12.23 C ANISOU 199 CZ2 TRP A 10 1892 805 1950 24 126 81 C ATOM 200 CZ3 TRP A 10 5.405 40.679 42.603 0.05 11.86 C ANISOU 200 CZ3 TRP A 10 1784 781 1939 39 69 45 C ATOM 201 CH2 TRP A 10 6.347 40.229 43.501 0.05 11.87 C ANISOU 201 CH2 TRP A 10 1830 768 1911 41 83 65 C ATOM 202 H TRP A 10 0.379 39.634 45.535 0.05 14.01 H ANISOU 202 H TRP A 10 1916 1119 2289 -34 280 5 H ATOM 203 HA TRP A 10 0.975 40.814 43.271 0.05 13.44 H ANISOU 203 HA TRP A 10 1786 1057 2262 12 151 -18 H ATOM 204 HB2 TRP A 10 0.642 38.079 43.767 0.05 13.76 H ANISOU 204 HB2 TRP A 10 1857 1063 2309 -91 214 1 H ATOM 205 HB3 TRP A 10 1.301 38.648 42.437 0.05 13.20 H ANISOU 205 HB3 TRP A 10 1794 996 2225 -52 139 -2 H ATOM 206 HD1 TRP A 10 2.235 37.331 45.549 0.05 13.79 H ANISOU 206 HD1 TRP A 10 1983 1017 2238 -93 278 61 H ATOM 207 HE1 TRP A 10 4.544 37.600 46.042 0.05 13.25 H ANISOU 207 HE1 TRP A 10 2025 917 2092 -40 235 108 H ATOM 208 HE3 TRP A 10 3.436 40.540 42.068 0.05 12.28 H ANISOU 208 HE3 TRP A 10 1761 860 2044 23 76 22 H ATOM 209 HZ2 TRP A 10 6.669 39.017 45.065 0.05 12.32 H ANISOU 209 HZ2 TRP A 10 1938 806 1938 30 131 101 H ATOM 210 HZ3 TRP A 10 5.668 41.286 41.951 0.05 11.67 H ANISOU 210 HZ3 TRP A 10 1760 759 1916 50 40 41 H ATOM 211 HH2 TRP A 10 7.228 40.534 43.426 0.05 11.70 H ANISOU 211 HH2 TRP A 10 1827 743 1873 55 62 69 H ATOM 212 N ASP A 11 -1.977 39.845 43.399 0.05 14.90 N ANISOU 212 N ASP A 11 1822 1297 2541 -59 246 -63 N ATOM 213 CA ASP A 11 -3.251 39.750 42.668 0.05 15.53 C ANISOU 213 CA ASP A 11 1798 1417 2686 -73 233 -96 C ATOM 214 C ASP A 11 -3.796 41.123 42.271 0.05 15.81 C ANISOU 214 C ASP A 11 1770 1481 2755 -3 201 -117 C ATOM 215 O ASP A 11 -4.440 41.272 41.215 0.05 16.37 O ANISOU 215 O ASP A 11 1748 1589 2882 3 164 -141 O ATOM 216 CB ASP A 11 -4.280 38.963 43.514 0.05 16.29 C ANISOU 216 CB ASP A 11 1849 1525 2813 -136 318 -110 C ATOM 217 CG ASP A 11 -5.637 38.810 42.836 0.05 17.08 C ANISOU 217 CG ASP A 11 1827 1673 2989 -162 303 -152 C ATOM 218 OD1 ASP A 11 -5.654 38.263 41.715 0.05 17.03 O ANISOU 218 OD1 ASP A 11 1805 1669 2997 -191 240 -161 O ATOM 219 OD2 ASP A 11 -6.669 39.208 43.426 0.05 17.83 O ANISOU 219 OD2 ASP A 11 1840 1805 3127 -157 356 -179 O ATOM 220 H ASP A 11 -2.063 39.798 44.252 0.05 15.05 H ANISOU 220 H ASP A 11 1859 1315 2544 -59 293 -59 H ATOM 221 HA ASP A 11 -3.088 39.264 41.846 0.05 15.41 H ANISOU 221 HA ASP A 11 1778 1400 2677 -90 187 -98 H ATOM 222 HB2 ASP A 11 -3.917 38.075 43.628 0.05 16.15 H ANISOU 222 HB2 ASP A 11 1877 1480 2779 -176 331 -94 H ATOM 223 HB3 ASP A 11 -4.405 39.374 44.383 0.05 16.48 H ANISOU 223 HB3 ASP A 11 1882 1555 2826 -124 371 -110 H ATOM 224 N SER A 12 -3.453 42.110 43.097 0.05 15.48 N ANISOU 224 N SER A 12 1783 1418 2680 50 207 -107 N ATOM 225 CA SER A 12 -3.983 43.471 42.905 0.05 15.79 C ANISOU 225 CA SER A 12 1782 1465 2754 123 182 -125 C ATOM 226 C SER A 12 -3.070 44.341 42.055 0.05 15.45 C ANISOU 226 C SER A 12 1755 1407 2711 160 83 -103 C ATOM 227 O SER A 12 -3.142 45.586 42.112 0.05 15.90 O ANISOU 227 O SER A 12 1765 1466 2810 221 41 -110 O ATOM 228 CB SER A 12 -4.206 44.185 44.241 0.05 15.73 C ANISOU 228 CB SER A 12 1832 1433 2710 159 235 -134 C ATOM 229 OG SER A 12 -2.964 44.615 44.774 0.05 14.97 O ANISOU 229 OG SER A 12 1836 1299 2552 162 206 -106 O ATOM 230 H SER A 12 -2.902 42.034 43.752 0.05 15.13 H ANISOU 230 H SER A 12 1800 1353 2596 45 223 -92 H ATOM 231 HA SER A 12 -4.835 43.419 42.451 0.05 16.40 H ANISOU 231 HA SER A 12 1782 1570 2878 127 196 -149 H ATOM 232 HB2 SER A 12 -4.778 44.949 44.080 0.05 16.07 H ANISOU 232 HB2 SER A 12 1843 1477 2786 206 226 -153 H ATOM 233 HB3 SER A 12 -4.637 43.584 44.871 0.05 15.99 H ANISOU 233 HB3 SER A 12 1864 1480 2732 132 298 -144 H ATOM 234 HG SER A 12 -2.988 44.588 45.611 0.05 14.97 H ANISOU 234 HG SER A 12 1870 1294 2522 158 243 -110 H HETATM 235 N MSE A 13 -2.238 43.740 41.242 0.05 14.79 N ANISOU 235 N MSE A 13 1737 1304 2579 127 48 -75 N HETATM 236 CA MSE A 13 -1.438 44.419 40.237 0.05 14.46 C ANISOU 236 CA MSE A 13 1733 1245 2516 152 -30 -48 C HETATM 237 C MSE A 13 -2.423 44.796 39.102 0.05 15.09 C ANISOU 237 C MSE A 13 1738 1358 2638 178 -97 -51 C HETATM 238 O MSE A 13 -3.369 44.103 38.789 0.05 15.62 O ANISOU 238 O MSE A 13 1727 1467 2743 152 -98 -75 O HETATM 239 CB MSE A 13 -0.299 43.484 39.773 0.05 13.85 C ANISOU 239 CB MSE A 13 1718 1157 2389 101 -43 -30 C HETATM 240 CG MSE A 13 0.924 43.201 40.844 0.05 13.31 C ANISOU 240 CG MSE A 13 1724 1055 2279 93 2 -19 C HETATM 241 SE MSE A 13 2.100 42.132 39.787 0.05 12.75 SE ANISOU 241 SE MSE A 13 1712 968 2163 44 -15 -3 SE HETATM 242 CE MSE A 13 3.035 43.610 39.186 0.05 12.26 C ANISOU 242 CE MSE A 13 1718 877 2065 79 -41 19 C HETATM 243 H MSE A 13 -2.078 42.896 41.255 0.05 14.56 H ANISOU 243 H MSE A 13 1737 1269 2528 91 73 -70 H HETATM 244 HA MSE A 13 -1.051 45.214 40.622 0.05 14.31 H ANISOU 244 HA MSE A 13 1749 1201 2489 184 -30 -41 H HETATM 245 HB2 MSE A 13 -0.735 42.628 39.627 0.05 14.02 H ANISOU 245 HB2 MSE A 13 1712 1195 2422 65 -30 -43 H HETATM 246 HB3 MSE A 13 0.077 43.774 38.938 0.05 13.76 H ANISOU 246 HB3 MSE A 13 1722 1143 2362 109 -90 -16 H HETATM 247 HG2 MSE A 13 1.379 44.023 41.065 0.05 13.19 H ANISOU 247 HG2 MSE A 13 1734 1022 2255 124 -9 -13 H HETATM 248 HG3 MSE A 13 0.635 42.735 41.635 0.05 13.46 H ANISOU 248 HG3 MSE A 13 1734 1077 2302 81 48 -29 H HETATM 249 HE1 MSE A 13 2.462 44.071 38.571 0.05 12.28 H ANISOU 249 HE1 MSE A 13 1721 883 2064 84 -77 28 H HETATM 250 HE2 MSE A 13 3.223 44.171 39.955 0.05 12.38 H ANISOU 250 HE2 MSE A 13 1729 885 2088 104 -29 15 H HETATM 251 HE3 MSE A 13 3.862 43.344 38.756 0.05 11.99 H ANISOU 251 HE3 MSE A 13 1716 831 2009 66 -28 24 H ATOM 252 N VAL A 14 -2.152 45.955 38.500 0.05 15.14 N ANISOU 252 N VAL A 14 1770 1343 2640 229 -156 -24 N ATOM 253 CA VAL A 14 -2.947 46.558 37.454 0.05 15.83 C ANISOU 253 CA VAL A 14 1801 1458 2755 265 -236 -12 C ATOM 254 C VAL A 14 -2.303 46.226 36.107 0.05 15.57 C ANISOU 254 C VAL A 14 1825 1430 2660 237 -300 21 C ATOM 255 O VAL A 14 -1.125 46.486 35.899 0.05 15.00 O ANISOU 255 O VAL A 14 1840 1320 2540 228 -296 49 O ATOM 256 CB VAL A 14 -2.903 48.096 37.640 0.05 16.42 C ANISOU 256 CB VAL A 14 1856 1503 2881 354 -258 -3 C ATOM 257 CG1 VAL A 14 -3.379 48.830 36.393 0.05 17.14 C ANISOU 257 CG1 VAL A 14 1919 1610 2982 399 -362 33 C ATOM 258 CG2 VAL A 14 -3.650 48.562 38.891 0.05 16.99 C ANISOU 258 CG2 VAL A 14 1839 1594 3021 378 -196 -52 C ATOM 259 H VAL A 14 -1.456 46.405 38.696 0.05 14.84 H ANISOU 259 H VAL A 14 1783 1273 2581 242 -153 -10 H ATOM 260 HA VAL A 14 -3.860 46.237 37.474 0.05 16.23 H ANISOU 260 HA VAL A 14 1784 1546 2834 248 -235 -36 H ATOM 261 HB VAL A 14 -1.985 48.333 37.794 0.05 16.08 H ANISOU 261 HB VAL A 14 1875 1415 2818 366 -243 11 H ATOM 262 HG11 VAL A 14 -3.822 49.644 36.677 0.05 17.61 H ANISOU 262 HG11 VAL A 14 1960 1647 3084 460 -373 37 H ATOM 263 HG12 VAL A 14 -2.606 49.044 35.849 0.05 16.84 H ANISOU 263 HG12 VAL A 14 1945 1558 2894 384 -393 66 H ATOM 264 HG13 VAL A 14 -3.998 48.278 35.891 0.05 17.50 H ANISOU 264 HG13 VAL A 14 1901 1706 3043 382 -385 16 H ATOM 265 HG21 VAL A 14 -3.645 49.529 38.920 0.05 17.57 H ANISOU 265 HG21 VAL A 14 1877 1660 3140 438 -221 -52 H ATOM 266 HG22 VAL A 14 -4.565 48.235 38.861 0.05 17.19 H ANISOU 266 HG22 VAL A 14 1808 1662 3060 343 -189 -72 H ATOM 267 HG23 VAL A 14 -3.205 48.209 39.678 0.05 16.63 H ANISOU 267 HG23 VAL A 14 1831 1526 2962 367 -136 -65 H ATOM 268 N HIS A 15 -3.063 45.621 35.209 0.05 16.07 N ANISOU 268 N HIS A 15 1834 1547 2724 214 -353 11 N ATOM 269 CA HIS A 15 -2.586 45.338 33.880 0.05 16.06 C ANISOU 269 CA HIS A 15 1879 1565 2658 184 -415 33 C ATOM 270 C HIS A 15 -2.559 46.611 33.032 0.05 16.58 C ANISOU 270 C HIS A 15 1969 1623 2707 246 -495 86 C ATOM 271 O HIS A 15 -3.611 47.186 32.763 0.05 17.45 O ANISOU 271 O HIS A 15 2008 1761 2860 297 -554 91 O ATOM 272 CB HIS A 15 -3.467 44.236 33.229 0.05 16.57 C ANISOU 272 CB HIS A 15 1875 1694 2727 131 -445 -8 C ATOM 273 CG HIS A 15 -2.854 43.662 32.000 0.05 16.52 C ANISOU 273 CG HIS A 15 1926 1708 2641 84 -488 -3 C ATOM 274 ND1 HIS A 15 -1.867 42.692 32.050 0.05 15.84 N ANISOU 274 ND1 HIS A 15 1903 1599 2515 25 -433 -21 N ATOM 275 CD2 HIS A 15 -3.064 43.921 30.687 0.05 17.16 C ANISOU 275 CD2 HIS A 15 2014 1833 2671 89 -579 15 C ATOM 276 CE1 HIS A 15 -1.486 42.412 30.820 0.05 16.04 C ANISOU 276 CE1 HIS A 15 1972 1653 2471 -5 -480 -20 C ATOM 277 NE2 HIS A 15 -2.202 43.131 29.972 0.05 16.84 N ANISOU 277 NE2 HIS A 15 2044 1798 2557 29 -569 2 N ATOM 278 H HIS A 15 -3.869 45.367 35.353 0.05 16.49 H ANISOU 278 H HIS A 15 1822 1629 2815 212 -353 -13 H ATOM 279 HA HIS A 15 -1.685 45.012 33.926 0.05 15.48 H ANISOU 279 HA HIS A 15 1867 1469 2546 156 -385 39 H ATOM 280 HB2 HIS A 15 -3.597 43.531 33.872 0.05 16.35 H ANISOU 280 HB2 HIS A 15 1830 1662 2722 96 -390 -37 H ATOM 281 HB3 HIS A 15 -4.322 44.615 32.983 0.05 17.24 H ANISOU 281 HB3 HIS A 15 1895 1809 2846 160 -489 -11 H ATOM 282 HD2 HIS A 15 -3.673 44.528 30.337 0.05 17.76 H ANISOU 282 HD2 HIS A 15 2057 1933 2760 129 -637 33 H ATOM 283 HE1 HIS A 15 -0.837 41.789 30.591 0.05 15.75 H ANISOU 283 HE1 HIS A 15 1977 1607 2401 -42 -455 -35 H ATOM 284 N GLU A 16 -1.344 47.008 32.669 0.05 16.13 N ANISOU 284 N GLU A 16 2010 1528 2590 238 -493 125 N ATOM 285 CA GLU A 16 -1.080 48.222 31.864 0.05 16.64 C ANISOU 285 CA GLU A 16 2124 1571 2628 286 -558 188 C ATOM 286 C GLU A 16 0.084 48.005 30.892 0.05 16.26 C ANISOU 286 C GLU A 16 2174 1516 2488 236 -555 218 C ATOM 287 O GLU A 16 1.079 47.392 31.227 0.05 15.49 O ANISOU 287 O GLU A 16 2112 1406 2369 186 -491 194 O ATOM 288 CB GLU A 16 -0.824 49.492 32.747 0.05 16.75 C ANISOU 288 CB GLU A 16 2150 1514 2701 356 -539 211 C ATOM 289 CG GLU A 16 0.388 49.524 33.686 0.05 15.90 C ANISOU 289 CG GLU A 16 2086 1356 2599 332 -453 189 C ATOM 290 CD GLU A 16 0.196 50.581 34.829 0.05 16.11 C ANISOU 290 CD GLU A 16 2135 1310 2678 393 -435 202 C ATOM 291 OE1 GLU A 16 -0.980 50.931 35.071 0.05 16.98 O ANISOU 291 OE1 GLU A 16 2219 1403 2831 462 -489 229 O ATOM 292 OE2 GLU A 16 1.153 50.892 35.577 0.05 15.50 O ANISOU 292 OE2 GLU A 16 2098 1192 2599 371 -370 180 O ATOM 293 H GLU A 16 -0.623 46.588 32.861 0.05 15.59 H ANISOU 293 H GLU A 16 1981 1445 2496 205 -454 118 H ATOM 294 HA GLU A 16 -1.868 48.409 31.337 0.05 17.30 H ANISOU 294 HA GLU A 16 2169 1693 2714 305 -619 196 H ATOM 295 HB2 GLU A 16 -0.717 50.240 32.136 0.05 17.09 H ANISOU 295 HB2 GLU A 16 2239 1533 2722 379 -578 258 H ATOM 296 HB3 GLU A 16 -1.621 49.633 33.278 0.05 17.17 H ANISOU 296 HB3 GLU A 16 2137 1577 2811 394 -548 193 H ATOM 297 HG2 GLU A 16 0.474 48.644 34.097 0.05 15.63 H ANISOU 297 HG2 GLU A 16 2013 1342 2583 311 -414 149 H ATOM 298 HG3 GLU A 16 1.188 49.732 33.179 0.05 15.53 H ANISOU 298 HG3 GLU A 16 2096 1302 2502 295 -444 204 H ATOM 299 N TYR A 17 -0.030 48.549 29.676 0.05 16.93 N ANISOU 299 N TYR A 17 2302 1613 2517 249 -625 272 N ATOM 300 CA TYR A 17 1.001 48.391 28.674 0.05 16.75 C ANISOU 300 CA TYR A 17 2370 1593 2402 198 -614 299 C ATOM 301 C TYR A 17 1.473 46.969 28.609 0.05 16.41 C ANISOU 301 C TYR A 17 2315 1606 2313 126 -589 239 C ATOM 302 O TYR A 17 2.672 46.687 28.647 0.05 16.08 O ANISOU 302 O TYR A 17 2334 1564 2211 77 -550 235 O ATOM 303 CB TYR A 17 2.189 49.294 28.956 0.05 16.15 C ANISOU 303 CB TYR A 17 2364 1441 2331 191 -546 322 C ATOM 304 CG TYR A 17 1.736 50.733 28.939 0.05 16.71 C ANISOU 304 CG TYR A 17 2463 1445 2440 256 -575 383 C ATOM 305 CD1 TYR A 17 1.611 51.417 27.759 0.05 17.27 C ANISOU 305 CD1 TYR A 17 2620 1485 2457 255 -600 457 C ATOM 306 CD2 TYR A 17 1.404 51.396 30.114 0.05 16.81 C ANISOU 306 CD2 TYR A 17 2420 1422 2546 319 -573 366 C ATOM 307 CE1 TYR A 17 1.181 52.766 27.742 0.05 17.95 C ANISOU 307 CE1 TYR A 17 2738 1497 2583 315 -630 517 C ATOM 308 CE2 TYR A 17 0.968 52.691 30.116 0.05 17.47 C ANISOU 308 CE2 TYR A 17 2530 1434 2673 384 -600 416 C ATOM 309 CZ TYR A 17 0.854 53.374 28.918 0.05 18.03 C ANISOU 309 CZ TYR A 17 2692 1466 2693 383 -631 494 C ATOM 310 OH TYR A 17 0.425 54.712 28.856 0.05 18.84 O ANISOU 310 OH TYR A 17 2837 1483 2837 445 -660 554 O ATOM 311 H TYR A 17 -0.726 48.978 29.417 0.05 17.55 H ANISOU 311 H TYR A 17 2358 1703 2608 288 -678 294 H ATOM 312 HA TYR A 17 0.622 48.622 27.816 0.05 17.40 H ANISOU 312 HA TYR A 17 2476 1691 2445 213 -671 340 H ATOM 313 HB2 TYR A 17 2.564 49.097 29.830 0.05 15.57 H ANISOU 313 HB2 TYR A 17 2269 1351 2296 183 -496 286 H ATOM 314 HB3 TYR A 17 2.857 49.173 28.263 0.05 16.10 H ANISOU 314 HB3 TYR A 17 2407 1442 2266 153 -534 335 H ATOM 315 HD1 TYR A 17 1.831 50.993 26.977 0.05 17.29 H ANISOU 315 HD1 TYR A 17 2660 1516 2393 212 -597 467 H ATOM 316 HD2 TYR A 17 1.467 50.941 30.925 0.05 16.52 H ANISOU 316 HD2 TYR A 17 2327 1406 2544 317 -551 320 H ATOM 317 HE1 TYR A 17 1.104 53.221 26.935 0.05 18.39 H ANISOU 317 HE1 TYR A 17 2858 1529 2601 310 -645 572 H ATOM 318 HE2 TYR A 17 0.753 53.116 30.914 0.05 17.60 H ANISOU 318 HE2 TYR A 17 2508 1427 2753 429 -595 397 H ATOM 319 HH TYR A 17 0.426 55.042 29.629 0.05 19.26 H ANISOU 319 HH TYR A 17 2847 1539 2933 498 -695 552 H ATOM 320 N ASP A 18 0.467 46.109 28.620 0.05 16.61 N ANISOU 320 N ASP A 18 2259 1676 2376 120 -610 189 N ATOM 321 CA ASP A 18 0.611 44.709 28.302 0.05 16.45 C ANISOU 321 CA ASP A 18 2223 1698 2328 52 -589 126 C ATOM 322 C ASP A 18 1.465 43.971 29.315 0.05 15.47 C ANISOU 322 C ASP A 18 2116 1531 2231 17 -490 88 C ATOM 323 O ASP A 18 2.019 42.909 29.018 0.05 15.29 O ANISOU 323 O ASP A 18 2113 1521 2175 -38 -459 46 O ATOM 324 CB ASP A 18 1.116 44.562 26.854 0.05 16.98 C ANISOU 324 CB ASP A 18 2352 1815 2287 13 -632 135 C ATOM 325 CG ASP A 18 0.128 45.143 25.848 0.05 18.15 C ANISOU 325 CG ASP A 18 2476 2022 2398 43 -745 166 C ATOM 326 OD1 ASP A 18 0.357 45.043 24.626 0.05 18.72 O ANISOU 326 OD1 ASP A 18 2614 2133 2368 22 -786 191 O ATOM 327 OD2 ASP A 18 -0.906 45.656 26.306 0.05 18.58 O ANISOU 327 OD2 ASP A 18 2444 2091 2524 86 -792 161 O ATOM 328 H ASP A 18 -0.341 46.330 28.805 0.05 16.91 H ANISOU 328 H ASP A 18 2246 1720 2460 154 -635 189 H ATOM 329 HA ASP A 18 -0.266 44.307 28.343 0.05 16.77 H ANISOU 329 HA ASP A 18 2200 1768 2405 54 -613 99 H ATOM 330 HB2 ASP A 18 1.958 45.031 26.767 0.05 16.79 H ANISOU 330 HB2 ASP A 18 2389 1766 2225 11 -609 167 H ATOM 331 HB3 ASP A 18 1.248 43.624 26.646 0.05 16.88 H ANISOU 331 HB3 ASP A 18 2332 1821 2261 -32 -611 86 H ATOM 332 N LEU A 19 1.517 44.494 30.526 0.05 14.97 N ANISOU 332 N LEU A 19 2043 1416 2227 50 -445 100 N ATOM 333 CA LEU A 19 2.185 43.843 31.626 0.05 14.20 C ANISOU 333 CA LEU A 19 1954 1282 2158 28 -364 71 C ATOM 334 C LEU A 19 1.413 44.065 32.901 0.05 14.11 C ANISOU 334 C LEU A 19 1887 1252 2222 61 -337 61 C ATOM 335 O LEU A 19 0.440 44.816 32.922 0.05 14.63 O ANISOU 335 O LEU A 19 1906 1329 2324 104 -377 73 O ATOM 336 CB LEU A 19 3.623 44.329 31.700 0.05 13.69 C ANISOU 336 CB LEU A 19 1964 1181 2058 22 -327 96 C ATOM 337 CG LEU A 19 3.791 45.849 31.772 0.05 13.63 C ANISOU 337 CG LEU A 19 1995 1130 2054 59 -328 145 C ATOM 338 CD1 LEU A 19 3.380 46.403 33.145 0.05 13.50 C ANISOU 338 CD1 LEU A 19 1944 1079 2105 102 -310 141 C ATOM 339 CD2 LEU A 19 5.234 46.204 31.460 0.05 13.15 C ANISOU 339 CD2 LEU A 19 1989 1044 1963 28 -277 146 C ATOM 340 H LEU A 19 1.143 45.232 30.756 0.05 15.13 H ANISOU 340 H LEU A 19 2053 1422 2272 89 -462 125 H ATOM 341 HA LEU A 19 2.195 42.888 31.453 0.05 14.19 H ANISOU 341 HA LEU A 19 1943 1298 2149 -9 -353 38 H ATOM 342 HB2 LEU A 19 4.047 43.952 32.486 0.05 13.27 H ANISOU 342 HB2 LEU A 19 1912 1111 2020 7 -283 75 H ATOM 343 HB3 LEU A 19 4.089 44.029 30.909 0.05 13.88 H ANISOU 343 HB3 LEU A 19 2014 1225 2033 -2 -341 97 H ATOM 344 HG LEU A 19 3.236 46.254 31.090 0.05 14.09 H ANISOU 344 HG LEU A 19 2066 1198 2088 71 -370 174 H ATOM 345 HD11 LEU A 19 3.588 47.353 33.164 0.05 13.52 H ANISOU 345 HD11 LEU A 19 1977 1049 2110 121 -310 166 H ATOM 346 HD12 LEU A 19 2.431 46.291 33.286 0.05 13.86 H ANISOU 346 HD12 LEU A 19 1948 1141 2176 124 -337 137 H ATOM 347 HD13 LEU A 19 3.880 45.947 33.838 0.05 13.10 H ANISOU 347 HD13 LEU A 19 1887 1022 2069 88 -269 116 H ATOM 348 HD21 LEU A 19 5.362 46.168 30.499 0.05 13.36 H ANISOU 348 HD21 LEU A 19 2043 1088 1943 6 -286 156 H ATOM 349 HD22 LEU A 19 5.408 47.097 31.794 0.05 13.09 H ANISOU 349 HD22 LEU A 19 1997 1003 1971 46 -270 167 H ATOM 350 HD23 LEU A 19 5.828 45.572 31.899 0.05 12.79 H ANISOU 350 HD23 LEU A 19 1931 997 1933 14 -243 117 H ATOM 351 N ASP A 20 1.835 43.402 33.968 0.05 13.58 N ANISOU 351 N ASP A 20 1823 1158 2178 42 -271 38 N ATOM 352 CA ASP A 20 1.198 43.527 35.255 0.05 13.56 C ANISOU 352 CA ASP A 20 1779 1142 2231 65 -231 26 C ATOM 353 C ASP A 20 2.062 44.396 36.139 0.05 13.14 C ANISOU 353 C ASP A 20 1770 1044 2178 96 -198 45 C ATOM 354 O ASP A 20 3.249 44.154 36.296 0.05 12.64 O ANISOU 354 O ASP A 20 1757 958 2087 77 -169 48 O ATOM 355 CB ASP A 20 0.959 42.150 35.880 0.05 13.48 C ANISOU 355 CB ASP A 20 1745 1134 2240 19 -180 -8 C ATOM 356 CG ASP A 20 -0.140 41.461 35.192 0.05 14.05 C ANISOU 356 CG ASP A 20 1761 1248 2328 -14 -210 -37 C ATOM 357 OD1 ASP A 20 -1.053 42.063 34.641 0.05 14.64 O ANISOU 357 OD1 ASP A 20 1781 1360 2423 10 -264 -37 O ATOM 358 OD2 ASP A 20 -0.153 40.162 35.137 0.05 14.03 O ANISOU 358 OD2 ASP A 20 1766 1240 2322 -69 -182 -65 O ATOM 359 H ASP A 20 2.531 42.915 33.975 0.05 13.27 H ANISOU 359 H ASP A 20 1815 1109 2119 19 -246 32 H ATOM 360 HA ASP A 20 0.330 43.925 35.163 0.05 14.00 H ANISOU 360 HA ASP A 20 1790 1216 2314 89 -258 25 H ATOM 361 HB2 ASP A 20 1.762 41.621 35.836 0.05 13.13 H ANISOU 361 HB2 ASP A 20 1743 1073 2172 -2 -159 -9 H ATOM 362 HB3 ASP A 20 0.683 42.259 36.797 0.05 13.49 H ANISOU 362 HB3 ASP A 20 1728 1129 2270 32 -147 -13 H ATOM 363 N GLY A 21 1.474 45.474 36.670 0.05 13.45 N ANISOU 363 N GLY A 21 1786 1070 2253 146 -206 52 N ATOM 364 CA GLY A 21 2.249 46.447 37.453 0.05 13.20 C ANISOU 364 CA GLY A 21 1801 993 2222 174 -182 62 C ATOM 365 C GLY A 21 1.661 46.723 38.819 0.05 13.35 C ANISOU 365 C GLY A 21 1791 1003 2279 201 -135 35 C ATOM 366 O GLY A 21 0.472 46.657 39.039 0.05 13.84 O ANISOU 366 O GLY A 21 1788 1088 2382 220 -128 15 O ATOM 367 H GLY A 21 0.645 45.643 36.613 0.05 13.85 H ANISOU 367 H GLY A 21 1794 1137 2331 165 -224 47 H ATOM 368 HA2 GLY A 21 3.166 46.176 37.528 0.05 12.81 H ANISOU 368 HA2 GLY A 21 1791 931 2143 151 -167 66 H ATOM 369 HA3 GLY A 21 2.216 47.289 36.974 0.05 13.45 H ANISOU 369 HA3 GLY A 21 1843 1010 2257 201 -216 83 H ATOM 370 N SER A 22 2.560 47.137 39.699 0.05 13.03 N ANISOU 370 N SER A 22 1801 930 2222 203 -103 30 N ATOM 371 CA SER A 22 2.191 47.709 40.995 0.05 13.26 C ANISOU 371 CA SER A 22 1823 944 2270 231 -58 1 C ATOM 372 C SER A 22 2.919 49.035 41.127 0.05 13.32 C ANISOU 372 C SER A 22 1881 899 2279 258 -72 4 C ATOM 373 O SER A 22 4.113 49.095 41.368 0.05 12.94 O ANISOU 373 O SER A 22 1887 834 2198 233 -69 8 O ATOM 374 CB SER A 22 2.530 46.820 42.159 0.05 12.98 C ANISOU 374 CB SER A 22 1804 925 2201 195 -3 -15 C ATOM 375 OG SER A 22 1.829 47.283 43.298 0.05 13.22 O ANISOU 375 OG SER A 22 1849 947 2228 216 41 -44 O ATOM 376 H SER A 22 3.397 47.139 39.563 0.05 12.75 H ANISOU 376 H SER A 22 1803 881 2161 188 -109 42 H ATOM 377 HA SER A 22 1.240 47.884 41.003 0.05 13.68 H ANISOU 377 HA SER A 22 1830 1009 2358 254 -55 -11 H ATOM 378 HB2 SER A 22 2.276 45.907 41.965 0.05 13.10 H ANISOU 378 HB2 SER A 22 1784 966 2227 180 11 -19 H ATOM 379 HB3 SER A 22 3.482 46.878 42.338 0.05 12.60 H ANISOU 379 HB3 SER A 22 1792 872 2124 173 -11 -2 H ATOM 380 HG SER A 22 2.014 48.087 43.447 0.05 13.21 H ANISOU 380 HG SER A 22 1873 921 2224 230 29 -47 H ATOM 381 N ARG A 23 2.143 50.085 40.941 0.05 13.91 N ANISOU 381 N ARG A 23 1934 949 2402 311 -91 3 N ATOM 382 CA ARG A 23 2.720 51.444 40.967 0.05 14.16 C ANISOU 382 CA ARG A 23 2016 913 2449 338 -106 8 C ATOM 383 C ARG A 23 3.066 51.865 42.392 0.05 14.21 C ANISOU 383 C ARG A 23 2051 899 2450 341 -55 -42 C ATOM 384 O ARG A 23 2.327 51.607 43.314 0.05 14.46 O ANISOU 384 O ARG A 23 2048 955 2490 356 -10 -81 O ATOM 385 CB ARG A 23 1.755 52.456 40.335 0.05 14.94 C ANISOU 385 CB ARG A 23 2087 981 2610 405 -143 23 C ATOM 386 CG ARG A 23 1.656 52.376 38.790 0.05 15.06 C ANISOU 386 CG ARG A 23 2095 1011 2615 404 -210 81 C ATOM 387 CD ARG A 23 0.396 53.095 38.291 0.05 15.89 C ANISOU 387 CD ARG A 23 2202 1070 2767 468 -266 119 C ATOM 388 NE ARG A 23 0.297 53.276 36.838 0.05 15.81 N ANISOU 388 NE ARG A 23 2233 1069 2705 437 -320 182 N ATOM 389 CZ ARG A 23 0.773 54.317 36.155 0.05 16.45 C ANISOU 389 CZ ARG A 23 2354 1104 2791 469 -374 241 C ATOM 390 NH1 ARG A 23 1.444 55.285 36.781 0.05 17.26 N ANISOU 390 NH1 ARG A 23 2458 1139 2961 543 -389 249 N ATOM 391 NH2 ARG A 23 0.598 54.335 34.828 0.05 16.38 N ANISOU 391 NH2 ARG A 23 2386 1119 2718 429 -411 293 N ATOM 392 H ARG A 23 1.303 50.051 40.789 0.05 14.24 H ANISOU 392 H ARG A 23 1931 1007 2472 332 -97 -1 H ATOM 393 HA ARG A 23 3.540 51.451 40.455 0.05 13.88 H ANISOU 393 HA ARG A 23 2018 867 2389 312 -126 33 H ATOM 394 HB2 ARG A 23 0.868 52.293 40.690 0.05 15.25 H ANISOU 394 HB2 ARG A 23 2075 1041 2678 431 -125 -2 H ATOM 395 HB3 ARG A 23 2.047 53.343 40.583 0.05 15.18 H ANISOU 395 HB3 ARG A 23 2153 958 2657 424 -142 20 H ATOM 396 HG2 ARG A 23 2.441 52.776 38.388 0.05 14.68 H ANISOU 396 HG2 ARG A 23 2091 958 2528 366 -217 102 H ATOM 397 HG3 ARG A 23 1.598 51.448 38.516 0.05 15.02 H ANISOU 397 HG3 ARG A 23 2043 1056 2609 396 -214 75 H ATOM 398 HD2 ARG A 23 -0.368 52.565 38.565 0.05 16.32 H ANISOU 398 HD2 ARG A 23 2196 1148 2856 506 -279 110 H ATOM 399 HD3 ARG A 23 0.346 53.968 38.706 0.05 16.11 H ANISOU 399 HD3 ARG A 23 2264 1040 2816 489 -252 113 H ATOM 400 HE ARG A 23 0.123 52.577 36.375 0.05 15.37 H ANISOU 400 HE ARG A 23 2178 1051 2610 395 -314 180 H ATOM 401 HH11 ARG A 23 1.551 55.268 37.635 0.05 17.35 H ANISOU 401 HH11 ARG A 23 2442 1138 3012 568 -359 209 H ATOM 402 HH12 ARG A 23 1.748 55.949 36.328 0.05 17.74 H ANISOU 402 HH12 ARG A 23 2550 1166 3026 565 -426 293 H ATOM 403 HH21 ARG A 23 0.172 53.700 34.434 0.05 15.91 H ANISOU 403 HH21 ARG A 23 2324 1100 2619 384 -399 283 H ATOM 404 HH22 ARG A 23 0.906 54.993 34.363 0.05 16.85 H ANISOU 404 HH22 ARG A 23 2478 1152 2774 447 -446 337 H ATOM 405 N LEU A 24 4.199 52.537 42.531 0.05 14.10 N ANISOU 405 N LEU A 24 2098 839 2419 321 -62 -43 N ATOM 406 CA LEU A 24 4.601 53.138 43.818 0.05 14.32 C ANISOU 406 CA LEU A 24 2160 842 2440 322 -25 -97 C ATOM 407 C LEU A 24 3.583 54.126 44.371 0.05 15.13 C ANISOU 407 C LEU A 24 2246 906 2598 384 0 -140 C ATOM 408 O LEU A 24 3.235 54.089 45.547 0.05 15.41 O ANISOU 408 O LEU A 24 2275 959 2621 394 50 -195 O ATOM 409 CB LEU A 24 5.937 53.832 43.624 0.05 14.22 C ANISOU 409 CB LEU A 24 2207 783 2414 286 -47 -91 C ATOM 410 CG LEU A 24 6.541 54.534 44.854 0.05 14.55 C ANISOU 410 CG LEU A 24 2289 796 2443 276 -22 -154 C ATOM 411 CD1 LEU A 24 6.940 53.534 45.904 0.05 14.23 C ANISOU 411 CD1 LEU A 24 2246 824 2337 248 3 -181 C ATOM 412 CD2 LEU A 24 7.734 55.356 44.417 0.05 14.62 C ANISOU 412 CD2 LEU A 24 2345 751 2458 235 -48 -145 C ATOM 413 H LEU A 24 4.754 52.662 41.894 0.05 13.95 H ANISOU 413 H LEU A 24 2102 806 2392 304 -86 -15 H ATOM 414 HA LEU A 24 4.724 52.437 44.476 0.05 14.10 H ANISOU 414 HA LEU A 24 2127 854 2377 303 0 -114 H ATOM 415 HB2 LEU A 24 6.585 53.164 43.346 0.05 13.77 H ANISOU 415 HB2 LEU A 24 2152 755 2323 250 -56 -71 H ATOM 416 HB3 LEU A 24 5.841 54.478 42.916 0.05 14.46 H ANISOU 416 HB3 LEU A 24 2248 772 2475 300 -70 -66 H ATOM 417 HG LEU A 24 5.874 55.120 45.235 0.05 15.04 H ANISOU 417 HG LEU A 24 2348 830 2536 312 -5 -183 H ATOM 418 HD11 LEU A 24 7.210 54.018 46.701 0.05 14.54 H ANISOU 418 HD11 LEU A 24 2311 851 2364 244 15 -224 H ATOM 419 HD12 LEU A 24 6.196 52.948 46.117 0.05 14.22 H ANISOU 419 HD12 LEU A 24 2216 856 2331 265 24 -181 H ATOM 420 HD13 LEU A 24 7.687 53.014 45.572 0.05 13.81 H ANISOU 420 HD13 LEU A 24 2197 793 2259 215 -16 -155 H ATOM 421 HD21 LEU A 24 7.441 56.007 43.763 0.05 14.92 H ANISOU 421 HD21 LEU A 24 2393 740 2537 254 -61 -123 H ATOM 422 HD22 LEU A 24 8.103 55.802 45.195 0.05 14.87 H ANISOU 422 HD22 LEU A 24 2399 768 2481 224 -37 -190 H ATOM 423 HD23 LEU A 24 8.396 54.773 44.016 0.05 14.18 H ANISOU 423 HD23 LEU A 24 2286 726 2376 201 -63 -117 H ATOM 424 N LEU A 25 3.095 54.972 43.476 0.05 15.60 N ANISOU 424 N LEU A 25 2299 913 2717 429 -35 -111 N ATOM 425 CA LEU A 25 2.230 56.090 43.866 0.05 16.53 C ANISOU 425 CA LEU A 25 2405 973 2903 500 -18 -151 C ATOM 426 C LEU A 25 0.792 55.847 43.477 0.05 16.97 C ANISOU 426 C LEU A 25 2375 1063 3009 558 -24 -142 C ATOM 427 O LEU A 25 0.530 55.092 42.558 0.05 16.63 O ANISOU 427 O LEU A 25 2296 1070 2954 543 -61 -94 O ATOM 428 CB LEU A 25 2.721 57.391 43.202 0.05 17.02 C ANISOU 428 CB LEU A 25 2524 933 3009 520 -57 -122 C ATOM 429 CG LEU A 25 4.144 57.777 43.537 0.05 16.77 C ANISOU 429 CG LEU A 25 2570 859 2943 456 -55 -131 C ATOM 430 CD1 LEU A 25 4.587 58.986 42.708 0.05 17.41 C ANISOU 430 CD1 LEU A 25 2707 831 3076 471 -88 -92 C ATOM 431 CD2 LEU A 25 4.295 58.045 45.030 0.05 16.94 C ANISOU 431 CD2 LEU A 25 2611 882 2942 442 -3 -220 C ATOM 432 H LEU A 25 3.239 54.927 42.633 0.05 15.48 H ANISOU 432 H LEU A 25 2287 892 2702 423 -70 -69 H ATOM 433 HA LEU A 25 2.302 56.189 44.818 0.05 16.67 H ANISOU 433 HA LEU A 25 2433 993 2909 497 23 -203 H ATOM 434 HB2 LEU A 25 2.678 57.287 42.241 0.05 16.97 H ANISOU 434 HB2 LEU A 25 2511 927 3009 525 -97 -67 H ATOM 435 HB3 LEU A 25 2.138 58.117 43.475 0.05 17.69 H ANISOU 435 HB3 LEU A 25 2603 974 3144 571 -42 -153 H ATOM 436 HG LEU A 25 4.733 57.034 43.317 0.05 16.16 H ANISOU 436 HG LEU A 25 2494 825 2820 409 -68 -103 H ATOM 437 HD11 LEU A 25 5.548 59.090 42.777 0.05 17.23 H ANISOU 437 HD11 LEU A 25 2727 789 3032 419 -87 -95 H ATOM 438 HD12 LEU A 25 4.333 58.848 41.783 0.05 17.38 H ANISOU 438 HD12 LEU A 25 2693 834 3078 483 -123 -34 H ATOM 439 HD13 LEU A 25 4.139 59.772 43.056 0.05 18.07 H ANISOU 439 HD13 LEU A 25 2794 861 3210 519 -75 -124 H ATOM 440 HD21 LEU A 25 4.131 57.224 45.519 0.05 16.51 H ANISOU 440 HD21 LEU A 25 2533 896 2843 421 14 -231 H ATOM 441 HD22 LEU A 25 5.199 58.346 45.207 0.05 16.92 H ANISOU 441 HD22 LEU A 25 2654 847 2928 403 -9 -229 H ATOM 442 HD23 LEU A 25 3.659 58.728 45.300 0.05 17.56 H ANISOU 442 HD23 LEU A 25 2681 927 3063 490 18 -257 H ATOM 443 N PRO A 26 -0.166 56.475 44.184 0.05 17.82 N ANISOU 443 N PRO A 26 2444 1150 3176 624 14 -197 N ATOM 444 CA PRO A 26 0.159 57.266 45.370 0.05 18.33 C ANISOU 444 CA PRO A 26 2544 1171 3248 640 74 -276 C ATOM 445 C PRO A 26 0.470 56.392 46.600 0.05 17.84 C ANISOU 445 C PRO A 26 2502 1176 3101 577 133 -322 C ATOM 446 O PRO A 26 0.179 55.191 46.677 0.05 17.31 O ANISOU 446 O PRO A 26 2399 1190 2987 537 147 -302 O ATOM 447 CB PRO A 26 -1.105 58.102 45.597 0.05 19.37 C ANISOU 447 CB PRO A 26 2598 1299 3465 728 106 -320 C ATOM 448 CG PRO A 26 -2.200 57.251 45.080 0.05 19.16 C ANISOU 448 CG PRO A 26 2478 1357 3445 728 83 -277 C ATOM 449 CD PRO A 26 -1.611 56.543 43.860 0.05 18.47 C ANISOU 449 CD PRO A 26 2430 1261 3326 690 1 -191 C ATOM 450 HA PRO A 26 0.896 57.870 45.209 0.05 18.48 H ANISOU 450 HA PRO A 26 2618 1124 3278 640 56 -273 H ATOM 451 HB2 PRO A 26 -1.211 58.282 46.543 0.05 19.63 H ANISOU 451 HB2 PRO A 26 2628 1347 3485 728 165 -380 H ATOM 452 HB3 PRO A 26 -1.034 58.918 45.084 0.05 19.92 H ANISOU 452 HB3 PRO A 26 2679 1300 3591 777 78 -311 H ATOM 453 HG2 PRO A 26 -2.444 56.594 45.750 0.05 18.84 H ANISOU 453 HG2 PRO A 26 2419 1377 3363 688 124 -297 H ATOM 454 HG3 PRO A 26 -2.963 57.795 44.832 0.05 19.86 H ANISOU 454 HG3 PRO A 26 2509 1438 3600 790 78 -287 H ATOM 455 HD2 PRO A 26 -1.980 55.650 43.775 0.05 18.08 H ANISOU 455 HD2 PRO A 26 2343 1274 3253 661 -9 -169 H ATOM 456 HD3 PRO A 26 -1.758 57.059 43.054 0.05 18.91 H ANISOU 456 HD3 PRO A 26 2489 1269 3427 734 -43 -161 H ATOM 457 N TRP A 27 1.080 57.061 47.568 0.05 18.19 N ANISOU 457 N TRP A 27 2606 1178 3125 569 166 -384 N ATOM 458 CA TRP A 27 1.419 56.508 48.853 0.05 18.04 C ANISOU 458 CA TRP A 27 2617 1216 3023 522 219 -436 C ATOM 459 C TRP A 27 1.321 57.720 49.764 0.05 19.02 C ANISOU 459 C TRP A 27 2779 1279 3168 556 262 -527 C ATOM 460 O TRP A 27 2.185 58.589 49.721 0.05 19.17 O ANISOU 460 O TRP A 27 2862 1224 3198 543 233 -543 O ATOM 461 CB TRP A 27 2.845 55.938 48.815 0.05 17.16 C ANISOU 461 CB TRP A 27 2560 1124 2835 445 176 -396 C ATOM 462 CG TRP A 27 3.297 55.270 50.093 0.05 17.00 C ANISOU 462 CG TRP A 27 2573 1170 2717 397 211 -429 C ATOM 463 CD1 TRP A 27 3.157 55.711 51.375 0.05 17.68 C ANISOU 463 CD1 TRP A 27 2688 1269 2760 400 265 -508 C ATOM 464 CD2 TRP A 27 3.941 54.006 50.177 0.05 16.22 C ANISOU 464 CD2 TRP A 27 2482 1133 2547 342 189 -380 C ATOM 465 NE1 TRP A 27 3.690 54.820 52.263 0.05 17.39 N ANISOU 465 NE1 TRP A 27 2684 1304 2622 349 274 -504 N ATOM 466 CE2 TRP A 27 4.159 53.748 51.548 0.05 16.50 C ANISOU 466 CE2 TRP A 27 2556 1216 2496 316 226 -424 C ATOM 467 CE3 TRP A 27 4.352 53.074 49.233 0.05 15.41 C ANISOU 467 CE3 TRP A 27 2362 1049 2445 314 143 -305 C ATOM 468 CZ2 TRP A 27 4.787 52.607 51.997 0.05 16.00 C ANISOU 468 CZ2 TRP A 27 2513 1213 2353 271 211 -384 C ATOM 469 CZ3 TRP A 27 4.969 51.913 49.700 0.05 14.91 C ANISOU 469 CZ3 TRP A 27 2316 1040 2309 269 136 -278 C ATOM 470 CH2 TRP A 27 5.191 51.720 51.057 0.05 15.22 C ANISOU 470 CH2 TRP A 27 2391 1120 2271 251 166 -313 C ATOM 471 H TRP A 27 1.301 57.891 47.495 0.05 18.58 H ANISOU 471 H TRP A 27 2685 1165 3211 592 156 -399 H ATOM 472 HA TRP A 27 0.783 55.827 49.122 0.05 18.05 H ANISOU 472 HA TRP A 27 2575 1274 3007 523 253 -439 H ATOM 473 HB2 TRP A 27 2.872 55.282 48.107 0.05 16.66 H ANISOU 473 HB2 TRP A 27 2471 1085 2773 434 149 -342 H ATOM 474 HB3 TRP A 27 3.480 56.638 48.612 0.05 17.23 H ANISOU 474 HB3 TRP A 27 2610 1079 2860 438 149 -399 H ATOM 475 HD1 TRP A 27 2.762 56.523 51.619 0.05 18.33 H ANISOU 475 HD1 TRP A 27 2772 1316 2876 434 293 -558 H ATOM 476 HE1 TRP A 27 3.705 54.899 53.117 0.05 17.78 H ANISOU 476 HE1 TRP A 27 2759 1376 2621 341 303 -545 H ATOM 477 HE3 TRP A 27 4.210 53.212 48.327 0.05 15.28 H ANISOU 477 HE3 TRP A 27 2326 1007 2474 328 117 -275 H ATOM 478 HZ2 TRP A 27 4.932 52.467 52.904 0.05 16.26 H ANISOU 478 HZ2 TRP A 27 2576 1279 2324 256 230 -407 H ATOM 479 HZ3 TRP A 27 5.252 51.284 49.079 0.05 14.43 H ANISOU 479 HZ3 TRP A 27 2244 989 2251 253 109 -235 H ATOM 480 HH2 TRP A 27 5.604 50.930 51.334 0.05 14.94 H ANISOU 480 HH2 TRP A 27 2369 1118 2191 227 156 -287 H ATOM 481 N GLU A 28 0.264 57.777 50.565 0.05 19.76 N ANISOU 481 N GLU A 28 2830 1404 3273 597 336 -590 N ATOM 482 CA GLU A 28 0.016 58.944 51.397 0.05 20.88 C ANISOU 482 CA GLU A 28 2997 1495 3441 640 393 -692 C ATOM 483 C GLU A 28 1.220 59.216 52.260 0.05 20.86 C ANISOU 483 C GLU A 28 3092 1478 3357 580 390 -742 C ATOM 484 O GLU A 28 1.686 58.316 52.935 0.05 20.48 O ANISOU 484 O GLU A 28 3067 1510 3203 522 405 -744 O ATOM 485 CB GLU A 28 -1.218 58.768 52.312 0.05 21.54 C ANISOU 485 CB GLU A 28 3021 1656 3507 664 490 -751 C ATOM 486 CG GLU A 28 -1.455 59.880 53.410 0.05 22.95 C ANISOU 486 CG GLU A 28 3186 1788 3747 738 564 -859 C ATOM 487 CD GLU A 28 -2.135 59.282 54.650 0.05 23.62 C ANISOU 487 CD GLU A 28 3249 1963 3761 726 677 -934 C ATOM 488 OE1 GLU A 28 -2.969 58.370 54.464 0.05 23.54 O ANISOU 488 OE1 GLU A 28 3156 2032 3757 726 713 -902 O ATOM 489 OE2 GLU A 28 -1.801 59.653 55.803 0.05 24.35 O ANISOU 489 OE2 GLU A 28 3410 2049 3795 716 732 -1029 O ATOM 490 H GLU A 28 -0.322 57.155 50.640 0.05 19.68 H ANISOU 490 H GLU A 28 2773 1448 3255 598 358 -578 H ATOM 491 HA GLU A 28 -0.130 59.719 50.830 0.05 21.32 H ANISOU 491 HA GLU A 28 3044 1481 3576 690 375 -693 H ATOM 492 HB2 GLU A 28 -2.012 58.741 51.756 0.05 21.34 H ANISOU 492 HB2 GLU A 28 2931 1665 3514 678 484 -707 H ATOM 493 HB3 GLU A 28 -1.125 57.920 52.777 0.05 21.32 H ANISOU 493 HB3 GLU A 28 3025 1684 3392 614 514 -762 H ATOM 494 HG2 GLU A 28 -0.617 60.274 53.688 0.05 23.22 H ANISOU 494 HG2 GLU A 28 3283 1761 3779 736 554 -899 H ATOM 495 HG3 GLU A 28 -2.041 60.567 53.054 0.05 23.29 H ANISOU 495 HG3 GLU A 28 3171 1800 3879 797 555 -846 H ATOM 496 N GLY A 29 1.684 60.473 52.224 0.05 21.39 N ANISOU 496 N GLY A 29 3215 1439 3473 592 366 -781 N ATOM 497 CA GLY A 29 2.793 60.976 53.018 0.05 21.53 C ANISOU 497 CA GLY A 29 3318 1443 3420 528 357 -840 C ATOM 498 C GLY A 29 4.192 60.729 52.465 0.05 20.66 C ANISOU 498 C GLY A 29 3245 1320 3287 458 276 -773 C ATOM 499 O GLY A 29 5.181 61.188 53.039 0.05 20.88 O ANISOU 499 O GLY A 29 3334 1326 3274 403 257 -822 O ATOM 500 H GLY A 29 1.353 61.072 51.706 0.05 21.72 H ANISOU 500 H GLY A 29 3248 1416 3590 634 353 -774 H ATOM 501 HA2 GLY A 29 2.688 61.938 53.108 0.05 22.31 H ANISOU 501 HA2 GLY A 29 3445 1471 3562 554 375 -902 H ATOM 502 HA3 GLY A 29 2.738 60.601 53.906 0.05 21.55 H ANISOU 502 HA3 GLY A 29 3328 1517 3344 503 390 -872 H ATOM 503 N LEU A 30 4.275 59.987 51.357 0.05 19.79 N ANISOU 503 N LEU A 30 3094 1224 3202 456 231 -668 N ATOM 504 CA LEU A 30 5.543 59.731 50.666 0.05 19.00 C ANISOU 504 CA LEU A 30 3019 1122 3079 389 165 -603 C ATOM 505 C LEU A 30 5.785 60.809 49.627 0.05 19.22 C ANISOU 505 C LEU A 30 3068 1038 3197 401 124 -561 C ATOM 506 O LEU A 30 5.018 60.902 48.680 0.05 19.03 O ANISOU 506 O LEU A 30 3009 995 3227 441 103 -488 O ATOM 507 CB LEU A 30 5.546 58.350 49.978 0.05 17.94 C ANISOU 507 CB LEU A 30 2839 1081 2896 365 142 -517 C ATOM 508 CG LEU A 30 6.818 58.012 49.204 0.05 17.25 C ANISOU 508 CG LEU A 30 2769 985 2800 307 81 -453 C ATOM 509 CD1 LEU A 30 7.997 58.210 50.149 0.05 17.00 C ANISOU 509 CD1 LEU A 30 2765 1012 2683 242 66 -479 C ATOM 510 CD2 LEU A 30 6.812 56.547 48.575 0.05 16.48 C ANISOU 510 CD2 LEU A 30 2623 924 2714 314 55 -359 C ATOM 511 H LEU A 30 3.593 59.647 50.973 0.05 19.71 H ANISOU 511 H LEU A 30 3041 1225 3224 492 237 -637 H ATOM 512 HA LEU A 30 6.270 59.759 51.305 0.05 19.10 H ANISOU 512 HA LEU A 30 3068 1145 3043 346 160 -643 H ATOM 513 HB2 LEU A 30 5.422 57.674 50.660 0.05 17.84 H ANISOU 513 HB2 LEU A 30 2827 1132 2819 348 163 -539 H ATOM 514 HB3 LEU A 30 4.809 58.317 49.353 0.05 17.88 H ANISOU 514 HB3 LEU A 30 2791 1076 2927 404 147 -485 H ATOM 515 HG LEU A 30 6.912 58.638 48.473 0.05 17.57 H ANISOU 515 HG LEU A 30 2835 955 2885 304 65 -456 H ATOM 516 HD11 LEU A 30 8.703 57.587 49.918 0.05 16.64 H ANISOU 516 HD11 LEU A 30 2699 1034 2591 241 75 -462 H ATOM 517 HD12 LEU A 30 8.325 59.117 50.049 0.05 16.73 H ANISOU 517 HD12 LEU A 30 2737 963 2655 206 32 -450 H ATOM 518 HD13 LEU A 30 7.714 58.079 51.064 0.05 17.57 H ANISOU 518 HD13 LEU A 30 2866 1067 2742 238 81 -545 H ATOM 519 HD21 LEU A 30 7.554 56.033 48.924 0.05 16.28 H ANISOU 519 HD21 LEU A 30 2614 870 2704 289 23 -324 H ATOM 520 HD22 LEU A 30 5.978 56.109 48.797 0.05 16.05 H ANISOU 520 HD22 LEU A 30 2552 936 2609 296 60 -348 H ATOM 521 HD23 LEU A 30 6.895 56.611 47.612 0.05 16.71 H ANISOU 521 HD23 LEU A 30 2626 937 2787 361 65 -349 H ATOM 522 N ASN A 31 6.843 61.574 49.858 0.05 19.68 N ANISOU 522 N ASN A 31 3186 1028 3262 356 112 -608 N ATOM 523 CA ASN A 31 7.260 62.669 48.963 0.05 20.09 C ANISOU 523 CA ASN A 31 3278 959 3396 349 82 -574 C ATOM 524 C ASN A 31 8.471 62.258 48.129 0.05 19.39 C ANISOU 524 C ASN A 31 3199 891 3275 264 36 -511 C ATOM 525 O ASN A 31 9.553 62.169 48.667 0.05 19.35 O ANISOU 525 O ASN A 31 3215 915 3222 194 27 -556 O ATOM 526 CB ASN A 31 7.575 63.964 49.748 0.05 21.28 C ANISOU 526 CB ASN A 31 3489 1003 3591 348 107 -675 C ATOM 527 CG ASN A 31 7.703 65.181 48.834 0.05 21.98 C ANISOU 527 CG ASN A 31 3625 942 3785 358 88 -637 C ATOM 528 OD1 ASN A 31 7.270 65.137 47.674 0.05 21.67 O ANISOU 528 OD1 ASN A 31 3573 879 3781 378 57 -532 O ATOM 529 ND2 ASN A 31 8.333 66.236 49.333 0.05 23.03 N ANISOU 529 ND2 ASN A 31 3818 971 3960 340 107 -723 N ATOM 530 H ASN A 31 7.350 61.491 50.543 0.05 19.84 H ANISOU 530 H ASN A 31 3228 1070 3239 325 121 -661 H ATOM 531 HA ASN A 31 6.529 62.866 48.359 0.05 20.17 H ANISOU 531 HA ASN A 31 3268 939 3456 400 77 -528 H ATOM 532 HB2 ASN A 31 6.857 64.140 50.378 0.05 21.74 H ANISOU 532 HB2 ASN A 31 3537 1061 3660 399 144 -726 H ATOM 533 HB3 ASN A 31 8.413 63.874 50.231 0.05 21.27 H ANISOU 533 HB3 ASN A 31 3511 1026 3544 288 102 -718 H ATOM 534 HD21 ASN A 31 7.880 66.873 49.692 0.05 23.34 H ANISOU 534 HD21 ASN A 31 3864 1030 3973 339 131 -801 H ATOM 535 HD22 ASN A 31 9.191 66.277 49.300 0.05 23.46 H ANISOU 535 HD22 ASN A 31 3908 937 4067 328 96 -703 H ATOM 536 N THR A 32 8.277 62.033 46.834 0.05 18.94 N ANISOU 536 N THR A 32 3126 826 3245 274 7 -409 N ATOM 537 CA THR A 32 9.348 61.560 45.917 0.05 18.29 C ANISOU 537 CA THR A 32 3043 773 3132 201 -27 -341 C ATOM 538 C THR A 32 9.482 62.446 44.658 0.05 18.76 C ANISOU 538 C THR A 32 3143 727 3260 198 -45 -270 C ATOM 539 O THR A 32 8.477 62.930 44.157 0.05 19.24 O ANISOU 539 O THR A 32 3208 727 3375 272 -48 -236 O ATOM 540 CB THR A 32 9.131 60.062 45.431 0.05 17.22 C ANISOU 540 CB THR A 32 2849 754 2939 206 -41 -274 C ATOM 541 OG1 THR A 32 7.915 60.013 44.697 0.05 17.30 O ANISOU 541 OG1 THR A 32 2833 751 2987 280 -45 -225 O ATOM 542 CG2 THR A 32 9.045 59.081 46.602 0.05 16.76 C ANISOU 542 CG2 THR A 32 2758 801 2809 202 -24 -323 C ATOM 543 H THR A 32 7.518 62.117 46.451 0.05 19.05 H ANISOU 543 H THR A 32 3124 822 3292 324 7 -379 H ATOM 544 HA THR A 32 10.189 61.587 46.396 0.05 18.31 H ANISOU 544 HA THR A 32 3058 789 3108 148 -28 -381 H ATOM 545 HB THR A 32 9.862 59.808 44.851 0.05 16.91 H ANISOU 545 HB THR A 32 2811 726 2886 162 -59 -235 H ATOM 546 HG1 THR A 32 7.280 60.283 45.176 0.05 17.64 H ANISOU 546 HG1 THR A 32 2869 783 3049 319 -27 -261 H ATOM 547 HG21 THR A 32 9.867 58.570 46.670 0.05 16.65 H ANISOU 547 HG21 THR A 32 2755 810 2763 153 -33 -344 H ATOM 548 HG22 THR A 32 8.903 59.568 47.430 0.05 17.17 H ANISOU 548 HG22 THR A 32 2813 842 2867 236 1 -372 H ATOM 549 HG23 THR A 32 8.303 58.482 46.453 0.05 16.23 H ANISOU 549 HG23 THR A 32 2658 788 2721 214 -28 -282 H ATOM 550 N PRO A 33 10.697 62.555 44.124 0.05 18.68 N ANISOU 550 N PRO A 33 3155 703 3239 115 -58 -240 N ATOM 551 CA PRO A 33 10.876 63.312 42.882 0.05 19.16 C ANISOU 551 CA PRO A 33 3261 672 3348 100 -70 -158 C ATOM 552 C PRO A 33 10.759 62.417 41.647 0.05 18.45 C ANISOU 552 C PRO A 33 3141 653 3215 104 -92 -58 C ATOM 553 O PRO A 33 11.041 62.828 40.537 0.05 18.77 O ANISOU 553 O PRO A 33 3218 645 3268 79 -101 21 O ATOM 554 CB PRO A 33 12.295 63.842 43.014 0.05 19.53 C ANISOU 554 CB PRO A 33 3339 680 3401 -5 -61 -188 C ATOM 555 CG PRO A 33 13.018 62.712 43.799 0.05 18.69 C ANISOU 555 CG PRO A 33 3174 708 3220 -49 -66 -242 C ATOM 556 CD PRO A 33 11.979 62.258 44.773 0.05 18.47 C ANISOU 556 CD PRO A 33 3122 728 3169 29 -59 -295 C ATOM 557 HA PRO A 33 10.233 64.037 42.825 0.05 19.80 H ANISOU 557 HA PRO A 33 3369 674 3479 149 -68 -155 H ATOM 558 HB2 PRO A 33 12.686 63.955 42.137 0.05 19.60 H ANISOU 558 HB2 PRO A 33 3365 667 3415 -38 -65 -126 H ATOM 559 HB3 PRO A 33 12.307 64.672 43.516 0.05 20.23 H ANISOU 559 HB3 PRO A 33 3463 692 3532 -8 -50 -239 H ATOM 560 HG2 PRO A 33 13.255 62.016 43.172 0.05 18.13 H ANISOU 560 HG2 PRO A 33 3076 695 3117 -62 -74 -191 H ATOM 561 HG3 PRO A 33 13.798 63.047 44.258 0.05 19.01 H ANISOU 561 HG3 PRO A 33 3224 735 3264 -105 -64 -290 H ATOM 562 HD2 PRO A 33 12.063 61.303 44.938 0.05 17.81 H ANISOU 562 HD2 PRO A 33 2999 735 3034 28 -65 -292 H ATOM 563 HD3 PRO A 33 12.051 62.765 45.592 0.05 18.98 H ANISOU 563 HD3 PRO A 33 3206 759 3245 23 -49 -365 H ATOM 564 N PHE A 34 10.314 61.162 41.869 0.05 17.57 N ANISOU 564 N PHE A 34 2967 658 3050 132 -97 -63 N ATOM 565 CA PHE A 34 10.220 60.138 40.809 0.05 16.87 C ANISOU 565 CA PHE A 34 2847 650 2915 130 -116 13 C ATOM 566 C PHE A 34 8.947 59.340 41.004 0.05 16.50 C ANISOU 566 C PHE A 34 2747 667 2857 205 -123 10 C ATOM 567 O PHE A 34 8.307 59.393 42.027 0.05 16.65 O ANISOU 567 O PHE A 34 2746 688 2891 247 -105 -51 O ATOM 568 CB PHE A 34 11.449 59.190 40.837 0.05 16.16 C ANISOU 568 CB PHE A 34 2729 646 2766 52 -110 3 C ATOM 569 CG PHE A 34 11.676 58.513 42.174 0.05 15.75 C ANISOU 569 CG PHE A 34 2641 660 2683 48 -100 -76 C ATOM 570 CD1 PHE A 34 10.948 57.380 42.518 0.05 15.13 C ANISOU 570 CD1 PHE A 34 2517 665 2566 88 -99 -80 C ATOM 571 CD2 PHE A 34 12.574 59.012 43.085 0.05 16.11 C ANISOU 571 CD2 PHE A 34 2702 684 2734 1 -92 -143 C ATOM 572 CE1 PHE A 34 11.149 56.774 43.768 0.05 14.90 C ANISOU 572 CE1 PHE A 34 2468 693 2500 84 -89 -142 C ATOM 573 CE2 PHE A 34 12.778 58.414 44.316 0.05 15.88 C ANISOU 573 CE2 PHE A 34 2650 721 2665 -1 -91 -210 C ATOM 574 CZ PHE A 34 12.059 57.312 44.654 0.05 15.30 C ANISOU 574 CZ PHE A 34 2540 725 2547 42 -88 -204 C ATOM 575 H PHE A 34 10.032 60.896 42.625 0.05 17.43 H ANISOU 575 H PHE A 34 2929 672 3023 152 -88 -111 H ATOM 576 HA PHE A 34 10.178 60.563 39.941 0.05 17.21 H ANISOU 576 HA PHE A 34 2918 650 2972 129 -128 70 H ATOM 577 HB2 PHE A 34 11.306 58.512 40.166 0.05 15.76 H ANISOU 577 HB2 PHE A 34 2658 644 2687 57 -119 45 H ATOM 578 HB3 PHE A 34 12.250 59.681 40.614 0.05 16.45 H ANISOU 578 HB3 PHE A 34 2791 648 2813 1 -104 8 H ATOM 579 HD1 PHE A 34 10.328 57.036 41.924 0.05 14.94 H ANISOU 579 HD1 PHE A 34 2479 659 2541 116 -106 -41 H ATOM 580 HD2 PHE A 34 13.063 59.767 42.862 0.05 16.58 H ANISOU 580 HD2 PHE A 34 2792 685 2824 -33 -90 -143 H ATOM 581 HE1 PHE A 34 10.664 56.022 43.999 0.05 14.56 H ANISOU 581 HE1 PHE A 34 2400 700 2432 107 -85 -141 H ATOM 582 HE2 PHE A 34 13.390 58.776 44.913 0.05 16.21 H ANISOU 582 HE2 PHE A 34 2703 751 2706 -35 -93 -257 H ATOM 583 HZ PHE A 34 12.202 56.912 45.478 0.05 15.22 H ANISOU 583 HZ PHE A 34 2521 757 2504 40 -87 -242 H ATOM 584 N GLY A 35 8.608 58.588 39.966 0.05 16.12 N ANISOU 584 N GLY A 35 2674 673 2778 214 -146 75 N ATOM 585 CA GLY A 35 7.537 57.609 40.018 0.05 15.70 C ANISOU 585 CA GLY A 35 2559 698 2708 262 -154 73 C ATOM 586 C GLY A 35 8.194 56.239 39.876 0.05 14.82 C ANISOU 586 C GLY A 35 2418 682 2532 209 -149 77 C ATOM 587 O GLY A 35 9.333 56.136 39.508 0.05 14.63 O ANISOU 587 O GLY A 35 2415 662 2480 149 -145 92 O ATOM 588 H GLY A 35 9.012 58.619 39.214 0.05 16.15 H ANISOU 588 H GLY A 35 2696 671 2769 187 -157 119 H ATOM 589 HA2 GLY A 35 7.064 57.652 40.858 0.05 15.78 H ANISOU 589 HA2 GLY A 35 2551 711 2735 291 -136 26 H ATOM 590 HA3 GLY A 35 6.920 57.734 39.287 0.05 15.95 H ANISOU 590 HA3 GLY A 35 2587 722 2753 295 -178 116 H ATOM 591 N GLY A 36 7.428 55.199 40.206 0.05 14.41 N ANISOU 591 N GLY A 36 2314 701 2462 234 -143 60 N ATOM 592 CA GLY A 36 7.966 53.857 40.165 0.05 13.69 C ANISOU 592 CA GLY A 36 2196 687 2318 193 -136 59 C ATOM 593 C GLY A 36 6.869 52.832 39.943 0.05 13.47 C ANISOU 593 C GLY A 36 2118 719 2283 220 -141 68 C ATOM 594 O GLY A 36 5.710 53.031 40.175 0.05 13.83 O ANISOU 594 O GLY A 36 2132 761 2362 270 -142 58 O ATOM 595 H GLY A 36 6.610 55.241 40.442 0.05 14.60 H ANISOU 595 H GLY A 36 2315 726 2506 274 -141 48 H ATOM 596 HA2 GLY A 36 8.603 53.822 39.445 0.05 13.61 H ANISOU 596 HA2 GLY A 36 2203 675 2291 161 -145 88 H ATOM 597 HA3 GLY A 36 8.414 53.656 40.996 0.05 13.52 H ANISOU 597 HA3 GLY A 36 2175 678 2284 178 -117 23 H ATOM 598 N ALA A 37 7.305 51.639 39.517 0.05 12.95 N ANISOU 598 N ALA A 37 2036 708 2175 183 -141 80 N ATOM 599 CA ALA A 37 6.394 50.472 39.445 0.05 12.75 C ANISOU 599 CA ALA A 37 1962 739 2143 193 -138 76 C ATOM 600 C ALA A 37 7.187 49.192 39.402 0.05 12.21 C ANISOU 600 C ALA A 37 1892 713 2035 149 -124 73 C ATOM 601 O ALA A 37 8.198 49.085 38.756 0.05 12.04 O ANISOU 601 O ALA A 37 1893 692 1990 116 -131 89 O ATOM 602 CB ALA A 37 5.487 50.526 38.261 0.05 13.08 C ANISOU 602 CB ALA A 37 1984 792 2195 213 -177 111 C ATOM 603 H ALA A 37 8.107 51.473 39.284 0.05 12.76 H ANISOU 603 H ALA A 37 2027 688 2131 152 -139 86 H ATOM 604 HA ALA A 37 5.843 50.448 40.230 0.05 12.85 H ANISOU 604 HA ALA A 37 1957 755 2171 214 -119 51 H ATOM 605 HB1 ALA A 37 4.838 49.819 38.289 0.05 13.04 H ANISOU 605 HB1 ALA A 37 1941 822 2193 218 -175 101 H ATOM 606 HB2 ALA A 37 5.018 51.380 38.291 0.05 13.50 H ANISOU 606 HB2 ALA A 37 2040 811 2278 248 -189 117 H ATOM 607 HB3 ALA A 37 6.017 50.488 37.454 0.05 13.02 H ANISOU 607 HB3 ALA A 37 1998 787 2162 190 -193 137 H ATOM 608 N TRP A 38 6.630 48.222 40.122 0.05 12.06 N ANISOU 608 N TRP A 38 1843 727 2014 152 -100 52 N ATOM 609 CA TRP A 38 7.095 46.819 39.967 0.05 11.69 C ANISOU 609 CA TRP A 38 1790 712 1939 119 -89 53 C ATOM 610 C TRP A 38 6.305 46.217 38.826 0.05 11.79 C ANISOU 610 C TRP A 38 1775 750 1955 111 -109 65 C ATOM 611 O TRP A 38 5.112 46.201 38.867 0.05 12.08 O ANISOU 611 O TRP A 38 1774 799 2017 130 -112 59 O ATOM 612 CB TRP A 38 6.838 46.015 41.266 0.05 11.63 C ANISOU 612 CB TRP A 38 1775 720 1926 120 -52 32 C ATOM 613 CG TRP A 38 7.437 44.606 41.275 0.05 11.37 C ANISOU 613 CG TRP A 38 1747 702 1871 93 -40 38 C ATOM 614 CD1 TRP A 38 7.156 43.569 40.401 0.05 11.32 C ANISOU 614 CD1 TRP A 38 1724 709 1868 72 -42 44 C ATOM 615 CD2 TRP A 38 8.402 44.137 42.187 0.05 11.26 C ANISOU 615 CD2 TRP A 38 1757 688 1832 89 -28 37 C ATOM 616 NE1 TRP A 38 7.892 42.490 40.768 0.05 11.18 N ANISOU 616 NE1 TRP A 38 1722 689 1838 59 -26 46 N ATOM 617 CE2 TRP A 38 8.653 42.786 41.857 0.05 11.15 C ANISOU 617 CE2 TRP A 38 1742 679 1816 72 -20 46 C ATOM 618 CE3 TRP A 38 9.051 44.685 43.298 0.05 11.35 C ANISOU 618 CE3 TRP A 38 1793 696 1823 99 -27 25 C ATOM 619 CZ2 TRP A 38 9.568 42.017 42.555 0.05 11.14 C ANISOU 619 CZ2 TRP A 38 1762 675 1797 74 -15 54 C ATOM 620 CZ3 TRP A 38 9.948 43.921 43.982 0.05 11.33 C ANISOU 620 CZ3 TRP A 38 1809 703 1795 96 -28 32 C ATOM 621 CH2 TRP A 38 10.192 42.584 43.621 0.05 11.24 C ANISOU 621 CH2 TRP A 38 1794 692 1786 88 -23 50 C ATOM 622 H TRP A 38 6.014 48.308 40.689 0.05 12.22 H ANISOU 622 H TRP A 38 1847 748 2048 170 -87 37 H ATOM 623 HA TRP A 38 8.024 46.799 39.739 0.05 11.53 H ANISOU 623 HA TRP A 38 1790 687 1903 101 -93 58 H ATOM 624 HB2 TRP A 38 7.250 46.473 42.009 0.05 11.67 H ANISOU 624 HB2 TRP A 38 1798 713 1922 127 -45 21 H ATOM 625 HB3 TRP A 38 5.883 45.973 41.407 0.05 11.84 H ANISOU 625 HB3 TRP A 38 1776 754 1969 132 -42 26 H ATOM 626 HD1 TRP A 38 6.564 43.593 39.697 0.05 11.43 H ANISOU 626 HD1 TRP A 38 1719 731 1893 69 -55 44 H ATOM 627 HE1 TRP A 38 7.876 41.750 40.355 0.05 11.18 H ANISOU 627 HE1 TRP A 38 1718 689 1840 45 -22 45 H ATOM 628 HE3 TRP A 38 8.889 45.567 43.543 0.05 11.48 H ANISOU 628 HE3 TRP A 38 1814 704 1843 109 -30 13 H ATOM 629 HZ2 TRP A 38 9.732 41.135 42.310 0.05 11.14 H ANISOU 629 HZ2 TRP A 38 1762 669 1802 67 -9 60 H ATOM 630 HZ3 TRP A 38 10.395 44.259 44.718 0.05 11.46 H ANISOU 630 HZ3 TRP A 38 1840 723 1791 102 -35 23 H ATOM 631 HH2 TRP A 38 10.811 42.098 44.115 0.05 11.31 H ANISOU 631 HH2 TRP A 38 1815 703 1781 94 -27 58 H ATOM 632 N CYS A 39 7.024 45.696 37.842 0.05 11.63 N ANISOU 632 N CYS A 39 1770 741 1909 82 -120 76 N ATOM 633 CA CYS A 39 6.384 45.153 36.654 0.05 11.83 C ANISOU 633 CA CYS A 39 1778 794 1923 68 -145 82 C ATOM 634 C CYS A 39 6.770 43.705 36.396 0.05 11.64 C ANISOU 634 C CYS A 39 1752 788 1885 34 -125 62 C ATOM 635 O CYS A 39 7.893 43.312 36.585 0.05 11.39 O ANISOU 635 O CYS A 39 1741 745 1840 22 -103 58 O ATOM 636 CB CYS A 39 6.774 45.999 35.443 0.05 12.05 C ANISOU 636 CB CYS A 39 1838 817 1922 62 -176 112 C ATOM 637 SG CYS A 39 6.229 47.747 35.511 0.05 12.46 S ANISOU 637 SG CYS A 39 1908 828 1998 103 -204 144 S ATOM 638 H CYS A 39 7.866 45.649 37.840 0.05 11.48 H ANISOU 638 H CYS A 39 1769 715 1876 69 -113 77 H ATOM 639 HA CYS A 39 5.427 45.187 36.744 0.05 12.06 H ANISOU 639 HA CYS A 39 1778 832 1972 83 -155 79 H ATOM 640 HB2 CYS A 39 7.732 45.986 35.379 0.05 11.87 H ANISOU 640 HB2 CYS A 39 1837 789 1883 43 -160 111 H ATOM 641 HB3 CYS A 39 6.393 45.659 34.633 0.05 12.26 H ANISOU 641 HB3 CYS A 39 1857 867 1933 54 -197 116 H ATOM 642 HG CYS A 39 7.387 47.948 35.699 0.05 12.20 H ANISOU 642 HG CYS A 39 1895 771 1971 95 -176 134 H ATOM 643 N ILE A 40 5.770 42.995 35.882 0.05 11.90 N ANISOU 643 N ILE A 40 1754 845 1924 21 -137 49 N ATOM 644 CA ILE A 40 5.951 41.582 35.489 0.05 11.89 C ANISOU 644 CA ILE A 40 1752 852 1916 -15 -119 23 C ATOM 645 C ILE A 40 5.465 41.430 34.066 0.05 12.30 C ANISOU 645 C ILE A 40 1796 937 1939 -37 -158 13 C ATOM 646 O ILE A 40 4.305 41.723 33.728 0.05 12.70 O ANISOU 646 O ILE A 40 1811 1014 2001 -30 -195 14 O ATOM 647 CB ILE A 40 5.235 40.606 36.414 0.05 11.97 C ANISOU 647 CB ILE A 40 1733 854 1961 -26 -87 5 C ATOM 648 CG1 ILE A 40 5.747 40.736 37.825 0.05 11.75 C ANISOU 648 CG1 ILE A 40 1715 803 1946 -2 -54 18 C ATOM 649 CG2 ILE A 40 5.474 39.158 35.868 0.05 12.04 C ANISOU 649 CG2 ILE A 40 1755 850 1968 -63 -66 -21 C ATOM 650 CD1 ILE A 40 4.989 39.821 38.769 0.05 12.00 C ANISOU 650 CD1 ILE A 40 1722 830 2006 -17 -15 9 C ATOM 651 H ILE A 40 4.981 43.279 35.748 0.05 12.15 H ANISOU 651 H ILE A 40 1762 887 1967 31 -156 51 H ATOM 652 HA ILE A 40 6.884 41.393 35.526 0.05 11.69 H ANISOU 652 HA ILE A 40 1750 813 1878 -19 -103 23 H ATOM 653 HB ILE A 40 4.291 40.788 36.413 0.05 12.25 H ANISOU 653 HB ILE A 40 1735 907 2012 -26 -103 -1 H ATOM 654 HG12 ILE A 40 6.696 40.552 37.866 0.05 11.53 H ANISOU 654 HG12 ILE A 40 1715 760 1906 0 -43 23 H ATOM 655 HG13 ILE A 40 5.566 41.644 38.112 0.05 11.77 H ANISOU 655 HG13 ILE A 40 1712 808 1951 21 -67 27 H ATOM 656 HG21 ILE A 40 4.792 38.590 36.259 0.05 12.18 H ANISOU 656 HG21 ILE A 40 1757 859 2011 -75 -45 -28 H ATOM 657 HG22 ILE A 40 5.396 39.164 34.909 0.05 12.24 H ANISOU 657 HG22 ILE A 40 1777 894 1979 -80 -88 -35 H ATOM 658 HG23 ILE A 40 6.369 38.912 36.147 0.05 11.81 H ANISOU 658 HG23 ILE A 40 1754 804 1931 -56 -50 -15 H ATOM 659 HD11 ILE A 40 4.067 40.113 38.830 0.05 12.28 H ANISOU 659 HD11 ILE A 40 1721 885 2059 -25 -26 -2 H ATOM 660 HD12 ILE A 40 5.038 38.915 38.436 0.05 11.99 H ANISOU 660 HD12 ILE A 40 1737 813 2005 -36 2 5 H ATOM 661 HD13 ILE A 40 5.420 39.884 39.634 0.05 11.95 H ANISOU 661 HD13 ILE A 40 1722 819 2000 1 3 17 H ATOM 662 N VAL A 41 6.379 40.956 33.243 0.05 12.29 N ANISOU 662 N VAL A 41 1827 940 1901 -61 -150 2 N ATOM 663 CA VAL A 41 6.047 40.516 31.881 0.05 12.76 C ANISOU 663 CA VAL A 41 1891 1037 1921 -92 -179 -21 C ATOM 664 C VAL A 41 5.888 38.995 31.963 0.05 12.87 C ANISOU 664 C VAL A 41 1893 1039 1956 -126 -150 -71 C ATOM 665 O VAL A 41 6.821 38.271 32.286 0.05 12.64 O ANISOU 665 O VAL A 41 1887 979 1938 -130 -106 -86 O ATOM 666 CB VAL A 41 7.087 40.955 30.844 0.05 12.87 C ANISOU 666 CB VAL A 41 1952 1066 1874 -103 -180 -9 C ATOM 667 CG1 VAL A 41 6.724 40.471 29.433 0.05 13.49 C ANISOU 667 CG1 VAL A 41 2042 1190 1893 -139 -207 -39 C ATOM 668 CG2 VAL A 41 7.265 42.501 30.839 0.05 12.89 C ANISOU 668 CG2 VAL A 41 1972 1063 1861 -75 -205 47 C ATOM 669 H VAL A 41 7.194 40.835 33.453 0.05 12.07 H ANISOU 669 H VAL A 41 1818 897 1870 -61 -127 2 H ATOM 670 HA VAL A 41 5.188 40.876 31.617 0.05 13.05 H ANISOU 670 HA VAL A 41 1906 1096 1958 -87 -216 -14 H ATOM 671 HB VAL A 41 7.938 40.570 31.092 0.05 12.64 H ANISOU 671 HB VAL A 41 1934 1017 1850 -107 -143 -20 H ATOM 672 HG11 VAL A 41 7.389 40.790 28.803 0.05 13.59 H ANISOU 672 HG11 VAL A 41 2089 1213 1864 -149 -196 -33 H ATOM 673 HG12 VAL A 41 6.708 39.504 29.420 0.05 13.54 H ANISOU 673 HG12 VAL A 41 2039 1192 1915 -159 -190 -79 H ATOM 674 HG13 VAL A 41 5.853 40.832 29.208 0.05 13.79 H ANISOU 674 HG13 VAL A 41 2067 1251 1922 -132 -252 -24 H ATOM 675 HG21 VAL A 41 7.843 42.724 30.095 0.05 13.00 H ANISOU 675 HG21 VAL A 41 2018 1085 1837 -89 -196 55 H ATOM 676 HG22 VAL A 41 6.400 42.920 30.728 0.05 13.19 H ANISOU 676 HG22 VAL A 41 1998 1118 1896 -64 -245 61 H ATOM 677 HG23 VAL A 41 7.666 42.756 31.685 0.05 12.55 H ANISOU 677 HG23 VAL A 41 1923 992 1854 -56 -187 56 H ATOM 678 N ARG A 42 4.667 38.575 31.727 0.05 13.30 N ANISOU 678 N ARG A 42 1910 1117 2026 -147 -177 -94 N ATOM 679 CA ARG A 42 4.308 37.157 31.909 0.05 13.53 C ANISOU 679 CA ARG A 42 1925 1124 2090 -187 -147 -142 C ATOM 680 C ARG A 42 4.995 36.284 30.882 0.05 13.81 C ANISOU 680 C ARG A 42 1998 1159 2090 -220 -136 -188 C ATOM 681 O ARG A 42 5.446 36.750 29.840 0.05 13.98 O ANISOU 681 O ARG A 42 2047 1216 2048 -222 -159 -189 O ATOM 682 CB ARG A 42 2.784 37.052 31.854 0.05 14.06 C ANISOU 682 CB ARG A 42 1930 1223 2187 -208 -182 -160 C ATOM 683 CG ARG A 42 2.070 37.797 32.988 0.05 13.89 C ANISOU 683 CG ARG A 42 1865 1200 2212 -173 -177 -124 C ATOM 684 CD ARG A 42 2.476 37.289 34.344 0.05 13.49 C ANISOU 684 CD ARG A 42 1831 1096 2200 -169 -109 -112 C ATOM 685 NE ARG A 42 1.778 38.046 35.398 0.05 13.45 N ANISOU 685 NE ARG A 42 1788 1096 2227 -138 -97 -87 N ATOM 686 CZ ARG A 42 1.966 37.841 36.673 0.05 13.23 C ANISOU 686 CZ ARG A 42 1773 1034 2219 -129 -43 -70 C ATOM 687 NH1 ARG A 42 2.813 36.906 37.105 0.05 13.03 N ANISOU 687 NH1 ARG A 42 1796 963 2189 -143 -3 -66 N ATOM 688 NH2 ARG A 42 1.271 38.534 37.569 0.05 13.32 N ANISOU 688 NH2 ARG A 42 1750 1057 2254 -104 -27 -57 N ATOM 689 H ARG A 42 4.015 39.055 31.465 0.05 13.54 H ANISOU 689 H ARG A 42 1919 1173 2052 -141 -212 -85 H ATOM 690 HA ARG A 42 4.633 36.893 32.771 0.05 13.23 H ANISOU 690 HA ARG A 42 1894 1051 2083 -176 -111 -131 H ATOM 691 HB2 ARG A 42 2.456 37.389 31.010 0.05 14.40 H ANISOU 691 HB2 ARG A 42 1966 1307 2198 -213 -228 -165 H ATOM 692 HB3 ARG A 42 2.552 36.115 31.945 0.05 14.27 H ANISOU 692 HB3 ARG A 42 1951 1233 2240 -242 -160 -192 H ATOM 693 HG2 ARG A 42 2.312 38.735 32.934 0.05 13.70 H ANISOU 693 HG2 ARG A 42 1852 1185 2169 -138 -196 -94 H ATOM 694 HG3 ARG A 42 1.115 37.711 32.893 0.05 14.31 H ANISOU 694 HG3 ARG A 42 1871 1278 2288 -187 -197 -140 H ATOM 695 HD2 ARG A 42 2.174 36.367 34.427 0.05 13.75 H ANISOU 695 HD2 ARG A 42 1856 1113 2255 -204 -87 -138 H ATOM 696 HD3 ARG A 42 3.427 37.331 34.484 0.05 13.13 H ANISOU 696 HD3 ARG A 42 1827 1028 2135 -153 -92 -99 H ATOM 697 HE ARG A 42 1.044 38.400 35.168 0.05 13.75 H ANISOU 697 HE ARG A 42 1785 1162 2276 -134 -123 -92 H ATOM 698 HH11 ARG A 42 3.269 36.458 36.538 0.05 13.02 H ANISOU 698 HH11 ARG A 42 1816 952 2177 -156 -9 -79 H ATOM 699 HH12 ARG A 42 2.941 36.793 37.944 0.05 12.94 H ANISOU 699 HH12 ARG A 42 1798 933 2185 -135 28 -51 H ATOM 700 HH21 ARG A 42 0.720 39.127 37.294 0.05 13.51 H ANISOU 700 HH21 ARG A 42 1740 1107 2287 -89 -54 -60 H ATOM 701 HH22 ARG A 42 1.396 38.420 38.404 0.05 13.23 H ANISOU 701 HH22 ARG A 42 1751 1028 2246 -100 9 -47 H ATOM 702 N PRO A 43 5.129 34.982 31.198 0.05 13.95 N ANISOU 702 N PRO A 43 2024 1129 2147 -247 -92 -227 N ATOM 703 CA PRO A 43 5.821 34.083 30.266 0.05 14.31 C ANISOU 703 CA PRO A 43 2107 1164 2168 -274 -71 -283 C ATOM 704 C PRO A 43 5.261 34.148 28.854 0.05 14.97 C ANISOU 704 C PRO A 43 2189 1311 2187 -313 -120 -326 C ATOM 705 O PRO A 43 4.042 34.166 28.655 0.05 15.39 O ANISOU 705 O PRO A 43 2202 1399 2247 -340 -166 -340 O ATOM 706 CB PRO A 43 5.508 32.702 30.877 0.05 14.60 C ANISOU 706 CB PRO A 43 2141 1134 2272 -303 -30 -318 C ATOM 707 CG PRO A 43 5.413 32.975 32.349 0.05 14.10 C ANISOU 707 CG PRO A 43 2065 1037 2256 -269 -8 -258 C ATOM 708 CD PRO A 43 4.674 34.289 32.416 0.05 13.89 C ANISOU 708 CD PRO A 43 1999 1071 2207 -252 -54 -220 C ATOM 709 HA PRO A 43 6.774 34.214 30.278 0.05 14.07 H ANISOU 709 HA PRO A 43 2101 1121 2124 -251 -49 -273 H ATOM 710 HB2 PRO A 43 4.668 32.394 30.518 0.05 15.03 H ANISOU 710 HB2 PRO A 43 2174 1205 2331 -340 -50 -348 H ATOM 711 HB3 PRO A 43 6.229 32.092 30.673 0.05 14.71 H ANISOU 711 HB3 PRO A 43 2185 1116 2289 -302 -1 -344 H ATOM 712 HG2 PRO A 43 4.903 32.286 32.796 0.05 14.34 H ANISOU 712 HG2 PRO A 43 2088 1033 2327 -292 12 -267 H ATOM 713 HG3 PRO A 43 6.294 33.072 32.734 0.05 13.77 H ANISOU 713 HG3 PRO A 43 2046 974 2213 -236 12 -235 H ATOM 714 HD2 PRO A 43 3.718 34.141 32.395 0.05 14.21 H ANISOU 714 HD2 PRO A 43 2006 1127 2267 -278 -69 -234 H ATOM 715 HD3 PRO A 43 4.945 34.758 33.211 0.05 13.49 H ANISOU 715 HD3 PRO A 43 1951 1009 2167 -220 -42 -181 H ATOM 716 N GLU A 44 6.167 34.186 27.879 0.05 15.15 N ANISOU 716 N GLU A 44 2255 1355 2147 -316 -110 -349 N ATOM 717 CA GLU A 44 5.790 34.202 26.453 0.05 15.91 C ANISOU 717 CA GLU A 44 2367 1519 2161 -355 -154 -392 C ATOM 718 C GLU A 44 4.894 35.330 26.037 0.05 16.10 C ANISOU 718 C GLU A 44 2366 1611 2139 -347 -235 -344 C ATOM 719 O GLU A 44 3.946 35.183 25.257 0.05 16.84 O ANISOU 719 O GLU A 44 2444 1759 2196 -381 -295 -378 O ATOM 720 CB GLU A 44 5.096 32.903 26.053 0.05 16.64 C ANISOU 720 CB GLU A 44 2451 1595 2275 -413 -152 -480 C ATOM 721 CG GLU A 44 5.819 31.659 26.286 0.05 16.86 C ANISOU 721 CG GLU A 44 2518 1561 2325 -426 -81 -546 C ATOM 722 CD GLU A 44 5.178 30.606 25.434 0.05 17.77 C ANISOU 722 CD GLU A 44 2631 1671 2449 -492 -93 -637 C ATOM 723 OE1 GLU A 44 5.606 30.507 24.285 0.05 18.49 O ANISOU 723 OE1 GLU A 44 2753 1809 2463 -527 -108 -702 O ATOM 724 OE2 GLU A 44 4.189 29.978 25.817 0.05 17.85 O ANISOU 724 OE2 GLU A 44 2609 1636 2538 -516 -90 -646 O ATOM 725 H GLU A 44 7.013 34.201 28.018 0.05 14.92 H ANISOU 725 H GLU A 44 2245 1305 2117 -297 -77 -342 H ATOM 726 HA GLU A 44 6.598 34.261 25.929 0.05 15.98 H ANISOU 726 HA GLU A 44 2410 1538 2125 -353 -132 -401 H ATOM 727 HB2 GLU A 44 4.259 32.846 26.535 0.05 16.54 H ANISOU 727 HB2 GLU A 44 2405 1558 2321 -417 -155 -472 H ATOM 728 HB3 GLU A 44 4.909 32.945 25.104 0.05 17.18 H ANISOU 728 HB3 GLU A 44 2522 1717 2290 -440 -195 -506 H ATOM 729 HG2 GLU A 44 6.747 31.754 26.029 0.05 16.94 H ANISOU 729 HG2 GLU A 44 2560 1594 2284 -418 -65 -555 H ATOM 730 HG3 GLU A 44 5.740 31.401 27.218 0.05 16.45 H ANISOU 730 HG3 GLU A 44 2463 1453 2336 -402 -44 -524 H ATOM 731 N THR A 45 5.220 36.514 26.548 0.05 15.52 N ANISOU 731 N THR A 45 2291 1534 2070 -297 -240 -266 N ATOM 732 CA THR A 45 4.466 37.717 26.212 0.05 15.70 C ANISOU 732 CA THR A 45 2298 1606 2064 -272 -313 -207 C ATOM 733 C THR A 45 5.455 38.916 26.070 0.05 15.45 C ANISOU 733 C THR A 45 2316 1574 1980 -243 -300 -147 C ATOM 734 O THR A 45 6.636 38.766 26.409 0.05 15.02 O ANISOU 734 O THR A 45 2290 1484 1933 -240 -234 -150 O ATOM 735 CB THR A 45 3.253 37.897 27.200 0.05 15.38 C ANISOU 735 CB THR A 45 2190 1544 2108 -238 -332 -173 C ATOM 736 OG1 THR A 45 2.218 36.875 26.956 0.05 15.69 O ANISOU 736 OG1 THR A 45 2178 1581 2204 -274 -333 -227 O ATOM 737 CG2 THR A 45 2.636 39.193 27.106 0.05 15.74 C ANISOU 737 CG2 THR A 45 2213 1631 2135 -203 -407 -122 C ATOM 738 H THR A 45 5.865 36.620 27.086 0.05 15.06 H ANISOU 738 H THR A 45 2243 1443 2037 -277 -203 -248 H ATOM 739 HA THR A 45 4.069 37.594 25.336 0.05 16.32 H ANISOU 739 HA THR A 45 2374 1729 2098 -294 -359 -229 H ATOM 740 HB THR A 45 3.599 37.836 28.106 0.05 14.81 H ANISOU 740 HB THR A 45 2126 1432 2069 -213 -293 -147 H ATOM 741 HG1 THR A 45 1.528 37.046 27.404 0.05 15.57 H ANISOU 741 HG1 THR A 45 2177 1535 2204 -293 -292 -255 H ATOM 742 HG21 THR A 45 2.172 39.372 27.944 0.05 15.56 H ANISOU 742 HG21 THR A 45 2147 1593 2171 -181 -407 -109 H ATOM 743 HG22 THR A 45 3.262 39.903 26.961 0.05 15.63 H ANISOU 743 HG22 THR A 45 2236 1617 2087 -181 -411 -80 H ATOM 744 HG23 THR A 45 1.976 39.167 26.409 0.05 16.35 H ANISOU 744 HG23 THR A 45 2276 1752 2184 -224 -454 -146 H ATOM 745 N LYS A 46 4.962 40.038 25.534 0.05 15.79 N ANISOU 745 N LYS A 46 2367 1653 1981 -220 -363 -89 N ATOM 746 CA LYS A 46 5.694 41.329 25.447 0.05 15.58 C ANISOU 746 CA LYS A 46 2383 1609 1927 -192 -351 -18 C ATOM 747 C LYS A 46 4.889 42.521 25.964 0.05 15.64 C ANISOU 747 C LYS A 46 2368 1610 1966 -142 -409 48 C ATOM 748 O LYS A 46 3.655 42.507 25.978 0.05 16.03 O ANISOU 748 O LYS A 46 2367 1684 2039 -127 -470 43 O ATOM 749 CB LYS A 46 6.224 41.597 24.007 0.05 16.20 C ANISOU 749 CB LYS A 46 2532 1730 1893 -224 -345 -11 C ATOM 750 CG LYS A 46 5.215 41.603 22.873 0.05 17.00 C ANISOU 750 CG LYS A 46 2646 1894 1921 -266 -379 -68 C ATOM 751 CD LYS A 46 4.194 42.737 22.814 0.05 17.70 C ANISOU 751 CD LYS A 46 2711 2030 1984 -250 -484 -39 C ATOM 752 CE LYS A 46 4.675 43.990 22.036 0.05 18.20 C ANISOU 752 CE LYS A 46 2825 2111 1978 -223 -530 54 C ATOM 753 NZ LYS A 46 3.488 44.668 21.468 0.05 18.23 N ANISOU 753 NZ LYS A 46 2774 2100 2051 -164 -603 106 N ATOM 754 H LYS A 46 4.179 40.101 25.198 0.05 16.22 H ANISOU 754 H LYS A 46 2401 1738 2023 -220 -415 -88 H ATOM 755 HA LYS A 46 6.471 41.259 26.022 0.05 15.03 H ANISOU 755 HA LYS A 46 2313 1501 1897 -185 -299 -20 H ATOM 756 HB2 LYS A 46 6.679 42.454 23.985 0.05 16.43 H ANISOU 756 HB2 LYS A 46 2584 1764 1893 -207 -375 46 H ATOM 757 HB3 LYS A 46 6.862 40.897 23.793 0.05 15.91 H ANISOU 757 HB3 LYS A 46 2513 1673 1859 -235 -286 -25 H ATOM 758 HG2 LYS A 46 5.712 41.634 22.041 0.05 17.37 H ANISOU 758 HG2 LYS A 46 2740 1964 1895 -289 -358 -71 H ATOM 759 HG3 LYS A 46 4.716 40.775 22.918 0.05 16.82 H ANISOU 759 HG3 LYS A 46 2594 1856 1939 -281 -355 -124 H ATOM 760 HD2 LYS A 46 3.422 42.401 22.332 0.05 18.26 H ANISOU 760 HD2 LYS A 46 2784 2144 2009 -282 -509 -85 H ATOM 761 HD3 LYS A 46 3.935 43.014 23.697 0.05 17.39 H ANISOU 761 HD3 LYS A 46 2619 1969 2019 -226 -500 -35 H ATOM 762 HE2 LYS A 46 5.141 44.598 22.608 0.05 17.86 H ANISOU 762 HE2 LYS A 46 2817 2036 1934 -220 -480 83 H ATOM 763 HE3 LYS A 46 5.259 43.736 21.304 0.05 18.94 H ANISOU 763 HE3 LYS A 46 2954 2258 1987 -245 -566 50 H ATOM 764 HZ1 LYS A 46 3.678 45.515 21.286 0.05 18.41 H ANISOU 764 HZ1 LYS A 46 2829 2111 2053 -140 -620 167 H ATOM 765 HZ2 LYS A 46 3.231 44.252 20.724 0.05 18.75 H ANISOU 765 HZ2 LYS A 46 2813 2207 2102 -166 -661 89 H ATOM 766 HZ3 LYS A 46 2.824 44.644 22.058 0.05 17.63 H ANISOU 766 HZ3 LYS A 46 2659 1986 2052 -149 -573 93 H ATOM 767 N SER A 47 5.641 43.563 26.332 0.05 15.38 N ANISOU 767 N SER A 47 2369 1538 1936 -116 -388 107 N ATOM 768 CA SER A 47 5.213 44.898 26.813 0.05 15.41 C ANISOU 768 CA SER A 47 2360 1511 1985 -62 -427 168 C ATOM 769 C SER A 47 4.709 45.772 25.644 0.05 16.37 C ANISOU 769 C SER A 47 2525 1662 2030 -47 -501 233 C ATOM 770 O SER A 47 5.104 45.551 24.524 0.05 16.86 O ANISOU 770 O SER A 47 2642 1766 1998 -87 -502 235 O ATOM 771 CB SER A 47 6.496 45.579 27.394 0.05 14.73 C ANISOU 771 CB SER A 47 2294 1360 1943 -50 -363 189 C ATOM 772 OG SER A 47 7.482 44.679 26.989 0.05 14.23 O ANISOU 772 OG SER A 47 2237 1293 1878 -88 -292 141 O ATOM 773 H SER A 47 6.490 43.503 26.285 0.05 15.23 H ANISOU 773 H SER A 47 2381 1507 1897 -131 -348 110 H ATOM 774 HA SER A 47 4.538 44.821 27.496 0.05 15.37 H ANISOU 774 HA SER A 47 2304 1507 2028 -43 -447 151 H ATOM 775 HB2 SER A 47 6.668 46.421 26.980 0.05 14.99 H ANISOU 775 HB2 SER A 47 2369 1380 1945 -49 -367 232 H ATOM 776 HB3 SER A 47 6.464 45.634 28.354 0.05 14.48 H ANISOU 776 HB3 SER A 47 2229 1303 1970 -21 -365 189 H ATOM 777 HG SER A 47 7.485 44.034 27.522 0.05 13.81 H ANISOU 777 HG SER A 47 2162 1214 1872 -77 -270 130 H ATOM 778 N PHE A 48 3.884 46.777 25.920 0.05 16.77 N ANISOU 778 N PHE A 48 2555 1698 2118 10 -563 283 N ATOM 779 CA PHE A 48 3.355 47.722 24.901 0.05 17.81 C ANISOU 779 CA PHE A 48 2741 1851 2174 30 -638 357 C ATOM 780 C PHE A 48 4.443 48.765 24.700 0.05 17.87 C ANISOU 780 C PHE A 48 2831 1799 2159 30 -602 429 C ATOM 781 O PHE A 48 5.040 49.273 25.617 0.05 17.28 O ANISOU 781 O PHE A 48 2756 1657 2154 45 -551 435 O ATOM 782 CB PHE A 48 1.932 48.132 25.406 0.05 18.70 C ANISOU 782 CB PHE A 48 2798 2005 2303 84 -749 376 C ATOM 783 CG PHE A 48 1.347 49.490 25.015 0.05 19.00 C ANISOU 783 CG PHE A 48 2811 1985 2424 168 -789 434 C ATOM 784 CD1 PHE A 48 -0.053 49.566 25.126 0.05 19.88 C ANISOU 784 CD1 PHE A 48 2854 2136 2563 224 -887 443 C ATOM 785 CD2 PHE A 48 2.052 50.664 24.752 0.05 18.56 C ANISOU 785 CD2 PHE A 48 2787 1841 2424 194 -736 467 C ATOM 786 CE1 PHE A 48 -0.768 50.748 24.891 0.05 20.32 C ANISOU 786 CE1 PHE A 48 2875 2143 2705 312 -927 486 C ATOM 787 CE2 PHE A 48 1.324 51.883 24.494 0.05 19.01 C ANISOU 787 CE2 PHE A 48 2818 1845 2562 277 -776 507 C ATOM 788 CZ PHE A 48 -0.090 51.897 24.589 0.05 19.88 C ANISOU 788 CZ PHE A 48 2860 1991 2702 338 -867 517 C ATOM 789 H PHE A 48 3.608 46.957 26.710 0.05 16.55 H ANISOU 789 H PHE A 48 2486 1647 2154 40 -564 277 H ATOM 790 HA PHE A 48 3.254 47.257 24.055 0.05 18.10 H ANISOU 790 HA PHE A 48 2806 1934 2138 -10 -642 342 H ATOM 791 HB2 PHE A 48 1.298 47.470 25.081 0.05 19.41 H ANISOU 791 HB2 PHE A 48 2928 2134 2314 74 -796 405 H ATOM 792 HB3 PHE A 48 1.959 48.119 26.362 0.05 18.54 H ANISOU 792 HB3 PHE A 48 2717 2014 2314 73 -752 321 H ATOM 793 HD1 PHE A 48 -0.523 48.790 25.342 0.05 20.25 H ANISOU 793 HD1 PHE A 48 2874 2246 2573 202 -928 415 H ATOM 794 HD2 PHE A 48 2.977 50.667 24.694 0.05 18.04 H ANISOU 794 HD2 PHE A 48 2759 1750 2345 158 -674 459 H ATOM 795 HE1 PHE A 48 -1.696 50.746 24.944 0.05 20.99 H ANISOU 795 HE1 PHE A 48 2906 2259 2811 351 -994 490 H ATOM 796 HE2 PHE A 48 1.786 52.656 24.288 0.05 18.80 H ANISOU 796 HE2 PHE A 48 2816 1755 2571 292 -741 525 H ATOM 797 HZ PHE A 48 -0.563 52.677 24.416 0.05 20.24 H ANISOU 797 HZ PHE A 48 2886 1997 2806 398 -890 541 H ATOM 798 N ARG A 49 4.796 48.933 23.438 0.05 18.63 N ANISOU 798 N ARG A 49 3004 1929 2143 -2 -618 472 N ATOM 799 CA ARG A 49 5.947 49.744 23.067 0.05 18.79 C ANISOU 799 CA ARG A 49 3112 1905 2123 -30 -564 532 C ATOM 800 C ARG A 49 5.593 51.220 23.142 0.05 19.43 C ANISOU 800 C ARG A 49 3228 1916 2238 30 -615 627 C ATOM 801 O ARG A 49 4.538 51.600 22.624 0.05 20.31 O ANISOU 801 O ARG A 49 3339 2052 2328 80 -712 673 O ATOM 802 CB ARG A 49 6.361 49.353 21.637 0.05 19.57 C ANISOU 802 CB ARG A 49 3282 2074 2079 -90 -560 542 C ATOM 803 CG ARG A 49 6.331 50.481 20.633 0.05 20.89 C ANISOU 803 CG ARG A 49 3528 2255 2156 -70 -638 644 C ATOM 804 CD ARG A 49 6.661 49.950 19.256 0.05 21.78 C ANISOU 804 CD ARG A 49 3693 2465 2118 -120 -661 635 C ATOM 805 NE ARG A 49 7.925 50.466 18.775 0.05 22.15 N ANISOU 805 NE ARG A 49 3833 2507 2076 -184 -575 671 N ATOM 806 CZ ARG A 49 8.156 50.843 17.516 0.05 23.43 C ANISOU 806 CZ ARG A 49 4099 2689 2114 -203 -601 763 C ATOM 807 NH1 ARG A 49 7.216 50.685 16.587 0.05 24.52 N ANISOU 807 NH1 ARG A 49 4267 2851 2197 -152 -723 838 N ATOM 808 NH2 ARG A 49 9.347 51.331 17.194 0.05 23.71 N ANISOU 808 NH2 ARG A 49 4208 2721 2081 -272 -500 784 N ATOM 809 H ARG A 49 4.398 48.566 22.776 0.05 19.11 H ANISOU 809 H ARG A 49 3070 2043 2148 -14 -657 465 H ATOM 810 HA ARG A 49 6.670 49.591 23.678 0.05 18.11 H ANISOU 810 HA ARG A 49 3015 1788 2080 -50 -498 502 H ATOM 811 HB2 ARG A 49 7.258 48.993 21.652 0.05 19.34 H ANISOU 811 HB2 ARG A 49 3282 2031 2034 -130 -489 535 H ATOM 812 HB3 ARG A 49 5.748 48.673 21.327 0.05 19.53 H ANISOU 812 HB3 ARG A 49 3244 2123 2053 -103 -576 487 H ATOM 813 HG2 ARG A 49 5.450 50.877 20.583 0.05 21.16 H ANISOU 813 HG2 ARG A 49 3531 2284 2224 -17 -710 665 H ATOM 814 HG3 ARG A 49 6.991 51.153 20.869 0.05 21.05 H ANISOU 814 HG3 ARG A 49 3600 2225 2174 -78 -604 699 H ATOM 815 HD2 ARG A 49 6.738 48.982 19.317 0.05 21.36 H ANISOU 815 HD2 ARG A 49 3595 2452 2070 -142 -645 556 H ATOM 816 HD3 ARG A 49 5.948 50.199 18.647 0.05 22.59 H ANISOU 816 HD3 ARG A 49 3813 2594 2178 -90 -745 681 H ATOM 817 HE ARG A 49 8.617 50.291 19.259 0.05 21.54 H ANISOU 817 HE ARG A 49 3743 2397 2044 -206 -504 645 H ATOM 818 HH11 ARG A 49 6.443 50.374 16.795 0.05 24.40 H ANISOU 818 HH11 ARG A 49 4197 2843 2231 -107 -786 822 H ATOM 819 HH12 ARG A 49 7.372 50.924 15.775 0.05 25.40 H ANISOU 819 HH12 ARG A 49 4453 2975 2223 -164 -739 904 H ATOM 820 HH21 ARG A 49 9.955 51.414 17.797 0.05 23.07 H ANISOU 820 HH21 ARG A 49 4101 2626 2040 -301 -426 735 H ATOM 821 HH22 ARG A 49 9.517 51.557 16.383 0.05 24.59 H ANISOU 821 HH22 ARG A 49 4392 2843 2107 -289 -509 846 H ATOM 822 N HIS A 50 6.434 52.030 23.805 0.05 19.08 N ANISOU 822 N HIS A 50 3209 1784 2256 30 -556 652 N ATOM 823 CA HIS A 50 6.216 53.486 23.830 0.05 19.84 C ANISOU 823 CA HIS A 50 3355 1795 2388 83 -596 744 C ATOM 824 C HIS A 50 7.568 54.177 23.975 0.05 19.81 C ANISOU 824 C HIS A 50 3423 1721 2385 29 -512 777 C ATOM 825 O HIS A 50 8.596 53.561 24.006 0.05 19.26 O ANISOU 825 O HIS A 50 3353 1678 2288 -41 -432 730 O ATOM 826 CB HIS A 50 5.213 53.910 24.932 0.05 19.63 C ANISOU 826 CB HIS A 50 3256 1712 2488 170 -635 727 C ATOM 827 CG HIS A 50 5.726 53.874 26.355 0.05 18.58 C ANISOU 827 CG HIS A 50 3083 1524 2452 161 -556 663 C ATOM 828 ND1 HIS A 50 6.961 53.383 26.717 0.05 17.78 N ANISOU 828 ND1 HIS A 50 2985 1436 2335 88 -472 613 N ATOM 829 CD2 HIS A 50 5.127 54.249 27.511 0.05 18.30 C ANISOU 829 CD2 HIS A 50 3002 1427 2525 216 -551 636 C ATOM 830 CE1 HIS A 50 7.104 53.470 28.031 0.05 17.07 C ANISOU 830 CE1 HIS A 50 2857 1298 2331 98 -427 564 C ATOM 831 NE2 HIS A 50 6.003 53.980 28.540 0.05 17.36 N ANISOU 831 NE2 HIS A 50 2867 1288 2440 172 -469 574 N ATOM 832 H HIS A 50 7.144 51.793 24.228 0.05 18.51 H ANISOU 832 H HIS A 50 3130 1696 2205 -1 -495 619 H ATOM 833 HA HIS A 50 5.839 53.732 22.978 0.05 20.67 H ANISOU 833 HA HIS A 50 3499 1926 2429 94 -651 796 H ATOM 834 HB2 HIS A 50 4.924 54.820 24.749 0.05 20.33 H ANISOU 834 HB2 HIS A 50 3386 1750 2590 208 -669 792 H ATOM 835 HB3 HIS A 50 4.447 53.319 24.894 0.05 19.62 H ANISOU 835 HB3 HIS A 50 3199 1763 2494 196 -679 698 H ATOM 836 HD2 HIS A 50 4.281 54.608 27.593 0.05 18.73 H ANISOU 836 HD2 HIS A 50 3037 1457 2621 275 -594 653 H ATOM 837 HE1 HIS A 50 7.840 53.213 28.519 0.05 16.53 H ANISOU 837 HE1 HIS A 50 2781 1230 2272 62 -376 528 H ATOM 838 N SER A 51 7.605 55.491 24.052 0.05 20.52 N ANISOU 838 N SER A 51 3571 1714 2511 60 -527 856 N ATOM 839 CA SER A 51 8.721 56.148 24.771 0.05 20.43 C ANISOU 839 CA SER A 51 3608 1617 2538 7 -443 870 C ATOM 840 C SER A 51 8.101 57.481 25.185 0.05 21.18 C ANISOU 840 C SER A 51 3750 1587 2710 63 -472 939 C ATOM 841 O SER A 51 6.907 57.739 24.934 0.05 21.74 O ANISOU 841 O SER A 51 3810 1642 2809 150 -558 975 O ATOM 842 CB SER A 51 10.052 56.413 23.971 0.05 20.90 C ANISOU 842 CB SER A 51 3744 1702 2494 -89 -375 906 C ATOM 843 OG SER A 51 11.041 55.322 23.895 0.05 20.04 O ANISOU 843 OG SER A 51 3595 1609 2409 -161 -277 827 O ATOM 844 H SER A 51 7.022 56.021 23.716 0.05 21.10 H ANISOU 844 H SER A 51 3656 1767 2594 110 -585 900 H ATOM 845 HA SER A 51 8.920 55.659 25.571 0.05 19.59 H ANISOU 845 HA SER A 51 3447 1512 2484 -4 -403 801 H ATOM 846 HB2 SER A 51 9.797 56.666 23.066 0.05 21.16 H ANISOU 846 HB2 SER A 51 3787 1807 2448 -96 -401 913 H ATOM 847 HB3 SER A 51 10.506 57.167 24.355 0.05 21.66 H ANISOU 847 HB3 SER A 51 3908 1737 2585 -96 -374 977 H ATOM 848 HG SER A 51 11.755 55.551 24.244 0.05 19.42 H ANISOU 848 HG SER A 51 3465 1516 2396 -138 -276 780 H ATOM 849 N HIS A 52 8.928 58.337 25.771 0.05 21.24 N ANISOU 849 N HIS A 52 3801 1506 2764 14 -403 948 N ATOM 850 CA HIS A 52 8.470 59.529 26.453 0.05 21.68 C ANISOU 850 CA HIS A 52 3874 1434 2927 73 -421 970 C ATOM 851 C HIS A 52 9.680 60.467 26.692 0.05 22.34 C ANISOU 851 C HIS A 52 4040 1384 3062 20 -359 1011 C ATOM 852 O HIS A 52 10.805 60.003 26.785 0.05 22.66 O ANISOU 852 O HIS A 52 4137 1422 3050 -74 -295 1041 O ATOM 853 CB HIS A 52 7.803 59.118 27.774 0.05 20.65 C ANISOU 853 CB HIS A 52 3635 1321 2891 136 -433 867 C ATOM 854 CG HIS A 52 8.393 57.867 28.412 0.05 19.33 C ANISOU 854 CG HIS A 52 3387 1246 2711 85 -380 764 C ATOM 855 ND1 HIS A 52 9.649 57.846 28.983 0.05 18.75 N ANISOU 855 ND1 HIS A 52 3304 1151 2668 19 -303 709 N ATOM 856 CD2 HIS A 52 7.892 56.617 28.598 0.05 18.58 C ANISOU 856 CD2 HIS A 52 3217 1256 2589 97 -397 706 C ATOM 857 CE1 HIS A 52 9.916 56.655 29.466 0.05 17.74 C ANISOU 857 CE1 HIS A 52 3104 1110 2526 -2 -279 631 C ATOM 858 NE2 HIS A 52 8.860 55.877 29.260 0.05 17.60 N ANISOU 858 NE2 HIS A 52 3047 1164 2476 43 -331 626 N ATOM 859 H HIS A 52 9.783 58.257 25.787 0.05 21.11 H ANISOU 859 H HIS A 52 3801 1499 2723 -49 -347 938 H ATOM 860 HA HIS A 52 7.822 59.984 25.900 0.05 22.43 H ANISOU 860 HA HIS A 52 4000 1513 3009 126 -482 1033 H ATOM 861 HB2 HIS A 52 7.905 59.837 28.412 0.05 20.75 H ANISOU 861 HB2 HIS A 52 3655 1254 2975 152 -417 855 H ATOM 862 HB3 HIS A 52 6.859 58.966 27.604 0.05 20.88 H ANISOU 862 HB3 HIS A 52 3638 1376 2918 197 -493 881 H ATOM 863 HD2 HIS A 52 7.055 56.317 28.329 0.05 18.77 H ANISOU 863 HD2 HIS A 52 3222 1321 2591 134 -447 718 H ATOM 864 HE1 HIS A 52 10.702 56.399 29.896 0.05 17.27 H ANISOU 864 HE1 HIS A 52 3022 1058 2481 -40 -235 586 H ATOM 865 N ASN A 53 9.477 61.798 26.737 0.05 22.68 N ANISOU 865 N ASN A 53 4092 1313 3212 78 -375 1008 N ATOM 866 CA ASN A 53 10.530 62.684 27.270 0.05 23.13 C ANISOU 866 CA ASN A 53 4206 1251 3330 17 -310 1013 C ATOM 867 C ASN A 53 10.870 62.368 28.739 0.05 21.89 C ANISOU 867 C ASN A 53 3966 1136 3216 -32 -250 888 C ATOM 868 O ASN A 53 11.997 62.611 29.145 0.05 21.83 O ANISOU 868 O ASN A 53 3970 1113 3212 -127 -180 863 O ATOM 869 CB ASN A 53 10.347 64.244 27.069 0.05 24.03 C ANISOU 869 CB ASN A 53 4362 1216 3553 98 -344 1040 C ATOM 870 CG ASN A 53 9.019 64.659 26.430 0.05 25.12 C ANISOU 870 CG ASN A 53 4544 1326 3676 199 -435 1143 C ATOM 871 OD1 ASN A 53 8.068 63.900 26.335 0.05 25.03 O ANISOU 871 OD1 ASN A 53 4468 1324 3718 308 -497 1113 O ATOM 872 ND2 ASN A 53 8.943 65.933 26.034 0.05 26.38 N ANISOU 872 ND2 ASN A 53 4816 1435 3770 168 -444 1269 N ATOM 873 H ASN A 53 8.770 62.201 26.465 0.05 22.71 H ANISOU 873 H ASN A 53 4066 1305 3257 149 -418 999 H ATOM 874 HA ASN A 53 11.335 62.457 26.787 0.05 23.67 H ANISOU 874 HA ASN A 53 4336 1310 3348 -45 -281 1068 H ATOM 875 HB2 ASN A 53 10.400 64.681 27.933 0.05 23.44 H ANISOU 875 HB2 ASN A 53 4225 1145 3537 136 -345 964 H ATOM 876 HB3 ASN A 53 11.064 64.574 26.500 0.05 24.59 H ANISOU 876 HB3 ASN A 53 4491 1201 3650 48 -304 1062 H ATOM 877 HD21 ASN A 53 8.175 66.305 25.922 0.05 26.92 H ANISOU 877 HD21 ASN A 53 4907 1525 3797 214 -500 1331 H ATOM 878 HD22 ASN A 53 9.662 66.378 25.874 0.05 26.68 H ANISOU 878 HD22 ASN A 53 4907 1425 3807 101 -394 1288 H ATOM 879 N GLU A 54 9.953 61.785 29.517 0.05 20.99 N ANISOU 879 N GLU A 54 3762 1082 3131 33 -279 811 N ATOM 880 CA GLU A 54 10.343 61.333 30.859 0.05 20.13 C ANISOU 880 CA GLU A 54 3589 975 3086 20 -241 703 C ATOM 881 C GLU A 54 11.692 60.536 30.725 0.05 19.21 C ANISOU 881 C GLU A 54 3422 957 2920 -67 -187 644 C ATOM 882 O GLU A 54 11.937 59.883 29.651 0.05 18.87 O ANISOU 882 O GLU A 54 3359 1013 2797 -83 -191 659 O ATOM 883 CB GLU A 54 9.179 60.544 31.596 0.05 19.81 C ANISOU 883 CB GLU A 54 3485 949 3094 127 -291 660 C ATOM 884 CG GLU A 54 7.931 61.412 32.246 0.05 21.10 C ANISOU 884 CG GLU A 54 3709 985 3323 210 -337 727 C ATOM 885 CD GLU A 54 7.401 62.557 31.365 0.05 21.31 C ANISOU 885 CD GLU A 54 3686 1045 3367 326 -410 741 C ATOM 886 OE1 GLU A 54 8.227 63.439 31.072 0.05 22.42 O ANISOU 886 OE1 GLU A 54 3876 1133 3510 387 -469 833 O ATOM 887 OE2 GLU A 54 6.205 62.538 30.952 0.05 20.48 O ANISOU 887 OE2 GLU A 54 3490 1015 3276 355 -409 661 O ATOM 888 H GLU A 54 9.131 61.640 29.302 0.05 20.92 H ANISOU 888 H GLU A 54 3728 1114 3104 85 -323 821 H ATOM 889 HA GLU A 54 10.535 62.116 31.393 0.05 20.58 H ANISOU 889 HA GLU A 54 3682 946 3194 1 -219 700 H ATOM 890 HB2 GLU A 54 8.796 59.920 30.960 0.05 19.49 H ANISOU 890 HB2 GLU A 54 3410 987 3010 147 -318 666 H ATOM 891 HB3 GLU A 54 9.582 60.045 32.319 0.05 19.30 H ANISOU 891 HB3 GLU A 54 3380 887 3067 124 -267 588 H ATOM 892 HG2 GLU A 54 7.185 60.830 32.443 0.05 21.25 H ANISOU 892 HG2 GLU A 54 3736 932 3405 214 -314 688 H ATOM 893 HG3 GLU A 54 8.241 61.802 33.079 0.05 21.79 H ANISOU 893 HG3 GLU A 54 3863 1033 3382 186 -341 801 H ATOM 894 N TYR A 55 12.556 60.650 31.760 0.05 19.00 N ANISOU 894 N TYR A 55 3380 900 2941 -125 -137 580 N ATOM 895 CA TYR A 55 13.732 59.779 32.040 0.05 18.26 C ANISOU 895 CA TYR A 55 3229 892 2818 -198 -90 518 C ATOM 896 C TYR A 55 13.192 58.545 32.700 0.05 17.19 C ANISOU 896 C TYR A 55 3011 849 2672 -144 -114 453 C ATOM 897 O TYR A 55 12.213 58.597 33.409 0.05 17.01 O ANISOU 897 O TYR A 55 2968 810 2685 -70 -148 429 O ATOM 898 CB TYR A 55 14.668 60.380 33.090 0.05 18.46 C ANISOU 898 CB TYR A 55 3248 860 2905 -265 -47 460 C ATOM 899 CG TYR A 55 15.381 61.650 32.682 0.05 19.68 C ANISOU 899 CG TYR A 55 3490 903 3084 -328 -17 524 C ATOM 900 CD1 TYR A 55 14.775 62.889 32.800 0.05 20.52 C ANISOU 900 CD1 TYR A 55 3668 886 3243 -281 -43 568 C ATOM 901 CD2 TYR A 55 16.685 61.591 32.222 0.05 20.11 C ANISOU 901 CD2 TYR A 55 3556 975 3109 -435 43 545 C ATOM 902 CE1 TYR A 55 15.427 64.021 32.409 0.05 21.75 C ANISOU 902 CE1 TYR A 55 3913 929 3421 -339 -14 637 C ATOM 903 CE2 TYR A 55 17.358 62.741 31.844 0.05 21.36 C ANISOU 903 CE2 TYR A 55 3799 1026 3289 -503 79 610 C ATOM 904 CZ TYR A 55 16.714 63.927 31.932 0.05 22.15 C ANISOU 904 CZ TYR A 55 3979 997 3440 -453 48 660 C ATOM 905 OH TYR A 55 17.395 65.044 31.588 0.05 23.50 O ANISOU 905 OH TYR A 55 4246 1048 3637 -521 85 733 O ATOM 906 H TYR A 55 12.471 61.249 32.361 0.05 19.34 H ANISOU 906 H TYR A 55 3443 871 3035 -120 -133 568 H ATOM 907 HA TYR A 55 14.224 59.554 31.238 0.05 18.43 H ANISOU 907 HA TYR A 55 3266 948 2787 -238 -72 554 H ATOM 908 HB2 TYR A 55 14.152 60.552 33.889 0.05 18.29 H ANISOU 908 HB2 TYR A 55 3211 812 2926 -227 -63 416 H ATOM 909 HB3 TYR A 55 15.367 59.744 33.293 0.05 18.07 H ANISOU 909 HB3 TYR A 55 3157 871 2838 -310 -21 424 H ATOM 910 HD1 TYR A 55 13.899 62.948 33.100 0.05 20.34 H ANISOU 910 HD1 TYR A 55 3634 851 3243 -209 -78 553 H ATOM 911 HD2 TYR A 55 17.111 60.771 32.147 0.05 19.63 H ANISOU 911 HD2 TYR A 55 3445 995 3020 -463 63 514 H ATOM 912 HE1 TYR A 55 15.012 64.850 32.485 0.05 22.37 H ANISOU 912 HE1 TYR A 55 4042 916 3541 -301 -33 666 H ATOM 913 HE2 TYR A 55 18.229 62.703 31.524 0.05 21.70 H ANISOU 913 HE2 TYR A 55 3847 1084 3315 -578 125 623 H ATOM 914 HH TYR A 55 18.055 64.831 31.112 0.05 23.69 H ANISOU 914 HH TYR A 55 4268 1102 3630 -590 125 746 H ATOM 915 N GLU A 56 13.873 57.424 32.453 0.05 16.60 N ANISOU 915 N GLU A 56 2891 871 2546 -183 -90 428 N ATOM 916 CA GLU A 56 13.449 56.138 32.997 0.05 15.67 C ANISOU 916 CA GLU A 56 2702 837 2414 -142 -106 372 C ATOM 917 C GLU A 56 14.622 55.202 33.114 0.05 15.20 C ANISOU 917 C GLU A 56 2595 847 2334 -198 -65 325 C ATOM 918 O GLU A 56 15.545 55.218 32.335 0.05 15.55 O ANISOU 918 O GLU A 56 2653 908 2348 -259 -28 346 O ATOM 919 CB GLU A 56 12.324 55.566 32.138 0.05 15.66 C ANISOU 919 CB GLU A 56 2704 881 2365 -93 -147 414 C ATOM 920 CG GLU A 56 11.676 54.298 32.751 0.05 14.82 C ANISOU 920 CG GLU A 56 2528 853 2250 -56 -161 360 C ATOM 921 CD GLU A 56 10.460 53.812 31.976 0.05 14.96 C ANISOU 921 CD GLU A 56 2539 903 2241 -2 -213 390 C ATOM 922 OE1 GLU A 56 9.693 52.954 32.491 0.05 14.46 O ANISOU 922 OE1 GLU A 56 2421 883 2191 34 -227 349 O ATOM 923 OE2 GLU A 56 10.301 54.288 30.836 0.05 15.68 O ANISOU 923 OE2 GLU A 56 2683 978 2298 -1 -239 458 O ATOM 924 H GLU A 56 14.581 57.377 31.984 0.05 16.77 H ANISOU 924 H GLU A 56 2922 909 2543 -232 -62 441 H ATOM 925 HA GLU A 56 13.115 56.292 33.883 0.05 15.48 H ANISOU 925 HA GLU A 56 2660 792 2429 -110 -117 338 H ATOM 926 HB2 GLU A 56 11.618 56.226 32.069 0.05 16.04 H ANISOU 926 HB2 GLU A 56 2777 885 2434 -52 -177 444 H ATOM 927 HB3 GLU A 56 12.674 55.360 31.261 0.05 15.92 H ANISOU 927 HB3 GLU A 56 2761 937 2350 -127 -136 447 H ATOM 928 HG2 GLU A 56 12.338 53.589 32.760 0.05 14.54 H ANISOU 928 HG2 GLU A 56 2475 863 2188 -90 -137 341 H ATOM 929 HG3 GLU A 56 11.395 54.500 33.650 0.05 14.55 H ANISOU 929 HG3 GLU A 56 2470 803 2256 -34 -161 322 H ATOM 930 N ALEU A 57 14.474 54.321 34.083 0.02 14.50 N ANISOU 930 N ALEU A 57 2447 798 2264 -171 -70 262 N ATOM 931 N BLEU A 57 14.568 54.393 34.177 0.03 14.50 N ANISOU 931 N BLEU A 57 2447 798 2264 -171 -71 262 N ATOM 932 CA ALEU A 57 15.484 53.375 34.480 0.02 14.06 C ANISOU 932 CA ALEU A 57 2336 808 2198 -202 -44 214 C ATOM 933 CA BLEU A 57 15.574 53.384 34.541 0.03 14.06 C ANISOU 933 CA BLEU A 57 2336 808 2199 -202 -44 213 C ATOM 934 C ALEU A 57 14.809 52.072 34.882 0.02 13.38 C ANISOU 934 C ALEU A 57 2210 778 2095 -149 -64 189 C ATOM 935 C BLEU A 57 14.838 52.080 34.896 0.03 13.37 C ANISOU 935 C BLEU A 57 2208 777 2095 -150 -64 187 C ATOM 936 O ALEU A 57 13.893 52.097 35.700 0.02 13.18 O ANISOU 936 O ALEU A 57 2182 737 2087 -99 -91 181 O ATOM 937 O BLEU A 57 13.882 52.113 35.661 0.03 13.16 O ANISOU 937 O BLEU A 57 2179 735 2087 -99 -91 178 O ATOM 938 CB ALEU A 57 16.165 53.927 35.701 0.02 14.09 C ANISOU 938 CB ALEU A 57 2312 794 2248 -228 -35 160 C ATOM 939 CB BLEU A 57 16.407 53.811 35.772 0.03 14.11 C ANISOU 939 CB BLEU A 57 2316 793 2252 -227 -36 160 C ATOM 940 CG ALEU A 57 17.432 53.314 36.154 0.02 13.63 C ANISOU 940 CG ALEU A 57 2188 794 2195 -223 -36 101 C ATOM 941 CG BLEU A 57 17.544 52.911 36.268 0.03 13.90 C ANISOU 941 CG BLEU A 57 2226 827 2229 -258 -17 111 C ATOM 942 CD1ALEU A 57 18.295 54.468 36.640 0.02 14.03 C ANISOU 942 CD1ALEU A 57 2219 828 2285 -271 -29 59 C ATOM 943 CD1BLEU A 57 18.764 53.019 35.366 0.03 14.38 C ANISOU 943 CD1BLEU A 57 2278 906 2279 -325 28 126 C ATOM 944 CD2ALEU A 57 17.001 52.364 37.229 0.02 13.16 C ANISOU 944 CD2ALEU A 57 2123 740 2137 -159 -66 81 C ATOM 945 CD2BLEU A 57 17.894 53.264 37.710 0.03 14.03 C ANISOU 945 CD2BLEU A 57 2223 822 2286 -267 -32 59 C ATOM 946 H ALEU A 57 13.755 54.245 34.536 0.05 14.32 H ANISOU 946 H ALEU A 57 2416 765 2259 -132 -90 247 H ATOM 947 H BLEU A 57 13.910 54.387 34.718 0.05 14.31 H ANISOU 947 H BLEU A 57 2415 765 2257 -131 -91 247 H ATOM 948 HA ALEU A 57 16.121 53.251 33.767 0.05 14.28 H ANISOU 948 HA ALEU A 57 2369 856 2200 -238 -20 231 H ATOM 949 HA BLEU A 57 16.165 53.255 33.789 0.05 14.28 H ANISOU 949 HA BLEU A 57 2369 855 2202 -239 -20 230 H ATOM 950 HB2ALEU A 57 16.326 54.876 35.527 0.05 14.53 H ANISOU 950 HB2ALEU A 57 2379 830 2311 -276 -12 170 H ATOM 951 HB2BLEU A 57 16.800 54.678 35.572 0.05 14.61 H ANISOU 951 HB2BLEU A 57 2409 811 2332 -262 -24 176 H ATOM 952 HB3ALEU A 57 15.552 53.867 36.439 0.05 14.13 H ANISOU 952 HB3ALEU A 57 2333 761 2276 -202 -53 152 H ATOM 953 HB3BLEU A 57 15.813 53.909 36.518 0.05 13.92 H ANISOU 953 HB3BLEU A 57 2289 755 2244 -191 -56 140 H ATOM 954 HG ALEU A 57 17.869 52.848 35.426 0.05 13.48 H ANISOU 954 HG ALEU A 57 2147 819 2157 -230 -21 102 H ATOM 955 HG BLEU A 57 17.217 52.004 36.256 0.05 13.47 H ANISOU 955 HG BLEU A 57 2148 813 2158 -226 -25 101 H ATOM 956 HD11ALEU A 57 18.418 55.063 35.897 0.05 14.19 H ANISOU 956 HD11ALEU A 57 2209 877 2304 -307 -8 52 H ATOM 957 HD11BLEU A 57 19.559 53.076 35.918 0.05 14.53 H ANISOU 957 HD11BLEU A 57 2261 936 2324 -353 37 91 H ATOM 958 HD12ALEU A 57 17.834 54.923 37.352 0.05 14.44 H ANISOU 958 HD12ALEU A 57 2307 824 2354 -290 -26 72 H ATOM 959 HD12BLEU A 57 18.814 52.236 34.796 0.05 14.18 H ANISOU 959 HD12BLEU A 57 2240 924 2225 -316 39 131 H ATOM 960 HD13ALEU A 57 19.151 54.134 36.947 0.05 13.82 H ANISOU 960 HD13ALEU A 57 2172 815 2265 -248 -50 24 H ATOM 961 HD13BLEU A 57 18.696 53.819 34.820 0.05 14.81 H ANISOU 961 HD13BLEU A 57 2377 919 2331 -349 39 162 H ATOM 962 HD21ALEU A 57 17.613 51.605 37.277 0.05 12.98 H ANISOU 962 HD21ALEU A 57 2069 746 2116 -156 -70 49 H ATOM 963 HD21BLEU A 57 17.181 52.959 38.295 0.05 13.71 H ANISOU 963 HD21BLEU A 57 2180 786 2243 -224 -55 43 H ATOM 964 HD22ALEU A 57 16.988 52.831 38.076 0.05 13.36 H ANISOU 964 HD22ALEU A 57 2173 722 2181 -149 -76 79 H ATOM 965 HD22BLEU A 57 18.730 52.839 37.956 0.05 14.09 H ANISOU 965 HD22BLEU A 57 2190 863 2301 -293 -24 32 H ATOM 966 HD23ALEU A 57 16.113 52.051 37.025 0.05 12.92 H ANISOU 966 HD23ALEU A 57 2096 728 2087 -133 -71 100 H ATOM 967 HD23BLEU A 57 17.983 54.230 37.768 0.05 14.46 H ANISOU 967 HD23BLEU A 57 2311 823 2361 -291 -28 68 H ATOM 968 N PHE A 58 15.316 50.946 34.367 0.05 13.12 N ANISOU 968 N PHE A 58 2146 806 2034 -164 -44 172 N ATOM 969 CA PHE A 58 14.843 49.629 34.786 0.05 12.57 C ANISOU 969 CA PHE A 58 2039 779 1956 -126 -55 144 C ATOM 970 C PHE A 58 15.929 48.971 35.650 0.05 12.35 C ANISOU 970 C PHE A 58 1965 776 1950 -133 -40 98 C ATOM 971 O PHE A 58 17.112 48.946 35.299 0.05 12.60 O ANISOU 971 O PHE A 58 1977 826 1985 -173 -12 86 O ATOM 972 CB PHE A 58 14.557 48.646 33.611 0.05 12.55 C ANISOU 972 CB PHE A 58 2038 823 1909 -130 -48 153 C ATOM 973 CG PHE A 58 13.476 49.038 32.649 0.05 12.86 C ANISOU 973 CG PHE A 58 2116 858 1913 -119 -75 197 C ATOM 974 CD1 PHE A 58 12.608 50.084 32.860 0.05 13.09 C ANISOU 974 CD1 PHE A 58 2170 841 1961 -90 -109 230 C ATOM 975 CD2 PHE A 58 13.322 48.291 31.491 0.05 13.03 C ANISOU 975 CD2 PHE A 58 2147 925 1881 -135 -71 201 C ATOM 976 CE1 PHE A 58 11.623 50.390 31.946 0.05 13.49 C ANISOU 976 CE1 PHE A 58 2251 895 1982 -72 -146 274 C ATOM 977 CE2 PHE A 58 12.338 48.587 30.594 0.05 13.42 C ANISOU 977 CE2 PHE A 58 2228 982 1890 -124 -108 239 C ATOM 978 CZ PHE A 58 11.488 49.628 30.812 0.05 13.66 C ANISOU 978 CZ PHE A 58 2279 970 1943 -90 -149 280 C ATOM 979 H APHE A 58 15.936 50.925 33.784 0.05 13.32 H ANISOU 979 H APHE A 58 2171 846 2046 -198 -21 176 H ATOM 980 H BPHE A 58 15.919 50.921 33.767 0.05 13.33 H ANISOU 980 H BPHE A 58 2172 846 2046 -197 -21 177 H ATOM 981 HA PHE A 58 14.043 49.722 35.310 0.05 12.42 H ANISOU 981 HA PHE A 58 2023 747 1950 -93 -77 144 H ATOM 982 HB2 PHE A 58 15.367 48.535 33.097 0.05 12.75 H ANISOU 982 HB2 PHE A 58 2060 864 1920 -162 -20 149 H ATOM 983 HB3 PHE A 58 14.315 47.801 34.014 0.05 12.23 H ANISOU 983 HB3 PHE A 58 1973 801 1874 -109 -51 129 H ATOM 984 HD1 PHE A 58 12.696 50.592 33.630 0.05 13.03 H ANISOU 984 HD1 PHE A 58 2160 803 1988 -80 -110 221 H ATOM 985 HD2 PHE A 58 13.896 47.577 31.340 0.05 12.94 H ANISOU 985 HD2 PHE A 58 2118 939 1861 -151 -44 173 H ATOM 986 HE1 PHE A 58 11.046 51.095 32.099 0.05 13.72 H ANISOU 986 HE1 PHE A 58 2292 890 2030 -45 -170 296 H ATOM 987 HE2 PHE A 58 12.251 48.079 29.820 0.05 13.60 H ANISOU 987 HE2 PHE A 58 2259 1039 1870 -138 -106 237 H ATOM 988 HZ PHE A 58 10.826 49.833 30.188 0.05 14.02 H ANISOU 988 HZ PHE A 58 2343 1021 1961 -78 -181 309 H ATOM 989 N ILE A 59 15.450 48.410 36.745 0.05 11.98 N ANISOU 989 N ILE A 59 1900 735 1917 -94 -59 76 N ATOM 990 CA ILE A 59 16.232 47.542 37.632 0.05 11.81 C ANISOU 990 CA ILE A 59 1839 741 1908 -83 -58 42 C ATOM 991 C ILE A 59 15.663 46.104 37.439 0.05 11.50 C ANISOU 991 C ILE A 59 1789 726 1855 -54 -55 40 C ATOM 992 O ILE A 59 14.528 45.843 37.771 0.05 11.30 O ANISOU 992 O ILE A 59 1776 694 1825 -28 -66 48 O ATOM 993 CB ILE A 59 16.056 47.964 39.092 0.05 11.78 C ANISOU 993 CB ILE A 59 1837 722 1917 -62 -82 22 C ATOM 994 CG1 ILE A 59 16.488 49.434 39.310 0.05 12.19 C ANISOU 994 CG1 ILE A 59 1904 739 1988 -96 -85 13 C ATOM 995 CG2 ILE A 59 16.785 47.000 40.054 0.05 11.71 C ANISOU 995 CG2 ILE A 59 1796 746 1909 -43 -93 -2 C ATOM 996 CD1 ILE A 59 15.811 50.060 40.500 0.05 12.28 C ANISOU 996 CD1 ILE A 59 1932 727 2005 -76 -105 -12 C ATOM 997 H ILE A 59 14.652 48.519 37.021 0.05 11.88 H ANISOU 997 H ILE A 59 1898 710 1905 -70 -73 82 H ATOM 998 HA ILE A 59 17.157 47.548 37.380 0.05 12.00 H ANISOU 998 HA ILE A 59 1845 778 1939 -108 -45 32 H ATOM 999 HB ILE A 59 15.114 47.925 39.293 0.05 11.64 H ANISOU 999 HB ILE A 59 1836 694 1894 -39 -88 30 H ATOM 1000 HG12 ILE A 59 17.443 49.445 39.457 0.05 12.38 H ANISOU 1000 HG12 ILE A 59 1905 777 2022 -122 -80 -1 H ATOM 1001 HG13 ILE A 59 16.263 49.933 38.513 0.05 12.29 H ANISOU 1001 HG13 ILE A 59 1941 730 2001 -106 -77 37 H ATOM 1002 HG21 ILE A 59 16.534 47.169 40.970 0.05 11.74 H ANISOU 1002 HG21 ILE A 59 1808 746 1909 -30 -109 -13 H ATOM 1003 HG22 ILE A 59 16.512 46.100 39.820 0.05 11.52 H ANISOU 1003 HG22 ILE A 59 1768 732 1877 -24 -87 6 H ATOM 1004 HG23 ILE A 59 17.737 47.096 39.921 0.05 11.91 H ANISOU 1004 HG23 ILE A 59 1796 785 1945 -63 -89 -13 H ATOM 1005 HD11 ILE A 59 16.064 50.997 40.540 0.05 12.59 H ANISOU 1005 HD11 ILE A 59 1987 736 2062 -101 -105 -18 H ATOM 1006 HD12 ILE A 59 14.849 49.989 40.407 0.05 12.12 H ANISOU 1006 HD12 ILE A 59 1928 698 1980 -48 -106 -1 H ATOM 1007 HD13 ILE A 59 16.096 49.613 41.310 0.05 12.26 H ANISOU 1007 HD13 ILE A 59 1911 750 1997 -69 -117 -33 H ATOM 1008 N VAL A 60 16.483 45.251 36.838 0.05 11.59 N ANISOU 1008 N VAL A 60 1776 763 1865 -64 -33 26 N ATOM 1009 CA VAL A 60 15.995 43.892 36.502 0.05 11.43 C ANISOU 1009 CA VAL A 60 1752 753 1837 -43 -25 20 C ATOM 1010 C VAL A 60 16.079 43.022 37.750 0.05 11.30 C ANISOU 1010 C VAL A 60 1720 733 1839 -6 -38 10 C ATOM 1011 O VAL A 60 17.109 42.897 38.375 0.05 11.46 O ANISOU 1011 O VAL A 60 1714 762 1877 3 -44 -2 O ATOM 1012 CB VAL A 60 16.777 43.317 35.330 0.05 11.69 C ANISOU 1012 CB VAL A 60 1772 809 1861 -64 8 3 C ATOM 1013 CG1 VAL A 60 16.195 41.930 34.930 0.05 11.63 C ANISOU 1013 CG1 VAL A 60 1765 802 1852 -45 18 -15 C ATOM 1014 CG2 VAL A 60 16.777 44.246 34.124 0.05 11.95 C ANISOU 1014 CG2 VAL A 60 1833 849 1858 -104 22 22 C ATOM 1015 H VAL A 60 17.283 45.405 36.597 0.05 11.79 H ANISOU 1015 H VAL A 60 1785 797 1896 -83 -21 18 H ATOM 1016 HA VAL A 60 15.075 43.962 36.243 0.05 11.33 H ANISOU 1016 HA VAL A 60 1759 735 1812 -40 -33 32 H ATOM 1017 HB VAL A 60 17.686 43.169 35.606 0.05 11.85 H ANISOU 1017 HB VAL A 60 1764 837 1899 -65 18 -12 H ATOM 1018 HG11 VAL A 60 16.671 41.612 34.150 0.05 11.85 H ANISOU 1018 HG11 VAL A 60 1793 844 1866 -62 40 -29 H ATOM 1019 HG12 VAL A 60 16.314 41.324 35.675 0.05 11.61 H ANISOU 1019 HG12 VAL A 60 1746 792 1873 -21 16 -24 H ATOM 1020 HG13 VAL A 60 15.250 42.034 34.733 0.05 11.48 H ANISOU 1020 HG13 VAL A 60 1764 775 1822 -41 3 -3 H ATOM 1021 HG21 VAL A 60 15.896 44.640 34.053 0.05 11.89 H ANISOU 1021 HG21 VAL A 60 1846 841 1830 -100 11 31 H ATOM 1022 HG22 VAL A 60 17.439 44.941 34.243 0.05 12.00 H ANISOU 1022 HG22 VAL A 60 1848 841 1869 -115 12 38 H ATOM 1023 HG23 VAL A 60 16.972 43.727 33.329 0.05 12.21 H ANISOU 1023 HG23 VAL A 60 1855 900 1884 -123 51 7 H ATOM 1024 N ILE A 61 14.944 42.447 38.090 0.05 11.11 N ANISOU 1024 N ILE A 61 1713 697 1810 12 -43 20 N ATOM 1025 CA ILE A 61 14.805 41.702 39.351 0.05 11.07 C ANISOU 1025 CA ILE A 61 1710 683 1812 43 -52 24 C ATOM 1026 C ILE A 61 14.855 40.180 39.242 0.05 11.18 C ANISOU 1026 C ILE A 61 1722 686 1840 59 -37 20 C ATOM 1027 O ILE A 61 15.444 39.564 40.132 0.05 11.35 O ANISOU 1027 O ILE A 61 1741 701 1872 88 -46 27 O ATOM 1028 CB ILE A 61 13.539 42.201 40.067 0.05 10.94 C ANISOU 1028 CB ILE A 61 1714 657 1784 48 -57 37 C ATOM 1029 CG1 ILE A 61 13.951 43.523 40.740 0.05 10.96 C ANISOU 1029 CG1 ILE A 61 1724 657 1782 42 -71 36 C ATOM 1030 CG2 ILE A 61 12.989 41.199 41.074 0.05 11.00 C ANISOU 1030 CG2 ILE A 61 1735 658 1788 70 -51 48 C ATOM 1031 CD1 ILE A 61 12.877 44.353 41.453 0.05 10.96 C ANISOU 1031 CD1 ILE A 61 1736 648 1780 55 -70 40 C ATOM 1032 H ILE A 61 14.237 42.490 37.626 0.05 11.06 H ANISOU 1032 H ILE A 61 1717 690 1795 5 -42 25 H ATOM 1033 HA ILE A 61 15.555 41.913 39.917 0.05 11.16 H ANISOU 1033 HA ILE A 61 1714 701 1827 51 -64 21 H ATOM 1034 HB ILE A 61 12.856 42.369 39.412 0.05 10.90 H ANISOU 1034 HB ILE A 61 1710 651 1779 38 -50 38 H ATOM 1035 HG12 ILE A 61 14.597 43.268 41.417 0.05 11.05 H ANISOU 1035 HG12 ILE A 61 1733 672 1792 46 -80 29 H ATOM 1036 HG13 ILE A 61 14.383 44.064 40.070 0.05 10.98 H ANISOU 1036 HG13 ILE A 61 1726 659 1786 26 -71 38 H ATOM 1037 HG21 ILE A 61 12.299 41.595 41.617 0.05 10.98 H ANISOU 1037 HG21 ILE A 61 1738 652 1782 68 -44 52 H ATOM 1038 HG22 ILE A 61 12.622 40.457 40.572 0.05 11.06 H ANISOU 1038 HG22 ILE A 61 1741 657 1805 73 -42 49 H ATOM 1039 HG23 ILE A 61 13.724 40.918 41.633 0.05 11.10 H ANISOU 1039 HG23 ILE A 61 1751 675 1792 82 -63 49 H ATOM 1040 HD11 ILE A 61 12.072 44.343 40.912 0.05 10.94 H ANISOU 1040 HD11 ILE A 61 1729 644 1782 50 -68 46 H ATOM 1041 HD12 ILE A 61 12.699 43.974 42.332 0.05 10.97 H ANISOU 1041 HD12 ILE A 61 1741 653 1776 66 -62 41 H ATOM 1042 HD13 ILE A 61 13.197 45.261 41.556 0.05 11.05 H ANISOU 1042 HD13 ILE A 61 1755 651 1791 56 -77 34 H ATOM 1043 N GLN A 62 14.221 39.609 38.232 0.05 11.18 N ANISOU 1043 N GLN A 62 1727 681 1841 42 -18 9 N ATOM 1044 CA GLN A 62 14.174 38.135 38.154 0.05 11.38 C ANISOU 1044 CA GLN A 62 1758 681 1887 54 0 0 C ATOM 1045 C GLN A 62 13.761 37.767 36.768 0.05 11.49 C ANISOU 1045 C GLN A 62 1773 700 1894 25 18 -28 C ATOM 1046 O GLN A 62 12.907 38.397 36.142 0.05 11.40 O ANISOU 1046 O GLN A 62 1767 707 1858 -1 9 -27 O ATOM 1047 CB GLN A 62 13.136 37.651 39.142 0.05 11.38 C ANISOU 1047 CB GLN A 62 1777 657 1889 61 0 23 C ATOM 1048 CG GLN A 62 12.958 36.143 39.362 0.05 11.71 C ANISOU 1048 CG GLN A 62 1835 655 1958 71 21 22 C ATOM 1049 CD GLN A 62 11.797 35.999 40.355 0.05 11.82 C ANISOU 1049 CD GLN A 62 1873 646 1971 67 32 51 C ATOM 1050 OE1 GLN A 62 11.757 36.770 41.327 0.05 11.91 O ANISOU 1050 OE1 GLN A 62 1903 655 1967 90 23 85 O ATOM 1051 NE2 GLN A 62 10.862 35.091 40.125 0.05 11.89 N ANISOU 1051 NE2 GLN A 62 1882 646 1990 32 50 37 N ATOM 1052 H GLN A 62 13.808 39.993 37.601 0.05 11.14 H ANISOU 1052 H GLN A 62 1725 684 1824 24 -17 7 H ATOM 1053 HA GLN A 62 15.052 37.812 38.368 0.05 11.54 H ANISOU 1053 HA GLN A 62 1767 697 1922 74 0 -4 H ATOM 1054 HB2 GLN A 62 13.340 38.037 40.002 0.05 11.35 H ANISOU 1054 HB2 GLN A 62 1778 657 1878 78 -12 40 H ATOM 1055 HB3 GLN A 62 12.278 37.957 38.834 0.05 11.28 H ANISOU 1055 HB3 GLN A 62 1766 651 1868 43 1 22 H ATOM 1056 HG2 GLN A 62 12.739 35.747 38.513 0.05 11.77 H ANISOU 1056 HG2 GLN A 62 1840 660 1972 52 33 -1 H ATOM 1057 HG3 GLN A 62 13.772 35.786 39.743 0.05 11.87 H ANISOU 1057 HG3 GLN A 62 1853 667 1991 97 16 26 H ATOM 1058 HE21 GLN A 62 10.149 35.045 40.612 0.05 12.08 H ANISOU 1058 HE21 GLN A 62 1919 648 2024 24 65 49 H ATOM 1059 HE22 GLN A 62 10.967 34.521 39.494 0.05 11.80 H ANISOU 1059 HE22 GLN A 62 1856 651 1975 14 46 16 H ATOM 1060 N GLY A 63 14.307 36.633 36.313 0.05 11.81 N ANISOU 1060 N GLY A 63 1811 720 1957 33 42 -56 N ATOM 1061 CA GLY A 63 13.941 36.114 35.017 0.05 12.05 C ANISOU 1061 CA GLY A 63 1850 755 1976 3 62 -95 C ATOM 1062 C GLY A 63 14.886 36.528 33.921 0.05 12.25 C ANISOU 1062 C GLY A 63 1863 815 1975 -13 80 -122 C ATOM 1063 O GLY A 63 16.016 36.940 34.178 0.05 12.27 O ANISOU 1063 O GLY A 63 1842 832 1987 3 86 -117 O ATOM 1064 H GLY A 63 14.918 36.212 36.724 0.05 11.95 H ANISOU 1064 H GLY A 63 1822 723 1994 57 45 -55 H ATOM 1065 HA2 GLY A 63 13.961 35.139 35.053 0.05 12.30 H ANISOU 1065 HA2 GLY A 63 1887 755 2032 12 78 -112 H ATOM 1066 HA3 GLY A 63 13.044 36.386 34.787 0.05 11.96 H ANISOU 1066 HA3 GLY A 63 1847 752 1947 -19 50 -90 H ATOM 1067 N ASN A 64 14.402 36.424 32.692 0.05 12.48 N ANISOU 1067 N ASN A 64 1910 865 1968 -49 90 -151 N ATOM 1068 CA ASN A 64 15.191 36.776 31.523 0.05 12.83 C ANISOU 1068 CA ASN A 64 1954 947 1974 -71 119 -179 C ATOM 1069 C ASN A 64 14.284 37.441 30.511 0.05 12.92 C ANISOU 1069 C ASN A 64 1992 998 1918 -112 97 -170 C ATOM 1070 O ASN A 64 13.135 37.075 30.328 0.05 12.95 O ANISOU 1070 O ASN A 64 2010 1001 1911 -127 70 -176 O ATOM 1071 CB ASN A 64 15.890 35.542 30.923 0.05 13.38 C ANISOU 1071 CB ASN A 64 2021 999 2063 -65 164 -243 C ATOM 1072 CG ASN A 64 16.901 34.953 31.863 0.05 13.48 C ANISOU 1072 CG ASN A 64 2001 978 2142 -14 182 -248 C ATOM 1073 OD1 ASN A 64 18.006 35.480 32.079 0.05 13.67 O ANISOU 1073 OD1 ASN A 64 1992 1025 2177 -3 205 -256 O ATOM 1074 ND2 ASN A 64 16.521 33.893 32.474 0.05 13.45 N ANISOU 1074 ND2 ASN A 64 2005 920 2187 16 171 -240 N ATOM 1075 H ASN A 64 13.605 36.176 32.510 0.05 12.51 H ANISOU 1075 H ASN A 64 1924 864 1964 -63 80 -156 H ATOM 1076 HA ASN A 64 15.859 37.424 31.781 0.05 12.76 H ANISOU 1076 HA ASN A 64 1929 949 1969 -64 123 -164 H ATOM 1077 HB2 ASN A 64 15.228 34.869 30.726 0.05 13.46 H ANISOU 1077 HB2 ASN A 64 2048 989 2080 -72 159 -259 H ATOM 1078 HB3 ASN A 64 16.349 35.814 30.115 0.05 13.68 H ANISOU 1078 HB3 ASN A 64 2064 1069 2065 -87 188 -266 H ATOM 1079 HD21 ASN A 64 17.073 33.471 32.979 0.05 13.52 H ANISOU 1079 HD21 ASN A 64 1997 909 2232 49 171 -232 H ATOM 1080 HD22 ASN A 64 15.718 33.613 32.366 0.05 13.42 H ANISOU 1080 HD22 ASN A 64 2022 900 2178 0 163 -242 H ATOM 1081 N ALA A 65 14.814 38.411 29.793 0.05 13.10 N ANISOU 1081 N ALA A 65 2024 1058 1895 -134 109 -157 N ATOM 1082 CA ALA A 65 14.037 39.110 28.781 0.05 13.36 C ANISOU 1082 CA ALA A 65 2091 1129 1854 -169 84 -139 C ATOM 1083 C ALA A 65 14.975 39.823 27.849 0.05 13.82 C ANISOU 1083 C ALA A 65 2168 1226 1858 -200 122 -136 C ATOM 1084 O ALA A 65 16.148 40.032 28.177 0.05 13.92 O ANISOU 1084 O ALA A 65 2154 1236 1898 -196 171 -152 O ATOM 1085 CB ALA A 65 13.032 40.055 29.410 0.05 12.98 C ANISOU 1085 CB ALA A 65 2047 1074 1812 -157 28 -80 C ATOM 1086 H ALA A 65 15.622 38.674 29.865 0.05 13.15 H ANISOU 1086 H ALA A 65 2017 1068 1910 -131 131 -156 H ATOM 1087 HA ALA A 65 13.547 38.455 28.251 0.05 13.60 H ANISOU 1087 HA ALA A 65 2132 1167 1866 -181 79 -169 H ATOM 1088 HB1 ALA A 65 12.362 40.302 28.755 0.05 13.24 H ANISOU 1088 HB1 ALA A 65 2100 1129 1800 -173 5 -68 H ATOM 1089 HB2 ALA A 65 12.603 39.611 30.154 0.05 12.73 H ANISOU 1089 HB2 ALA A 65 2000 1020 1817 -140 14 -84 H ATOM 1090 HB3 ALA A 65 13.498 40.848 29.725 0.05 12.82 H ANISOU 1090 HB3 ALA A 65 2022 1046 1805 -150 33 -54 H ATOM 1091 N ILE A 66 14.446 40.208 26.696 0.05 14.23 N ANISOU 1091 N ILE A 66 2262 1314 1829 -231 99 -115 N ATOM 1092 CA ILE A 66 15.190 41.012 25.725 0.05 14.74 C ANISOU 1092 CA ILE A 66 2363 1414 1825 -267 124 -82 C ATOM 1093 C ILE A 66 14.555 42.379 25.755 0.05 14.58 C ANISOU 1093 C ILE A 66 2365 1379 1797 -261 69 -3 C ATOM 1094 O ILE A 66 13.354 42.514 25.554 0.05 14.57 O ANISOU 1094 O ILE A 66 2376 1380 1779 -247 7 18 O ATOM 1095 CB ILE A 66 15.122 40.409 24.315 0.05 15.54 C ANISOU 1095 CB ILE A 66 2511 1569 1824 -305 132 -110 C ATOM 1096 CG1 ILE A 66 15.476 38.920 24.357 0.05 15.83 C ANISOU 1096 CG1 ILE A 66 2531 1614 1871 -310 193 -200 C ATOM 1097 CG2 ILE A 66 16.007 41.184 23.394 0.05 16.18 C ANISOU 1097 CG2 ILE A 66 2641 1684 1823 -346 160 -62 C ATOM 1098 CD1 ILE A 66 15.136 38.162 23.061 0.05 16.47 C ANISOU 1098 CD1 ILE A 66 2649 1733 1874 -337 175 -252 C ATOM 1099 H ILE A 66 13.644 40.044 26.458 0.05 14.27 H ANISOU 1099 H ILE A 66 2279 1326 1817 -232 65 -115 H ATOM 1100 HA ILE A 66 16.120 41.077 25.985 0.05 14.79 H ANISOU 1100 HA ILE A 66 2349 1416 1852 -271 170 -94 H ATOM 1101 HB ILE A 66 14.212 40.504 23.989 0.05 15.55 H ANISOU 1101 HB ILE A 66 2526 1577 1806 -301 81 -101 H ATOM 1102 HG12 ILE A 66 16.423 38.812 24.526 0.05 16.15 H ANISOU 1102 HG12 ILE A 66 2570 1670 1897 -326 247 -211 H ATOM 1103 HG13 ILE A 66 14.964 38.499 25.064 0.05 15.41 H ANISOU 1103 HG13 ILE A 66 2442 1524 1889 -281 191 -220 H ATOM 1104 HG21 ILE A 66 15.501 41.934 23.045 0.05 16.08 H ANISOU 1104 HG21 ILE A 66 2646 1659 1806 -340 118 -3 H ATOM 1105 HG22 ILE A 66 16.779 41.505 23.884 0.05 16.19 H ANISOU 1105 HG22 ILE A 66 2622 1680 1851 -354 213 -72 H ATOM 1106 HG23 ILE A 66 16.290 40.613 22.662 0.05 16.76 H ANISOU 1106 HG23 ILE A 66 2749 1798 1823 -372 168 -82 H ATOM 1107 HD11 ILE A 66 15.461 37.249 23.137 0.05 16.48 H ANISOU 1107 HD11 ILE A 66 2632 1717 1913 -328 199 -311 H ATOM 1108 HD12 ILE A 66 14.173 38.153 22.941 0.05 16.33 H ANISOU 1108 HD12 ILE A 66 2640 1717 1848 -333 114 -225 H ATOM 1109 HD13 ILE A 66 15.558 38.592 22.298 0.05 17.06 H ANISOU 1109 HD13 ILE A 66 2759 1850 1874 -368 202 -255 H ATOM 1110 N ILE A 67 15.351 43.410 26.041 0.05 14.58 N ANISOU 1110 N ILE A 67 2367 1360 1814 -271 93 38 N ATOM 1111 CA ILE A 67 14.856 44.783 26.065 0.05 14.75 C ANISOU 1111 CA ILE A 67 2429 1363 1813 -274 52 115 C ATOM 1112 C ILE A 67 15.176 45.395 24.730 0.05 15.66 C ANISOU 1112 C ILE A 67 2605 1517 1828 -324 81 144 C ATOM 1113 O ILE A 67 16.341 45.536 24.394 0.05 16.01 O ANISOU 1113 O ILE A 67 2648 1576 1860 -364 154 129 O ATOM 1114 CB ILE A 67 15.502 45.658 27.150 0.05 14.43 C ANISOU 1114 CB ILE A 67 2369 1271 1841 -267 59 145 C ATOM 1115 CG1 ILE A 67 15.327 45.076 28.533 0.05 13.69 C ANISOU 1115 CG1 ILE A 67 2215 1152 1834 -229 55 104 C ATOM 1116 CG2 ILE A 67 14.920 47.021 27.101 0.05 14.60 C ANISOU 1116 CG2 ILE A 67 2434 1255 1858 -253 5 218 C ATOM 1117 CD1 ILE A 67 13.958 44.762 28.874 0.05 13.24 C ANISOU 1117 CD1 ILE A 67 2143 1087 1801 -186 4 92 C ATOM 1118 H ILE A 67 16.177 43.323 26.251 0.05 14.54 H ANISOU 1118 H ILE A 67 2339 1350 1836 -277 131 21 H ATOM 1119 HA ILE A 67 13.895 44.798 26.188 0.05 14.65 H ANISOU 1119 HA ILE A 67 2421 1346 1798 -251 1 129 H ATOM 1120 HB ILE A 67 16.452 45.716 26.963 0.05 14.74 H ANISOU 1120 HB ILE A 67 2411 1318 1870 -299 105 143 H ATOM 1121 HG12 ILE A 67 15.839 44.251 28.578 0.05 13.70 H ANISOU 1121 HG12 ILE A 67 2190 1169 1845 -235 92 65 H ATOM 1122 HG13 ILE A 67 15.662 45.706 29.191 0.05 13.57 H ANISOU 1122 HG13 ILE A 67 2195 1109 1854 -226 52 123 H ATOM 1123 HG21 ILE A 67 15.196 47.506 27.893 0.05 14.41 H ANISOU 1123 HG21 ILE A 67 2398 1196 1882 -249 11 226 H ATOM 1124 HG22 ILE A 67 15.255 47.460 26.304 0.05 15.16 H ANISOU 1124 HG22 ILE A 67 2549 1338 1874 -279 11 252 H ATOM 1125 HG23 ILE A 67 13.955 46.971 27.071 0.05 14.41 H ANISOU 1125 HG23 ILE A 67 2404 1231 1841 -221 -40 219 H ATOM 1126 HD11 ILE A 67 13.717 43.935 28.424 0.05 13.43 H ANISOU 1126 HD11 ILE A 67 2176 1137 1790 -192 1 76 H ATOM 1127 HD12 ILE A 67 13.893 44.642 29.836 0.05 12.88 H ANISOU 1127 HD12 ILE A 67 2065 1028 1800 -167 12 67 H ATOM 1128 HD13 ILE A 67 13.374 45.478 28.586 0.05 13.21 H ANISOU 1128 HD13 ILE A 67 2153 1065 1803 -171 -30 126 H ATOM 1129 N ARG A 68 14.147 45.777 23.984 0.05 16.14 N ANISOU 1129 N ARG A 68 2717 1597 1816 -323 24 188 N ATOM 1130 CA ARG A 68 14.332 46.336 22.657 0.05 17.13 C ANISOU 1130 CA ARG A 68 2918 1762 1830 -368 39 232 C ATOM 1131 C ARG A 68 14.187 47.829 22.749 0.05 17.43 C ANISOU 1131 C ARG A 68 3000 1750 1872 -367 14 327 C ATOM 1132 O ARG A 68 13.143 48.327 23.088 0.05 17.26 O ANISOU 1132 O ARG A 68 2980 1696 1882 -321 -61 367 O ATOM 1133 CB ARG A 68 13.303 45.781 21.690 0.05 17.60 C ANISOU 1133 CB ARG A 68 3006 1873 1807 -360 -27 226 C ATOM 1134 CG ARG A 68 13.496 46.323 20.270 0.05 18.77 C ANISOU 1134 CG ARG A 68 3241 2072 1818 -404 -24 273 C ATOM 1135 CD ARG A 68 12.825 45.431 19.267 0.05 19.20 C ANISOU 1135 CD ARG A 68 3304 2197 1794 -411 -59 214 C ATOM 1136 NE ARG A 68 13.459 44.100 19.234 0.05 19.20 N ANISOU 1136 NE ARG A 68 3282 2229 1785 -445 29 114 N ATOM 1137 CZ ARG A 68 14.204 43.649 18.228 0.05 20.13 C ANISOU 1137 CZ ARG A 68 3453 2402 1793 -499 96 96 C ATOM 1138 NH1 ARG A 68 14.449 44.394 17.168 0.05 21.08 N ANISOU 1138 NH1 ARG A 68 3658 2551 1801 -528 81 181 N ATOM 1139 NH2 ARG A 68 14.734 42.433 18.275 0.05 20.21 N ANISOU 1139 NH2 ARG A 68 3437 2437 1806 -521 180 -3 N ATOM 1140 H ARG A 68 13.330 45.751 24.237 0.05 15.95 H ANISOU 1140 H ARG A 68 2687 1567 1807 -295 -27 196 H ATOM 1141 HA ARG A 68 15.208 46.110 22.325 0.05 17.40 H ANISOU 1141 HA ARG A 68 2953 1819 1840 -403 104 204 H ATOM 1142 HB2 ARG A 68 13.402 44.819 21.660 0.05 17.41 H ANISOU 1142 HB2 ARG A 68 2953 1871 1791 -361 -13 161 H ATOM 1143 HB3 ARG A 68 12.416 46.018 21.999 0.05 17.41 H ANISOU 1143 HB3 ARG A 68 2974 1828 1812 -325 -90 256 H ATOM 1144 HG2 ARG A 68 13.108 47.208 20.209 0.05 19.06 H ANISOU 1144 HG2 ARG A 68 3312 2090 1839 -390 -70 343 H ATOM 1145 HG3 ARG A 68 14.442 46.342 20.061 0.05 19.04 H ANISOU 1145 HG3 ARG A 68 3289 2115 1829 -442 48 265 H ATOM 1146 HD2 ARG A 68 11.899 45.318 19.530 0.05 18.77 H ANISOU 1146 HD2 ARG A 68 3211 2131 1789 -377 -113 197 H ATOM 1147 HD3 ARG A 68 12.874 45.842 18.394 0.05 19.97 H ANISOU 1147 HD3 ARG A 68 3460 2329 1801 -427 -88 256 H ATOM 1148 HE ARG A 68 13.554 43.700 19.985 0.05 18.60 H ANISOU 1148 HE ARG A 68 3157 2125 1785 -430 53 75 H ATOM 1149 HH11 ARG A 68 14.117 45.184 17.103 0.05 21.10 H ANISOU 1149 HH11 ARG A 68 3679 2532 1806 -509 25 246 H ATOM 1150 HH12 ARG A 68 14.929 44.073 16.534 0.05 21.75 H ANISOU 1150 HH12 ARG A 68 3782 2675 1808 -566 128 172 H ATOM 1151 HH21 ARG A 68 14.592 41.924 18.955 0.05 19.67 H ANISOU 1151 HH21 ARG A 68 3318 2344 1810 -499 187 -52 H ATOM 1152 HH22 ARG A 68 15.218 42.152 17.622 0.05 20.88 H ANISOU 1152 HH22 ARG A 68 3556 2560 1818 -556 229 -18 H ATOM 1153 N AILE A 69 15.298 48.509 22.491 0.03 17.95 N ANISOU 1153 N AILE A 69 3098 1807 1915 -420 85 357 N ATOM 1154 N BILE A 69 15.276 48.513 22.447 0.03 17.97 N ANISOU 1154 N BILE A 69 3102 1809 1915 -420 84 358 N ATOM 1155 CA AILE A 69 15.388 49.961 22.473 0.03 18.42 C ANISOU 1155 CA AILE A 69 3211 1805 1982 -433 78 448 C ATOM 1156 CA BILE A 69 15.317 49.959 22.437 0.03 18.43 C ANISOU 1156 CA BILE A 69 3215 1808 1980 -430 73 450 C ATOM 1157 C AILE A 69 15.797 50.359 21.038 0.03 19.64 C ANISOU 1157 C AILE A 69 3451 1995 2015 -498 125 502 C ATOM 1158 C BILE A 69 15.791 50.370 21.044 0.03 19.63 C ANISOU 1158 C BILE A 69 3451 1993 2016 -497 124 503 C ATOM 1159 O AILE A 69 16.933 50.176 20.623 0.03 19.96 O ANISOU 1159 O AILE A 69 3484 2065 2037 -558 221 470 O ATOM 1160 O BILE A 69 16.939 50.188 20.661 0.03 19.93 O ANISOU 1160 O BILE A 69 3478 2056 2040 -557 221 471 O ATOM 1161 CB AILE A 69 16.398 50.459 23.534 0.03 17.97 C ANISOU 1161 CB AILE A 69 3106 1692 2030 -450 131 430 C ATOM 1162 CB BILE A 69 16.161 50.464 23.596 0.03 17.89 C ANISOU 1162 CB BILE A 69 3097 1675 2025 -435 110 436 C ATOM 1163 CG1AILE A 69 16.087 49.881 24.918 0.03 16.86 C ANISOU 1163 CG1AILE A 69 2885 1525 1995 -391 93 373 C ATOM 1164 CG1BILE A 69 15.358 50.299 24.877 0.03 17.00 C ANISOU 1164 CG1BILE A 69 2936 1518 2004 -364 40 419 C ATOM 1165 CG2AILE A 69 16.365 51.951 23.628 0.03 18.58 C ANISOU 1165 CG2AILE A 69 3245 1693 2121 -471 127 519 C ATOM 1166 CG2BILE A 69 16.480 51.923 23.440 0.03 18.65 C ANISOU 1166 CG2BILE A 69 3257 1710 2119 -477 133 518 C ATOM 1167 CD1AILE A 69 17.016 50.354 26.041 0.03 16.49 C ANISOU 1167 CD1AILE A 69 2787 1436 2042 -406 134 345 C ATOM 1168 CD1BILE A 69 16.166 49.997 26.066 0.03 16.21 C ANISOU 1168 CD1BILE A 69 2757 1406 1995 -358 74 350 C ATOM 1169 H AILE A 69 16.046 48.129 22.320 0.05 18.11 H ANISOU 1169 H AILE A 69 3110 1854 1918 -451 142 323 H ATOM 1170 H BILE A 69 16.022 48.149 22.238 0.05 18.14 H ANISOU 1170 H BILE A 69 3115 1857 1919 -452 142 325 H ATOM 1171 HA AILE A 69 14.520 50.333 22.674 0.05 18.36 H ANISOU 1171 HA AILE A 69 3218 1772 1987 -392 11 485 H ATOM 1172 HA BILE A 69 14.418 50.292 22.562 0.05 18.43 H ANISOU 1172 HA BILE A 69 3232 1788 1983 -391 5 487 H ATOM 1173 HB AILE A 69 17.289 50.187 23.277 0.05 18.13 H ANISOU 1173 HB AILE A 69 3108 1742 2040 -490 196 396 H ATOM 1174 HB BILE A 69 16.984 49.965 23.664 0.05 17.70 H ANISOU 1174 HB BILE A 69 3030 1675 2020 -458 164 383 H ATOM 1175 HG12AILE A 69 15.185 50.122 25.175 0.05 16.73 H ANISOU 1175 HG12AILE A 69 2881 1482 1993 -351 35 402 H ATOM 1176 HG12BILE A 69 14.890 51.139 25.033 0.05 17.21 H ANISOU 1176 HG12BILE A 69 2995 1495 2051 -352 13 470 H ATOM 1177 HG13AILE A 69 16.167 48.917 24.858 0.05 16.57 H ANISOU 1177 HG13AILE A 69 2816 1530 1950 -381 100 321 H ATOM 1178 HG13BILE A 69 14.708 49.588 24.762 0.05 16.83 H ANISOU 1178 HG13BILE A 69 2907 1526 1962 -333 -1 405 H ATOM 1179 HG21AILE A 69 17.110 52.240 24.176 0.05 18.47 H ANISOU 1179 HG21AILE A 69 3202 1655 2161 -499 172 500 H ATOM 1180 HG21BILE A 69 17.144 52.040 22.744 0.05 19.17 H ANISOU 1180 HG21BILE A 69 3339 1800 2144 -531 196 520 H ATOM 1181 HG22AILE A 69 16.435 52.329 22.738 0.05 19.36 H ANISOU 1181 HG22AILE A 69 3406 1807 2145 -504 142 568 H ATOM 1182 HG22BILE A 69 15.669 52.402 23.213 0.05 19.05 H ANISOU 1182 HG22BILE A 69 3362 1743 2134 -457 84 578 H ATOM 1183 HG23AILE A 69 15.526 52.206 24.037 0.05 18.35 H ANISOU 1183 HG23AILE A 69 3221 1627 2125 -424 66 543 H ATOM 1184 HG23BILE A 69 16.828 52.231 24.290 0.05 18.26 H ANISOU 1184 HG23BILE A 69 3175 1613 2149 -468 134 507 H ATOM 1185 HD11AILE A 69 16.789 49.879 26.857 0.05 15.86 H ANISOU 1185 HD11AILE A 69 2668 1343 2016 -365 103 317 H ATOM 1186 HD11BILE A 69 16.848 50.681 26.162 0.05 16.41 H ANISOU 1186 HD11BILE A 69 2785 1405 2046 -390 110 361 H ATOM 1187 HD12AILE A 69 17.935 50.171 25.794 0.05 16.60 H ANISOU 1187 HD12AILE A 69 2774 1481 2051 -438 188 309 H ATOM 1188 HD12BILE A 69 15.591 49.996 26.841 0.05 15.72 H ANISOU 1188 HD12BILE A 69 2672 1320 1981 -315 32 342 H ATOM 1189 HD13AILE A 69 16.891 51.307 26.167 0.05 16.86 H ANISOU 1189 HD13AILE A 69 2868 1438 2098 -424 135 391 H ATOM 1190 HD13BILE A 69 16.588 49.133 25.959 0.05 16.06 H ANISOU 1190 HD13BILE A 69 2709 1431 1964 -366 102 302 H ATOM 1191 N ASN A 70 14.828 50.848 20.276 0.05 20.42 N ANISOU 1191 N ASN A 70 3631 2097 2029 -485 59 584 N ATOM 1192 CA ASN A 70 14.989 51.074 18.802 0.05 21.74 C ANISOU 1192 CA ASN A 70 3896 2310 2056 -546 96 643 C ATOM 1193 C ASN A 70 15.813 50.197 17.820 0.05 22.16 C ANISOU 1193 C ASN A 70 3944 2444 2031 -614 202 574 C ATOM 1194 O ASN A 70 16.805 50.641 17.273 0.05 22.34 O ANISOU 1194 O ASN A 70 3951 2455 2082 -672 304 561 O ATOM 1195 CB ASN A 70 15.376 52.514 18.553 0.05 22.47 C ANISOU 1195 CB ASN A 70 4054 2328 2158 -589 137 739 C ATOM 1196 CG ASN A 70 14.229 53.380 18.719 0.05 22.49 C ANISOU 1196 CG ASN A 70 4086 2243 2216 -528 45 821 C ATOM 1197 OD1 ASN A 70 13.125 52.989 18.421 0.05 22.44 O ANISOU 1197 OD1 ASN A 70 4083 2254 2191 -460 -57 837 O ATOM 1198 ND2 ASN A 70 14.436 54.520 19.309 0.05 22.61 N ANISOU 1198 ND2 ASN A 70 4116 2163 2311 -549 79 865 N ATOM 1199 H AASN A 70 14.053 51.063 20.577 0.05 20.27 H ANISOU 1199 H AASN A 70 3613 2059 2031 -440 -9 608 H ATOM 1200 H BASN A 70 14.050 51.058 20.573 0.05 20.27 H ANISOU 1200 H BASN A 70 3613 2060 2030 -440 -9 607 H ATOM 1201 HA ASN A 70 14.094 50.971 18.458 0.05 22.14 H ANISOU 1201 HA ASN A 70 3986 2384 2043 -521 29 676 H ATOM 1202 HB2 ASN A 70 16.056 52.780 19.191 0.05 22.10 H ANISOU 1202 HB2 ASN A 70 3961 2257 2180 -615 198 703 H ATOM 1203 HB3 ASN A 70 15.700 52.631 17.649 0.05 23.41 H ANISOU 1203 HB3 ASN A 70 4241 2477 2177 -632 167 782 H ATOM 1204 HD21 ASN A 70 14.045 55.231 19.019 0.05 22.10 H ANISOU 1204 HD21 ASN A 70 4020 2048 2330 -511 48 857 H ATOM 1205 HD22 ASN A 70 14.969 54.556 19.985 0.05 23.23 H ANISOU 1205 HD22 ASN A 70 4235 2231 2360 -604 136 897 H ATOM 1206 N ASP A 71 15.321 49.014 17.480 0.05 22.50 N ANISOU 1206 N ASP A 71 4006 2570 1973 -613 181 529 N ATOM 1207 CA ASP A 71 16.077 48.107 16.613 0.05 22.94 C ANISOU 1207 CA ASP A 71 4055 2703 1960 -668 281 447 C ATOM 1208 C ASP A 71 17.212 47.352 17.386 0.05 22.28 C ANISOU 1208 C ASP A 71 3871 2608 1986 -687 388 353 C ATOM 1209 O ASP A 71 17.696 46.353 16.904 0.05 22.93 O ANISOU 1209 O ASP A 71 3951 2747 2013 -739 492 297 O ATOM 1210 CB ASP A 71 16.640 48.767 15.293 0.05 24.53 C ANISOU 1210 CB ASP A 71 4371 2954 1996 -740 332 518 C ATOM 1211 CG ASP A 71 15.651 49.742 14.609 0.05 25.38 C ANISOU 1211 CG ASP A 71 4581 3075 1987 -715 214 620 C ATOM 1212 OD1 ASP A 71 14.452 49.757 14.976 0.05 25.66 O ANISOU 1212 OD1 ASP A 71 4633 3184 1935 -697 150 579 O ATOM 1213 OD2 ASP A 71 16.078 50.482 13.656 0.05 25.99 O ANISOU 1213 OD2 ASP A 71 4730 3094 2050 -720 188 744 O ATOM 1214 H ASP A 71 14.554 48.721 17.738 0.05 22.54 H ANISOU 1214 H ASP A 71 4025 2590 1950 -581 108 541 H ATOM 1215 HA ASP A 71 15.460 47.418 16.317 0.05 22.82 H ANISOU 1215 HA ASP A 71 4027 2728 1915 -646 242 397 H ATOM 1216 HB2 ASP A 71 17.466 49.241 15.474 0.05 24.77 H ANISOU 1216 HB2 ASP A 71 4414 2947 2052 -775 387 561 H ATOM 1217 HB3 ASP A 71 16.817 48.055 14.659 0.05 24.89 H ANISOU 1217 HB3 ASP A 71 4415 3061 1980 -769 386 454 H ATOM 1218 N AGLU A 72 17.640 47.879 18.540 0.03 21.12 N ANISOU 1218 N AGLU A 72 3643 2394 1988 -640 359 336 N ATOM 1219 N BGLU A 72 17.623 47.840 18.550 0.03 21.13 N ANISOU 1219 N BGLU A 72 3644 2396 1989 -641 361 335 N ATOM 1220 CA AGLU A 72 18.703 47.272 19.371 0.03 20.44 C ANISOU 1220 CA AGLU A 72 3453 2299 2015 -636 428 247 C ATOM 1221 CA BGLU A 72 18.695 47.175 19.297 0.03 20.48 C ANISOU 1221 CA BGLU A 72 3458 2310 2013 -638 432 241 C ATOM 1222 C AGLU A 72 18.120 46.400 20.480 0.03 19.29 C ANISOU 1222 C AGLU A 72 3237 2136 1957 -561 359 182 C ATOM 1223 C BGLU A 72 18.177 46.413 20.507 0.03 19.30 C ANISOU 1223 C BGLU A 72 3238 2137 1957 -562 361 181 C ATOM 1224 O AGLU A 72 17.285 46.862 21.248 0.03 18.65 O ANISOU 1224 O AGLU A 72 3152 2006 1928 -514 273 222 O ATOM 1225 O BGLU A 72 17.431 46.932 21.330 0.03 18.66 O ANISOU 1225 O BGLU A 72 3154 2007 1930 -516 276 223 O ATOM 1226 CB AGLU A 72 19.561 48.347 20.071 0.03 20.24 C ANISOU 1226 CB AGLU A 72 3395 2207 2089 -656 458 287 C ATOM 1227 CB BGLU A 72 19.767 48.183 19.708 0.03 20.44 C ANISOU 1227 CB BGLU A 72 3417 2252 2097 -670 486 270 C ATOM 1228 CG AGLU A 72 19.996 49.558 19.254 0.03 21.36 C ANISOU 1228 CG AGLU A 72 3610 2335 2170 -733 515 373 C ATOM 1229 CG BGLU A 72 21.128 47.569 19.979 0.03 20.41 C ANISOU 1229 CG BGLU A 72 3316 2275 2162 -691 585 177 C ATOM 1230 CD AGLU A 72 20.419 50.746 20.147 0.03 21.11 C ANISOU 1230 CD AGLU A 72 3571 2211 2240 -738 495 431 C ATOM 1231 CD BGLU A 72 22.214 48.623 20.204 0.03 20.49 C ANISOU 1231 CD BGLU A 72 3278 2243 2265 -730 633 196 C ATOM 1232 OE1AGLU A 72 19.545 51.400 20.796 0.03 20.56 O ANISOU 1232 OE1AGLU A 72 3521 2081 2211 -681 399 476 O ATOM 1233 OE1BGLU A 72 21.920 49.828 20.038 0.03 20.87 O ANISOU 1233 OE1BGLU A 72 3387 2243 2301 -766 620 284 O ATOM 1234 OE2AGLU A 72 21.638 51.015 20.203 0.03 21.58 O ANISOU 1234 OE2AGLU A 72 3600 2258 2340 -803 581 426 O ATOM 1235 OE2BGLU A 72 23.348 48.242 20.565 0.03 20.23 O ANISOU 1235 OE2BGLU A 72 3142 2220 2322 -722 676 121 O ATOM 1236 H AGLU A 72 17.334 48.607 18.874 0.05 20.76 H ANISOU 1236 H AGLU A 72 3601 2308 1980 -607 297 375 H ATOM 1237 H BGLU A 72 17.315 48.548 18.925 0.05 20.77 H ANISOU 1237 H BGLU A 72 3601 2307 1984 -610 302 375 H ATOM 1238 HA AGLU A 72 19.281 46.723 18.824 0.05 20.92 H ANISOU 1238 HA AGLU A 72 3506 2404 2037 -668 499 200 H ATOM 1239 HA BGLU A 72 19.128 46.523 18.731 0.05 20.94 H ANISOU 1239 HA BGLU A 72 3513 2418 2026 -665 494 191 H ATOM 1240 HB2AGLU A 72 19.056 48.686 20.828 0.05 19.65 H ANISOU 1240 HB2AGLU A 72 3313 2086 2069 -616 392 312 H ATOM 1241 HB2BGLU A 72 19.875 48.816 18.979 0.05 21.18 H ANISOU 1241 HB2BGLU A 72 3569 2344 2135 -715 513 329 H ATOM 1242 HB3AGLU A 72 20.371 47.921 20.391 0.05 20.01 H ANISOU 1242 HB3AGLU A 72 3298 2187 2119 -660 507 227 H ATOM 1243 HB3BGLU A 72 19.483 48.648 20.509 0.05 19.78 H ANISOU 1243 HB3BGLU A 72 3312 2119 2087 -633 431 287 H ATOM 1244 HG2AGLU A 72 20.766 49.306 18.720 0.05 21.84 H ANISOU 1244 HG2AGLU A 72 3651 2432 2216 -778 600 338 H ATOM 1245 HG2BGLU A 72 21.077 47.011 20.767 0.05 19.73 H ANISOU 1245 HG2BGLU A 72 3177 2188 2133 -643 558 123 H ATOM 1246 HG3AGLU A 72 19.269 49.845 18.678 0.05 21.88 H ANISOU 1246 HG3AGLU A 72 3753 2415 2148 -738 485 425 H ATOM 1247 HG3BGLU A 72 21.390 47.035 19.215 0.05 21.12 H ANISOU 1247 HG3BGLU A 72 3425 2416 2183 -727 648 155 H ATOM 1248 N ASP A 73 18.584 45.157 20.585 0.05 19.14 N ANISOU 1248 N ASP A 73 3165 2152 1955 -551 403 82 N ATOM 1249 CA ASP A 73 18.143 44.271 21.648 0.05 18.17 C ANISOU 1249 CA ASP A 73 2977 2003 1923 -488 354 22 C ATOM 1250 C ASP A 73 19.186 44.236 22.762 0.05 17.64 C ANISOU 1250 C ASP A 73 2821 1904 1976 -470 400 -19 C ATOM 1251 O ASP A 73 20.395 44.309 22.524 0.05 18.11 O ANISOU 1251 O ASP A 73 2845 1993 2043 -493 486 -74 O ATOM 1252 CB ASP A 73 17.851 42.901 21.041 0.05 18.52 C ANISOU 1252 CB ASP A 73 3025 2096 1914 -488 373 -66 C ATOM 1253 CG ASP A 73 16.892 43.003 19.913 0.05 18.59 C ANISOU 1253 CG ASP A 73 3082 2123 1857 -475 283 -53 C ATOM 1254 OD1 ASP A 73 16.547 44.144 19.584 0.05 18.25 O ANISOU 1254 OD1 ASP A 73 3057 2053 1826 -452 201 21 O ATOM 1255 OD2 ASP A 73 16.504 42.001 19.281 0.05 19.07 O ANISOU 1255 OD2 ASP A 73 3160 2228 1859 -487 295 -126 O ATOM 1256 H AASP A 73 19.149 44.797 20.051 0.05 19.65 H ANISOU 1256 H AASP A 73 3232 2253 1982 -580 463 48 H ATOM 1257 H BASP A 73 19.115 44.780 20.028 0.05 19.65 H ANISOU 1257 H BASP A 73 3232 2253 1981 -580 463 48 H ATOM 1258 HA ASP A 73 17.313 44.598 22.021 0.05 17.75 H ANISOU 1258 HA ASP A 73 2933 1923 1888 -460 284 59 H ATOM 1259 HB2 ASP A 73 18.671 42.528 20.682 0.05 19.22 H ANISOU 1259 HB2 ASP A 73 3136 2225 1944 -526 435 -84 H ATOM 1260 HB3 ASP A 73 17.479 42.317 21.710 0.05 18.07 H ANISOU 1260 HB3 ASP A 73 2915 2020 1931 -458 383 -117 H ATOM 1261 N PHE A 74 18.649 44.166 23.971 0.05 16.75 N ANISOU 1261 N PHE A 74 2669 1737 1956 -423 340 -1 N ATOM 1262 CA PHE A 74 19.436 44.090 25.212 0.05 16.27 C ANISOU 1262 CA PHE A 74 2525 1650 2007 -397 364 -39 C ATOM 1263 C PHE A 74 18.903 42.978 26.087 0.05 15.59 C ANISOU 1263 C PHE A 74 2402 1541 1979 -336 321 -85 C ATOM 1264 O PHE A 74 17.963 43.189 26.873 0.05 15.01 O ANISOU 1264 O PHE A 74 2343 1438 1923 -305 250 -53 O ATOM 1265 CB PHE A 74 19.425 45.463 25.842 0.05 15.92 C ANISOU 1265 CB PHE A 74 2472 1559 2018 -398 331 18 C ATOM 1266 CG PHE A 74 20.026 46.457 24.936 0.05 16.64 C ANISOU 1266 CG PHE A 74 2609 1651 2062 -462 367 76 C ATOM 1267 CD1 PHE A 74 19.343 47.604 24.597 0.05 16.89 C ANISOU 1267 CD1 PHE A 74 2725 1666 2025 -473 322 151 C ATOM 1268 CD2 PHE A 74 21.224 46.158 24.270 0.05 17.22 C ANISOU 1268 CD2 PHE A 74 2643 1742 2159 -513 449 57 C ATOM 1269 CE1 PHE A 74 19.882 48.518 23.713 0.05 17.68 C ANISOU 1269 CE1 PHE A 74 2882 1759 2078 -532 357 214 C ATOM 1270 CE2 PHE A 74 21.771 47.112 23.364 0.05 18.00 C ANISOU 1270 CE2 PHE A 74 2791 1836 2210 -580 489 114 C ATOM 1271 CZ PHE A 74 21.066 48.260 23.089 0.05 18.23 C ANISOU 1271 CZ PHE A 74 2918 1839 2169 -590 444 197 C ATOM 1272 H PHE A 74 17.801 44.209 24.110 0.05 16.46 H ANISOU 1272 H PHE A 74 2654 1681 1920 -405 284 34 H ATOM 1273 HA PHE A 74 20.354 43.890 24.998 0.05 16.70 H ANISOU 1273 HA PHE A 74 2554 1729 2064 -419 426 -72 H ATOM 1274 HB2 PHE A 74 18.508 45.722 26.018 0.05 15.51 H ANISOU 1274 HB2 PHE A 74 2439 1481 1971 -371 273 45 H ATOM 1275 HB3 PHE A 74 19.924 45.444 26.671 0.05 15.70 H ANISOU 1275 HB3 PHE A 74 2389 1522 2056 -383 343 -11 H ATOM 1276 HD1 PHE A 74 18.535 47.790 25.019 0.05 16.57 H ANISOU 1276 HD1 PHE A 74 2702 1620 1974 -439 268 160 H ATOM 1277 HD2 PHE A 74 21.695 45.384 24.460 0.05 17.15 H ANISOU 1277 HD2 PHE A 74 2573 1747 2199 -501 475 7 H ATOM 1278 HE1 PHE A 74 19.416 49.299 23.523 0.05 17.91 H ANISOU 1278 HE1 PHE A 74 2970 1773 2064 -533 322 270 H ATOM 1279 HE2 PHE A 74 22.578 46.944 22.936 0.05 18.44 H ANISOU 1279 HE2 PHE A 74 2817 1905 2287 -620 548 100 H ATOM 1280 HZ PHE A 74 21.413 48.887 22.500 0.05 18.84 H ANISOU 1280 HZ PHE A 74 3036 1907 2215 -637 473 243 H ATOM 1281 N PRO A 75 19.519 41.782 25.940 0.05 15.73 N ANISOU 1281 N PRO A 75 2370 1570 2036 -316 368 -158 N ATOM 1282 CA PRO A 75 19.224 40.691 26.864 0.05 15.12 C ANISOU 1282 CA PRO A 75 2262 1455 2029 -257 327 -187 C ATOM 1283 C PRO A 75 19.629 41.016 28.283 0.05 14.54 C ANISOU 1283 C PRO A 75 2142 1345 2039 -224 292 -159 C ATOM 1284 O PRO A 75 20.743 41.486 28.552 0.05 14.79 O ANISOU 1284 O PRO A 75 2126 1386 2108 -233 327 -166 O ATOM 1285 CB PRO A 75 20.064 39.547 26.316 0.05 15.63 C ANISOU 1285 CB PRO A 75 2289 1531 2118 -242 391 -268 C ATOM 1286 CG PRO A 75 21.077 40.137 25.448 0.05 16.33 C ANISOU 1286 CG PRO A 75 2350 1663 2194 -281 469 -283 C ATOM 1287 CD PRO A 75 20.411 41.319 24.858 0.05 16.47 C ANISOU 1287 CD PRO A 75 2425 1700 2133 -339 460 -213 C ATOM 1288 HA PRO A 75 18.288 40.451 26.829 0.05 14.92 H ANISOU 1288 HA PRO A 75 2269 1423 1979 -252 287 -177 H ATOM 1289 HB2 PRO A 75 20.479 39.035 27.032 0.05 15.37 H ANISOU 1289 HB2 PRO A 75 2219 1469 2151 -201 379 -284 H ATOM 1290 HB3 PRO A 75 19.470 38.987 25.803 0.05 15.86 H ANISOU 1290 HB3 PRO A 75 2352 1572 2104 -252 396 -294 H ATOM 1291 HG2 PRO A 75 21.851 40.401 25.966 0.05 16.25 H ANISOU 1291 HG2 PRO A 75 2285 1641 2248 -261 475 -288 H ATOM 1292 HG3 PRO A 75 21.317 39.491 24.765 0.05 16.86 H ANISOU 1292 HG3 PRO A 75 2419 1751 2235 -288 517 -332 H ATOM 1293 HD2 PRO A 75 21.076 41.990 24.634 0.05 16.57 H ANISOU 1293 HD2 PRO A 75 2410 1714 2172 -356 479 -194 H ATOM 1294 HD3 PRO A 75 19.899 41.056 24.077 0.05 17.00 H ANISOU 1294 HD3 PRO A 75 2530 1800 2129 -371 492 -224 H ATOM 1295 N VAL A 76 18.721 40.734 29.182 0.05 13.91 N ANISOU 1295 N VAL A 76 2072 1229 1984 -190 229 -134 N ATOM 1296 CA VAL A 76 18.903 41.089 30.578 0.05 13.42 C ANISOU 1296 CA VAL A 76 1978 1137 1986 -158 193 -110 C ATOM 1297 C VAL A 76 18.367 40.062 31.518 0.05 13.10 C ANISOU 1297 C VAL A 76 1918 1065 1994 -106 169 -130 C ATOM 1298 O VAL A 76 17.555 39.198 31.151 0.05 13.06 O ANISOU 1298 O VAL A 76 1938 1048 1978 -97 162 -147 O ATOM 1299 CB VAL A 76 18.209 42.433 30.901 0.05 13.07 C ANISOU 1299 CB VAL A 76 1968 1074 1923 -168 143 -51 C ATOM 1300 CG1 VAL A 76 18.844 43.609 30.117 0.05 13.48 C ANISOU 1300 CG1 VAL A 76 2041 1138 1944 -219 166 -19 C ATOM 1301 CG2 VAL A 76 16.716 42.375 30.689 0.05 12.89 C ANISOU 1301 CG2 VAL A 76 1987 1046 1863 -161 106 -36 C ATOM 1302 H VAL A 76 17.973 40.352 29.011 0.05 13.80 H ANISOU 1302 H VAL A 76 2083 1211 1949 -186 207 -133 H ATOM 1303 HA VAL A 76 19.845 41.192 30.768 0.05 13.63 H ANISOU 1303 HA VAL A 76 1970 1172 2037 -164 215 -119 H ATOM 1304 HB VAL A 76 18.348 42.597 31.843 0.05 12.78 H ANISOU 1304 HB VAL A 76 1912 1018 1924 -145 120 -45 H ATOM 1305 HG11 VAL A 76 18.921 43.370 29.183 0.05 13.88 H ANISOU 1305 HG11 VAL A 76 2106 1213 1953 -244 198 -28 H ATOM 1306 HG12 VAL A 76 18.256 44.367 30.219 0.05 13.34 H ANISOU 1306 HG12 VAL A 76 2054 1103 1913 -220 134 17 H ATOM 1307 HG13 VAL A 76 19.722 43.803 30.484 0.05 13.55 H ANISOU 1307 HG13 VAL A 76 2017 1145 1988 -224 179 -27 H ATOM 1308 HG21 VAL A 76 16.325 41.626 31.163 0.05 12.93 H ANISOU 1308 HG21 VAL A 76 1987 1055 1871 -152 115 -67 H ATOM 1309 HG22 VAL A 76 16.334 43.203 31.022 0.05 12.55 H ANISOU 1309 HG22 VAL A 76 1944 982 1842 -142 72 -16 H ATOM 1310 HG23 VAL A 76 16.535 42.294 29.737 0.05 13.16 H ANISOU 1310 HG23 VAL A 76 2052 1096 1852 -187 107 -17 H ATOM 1311 N THR A 77 18.812 40.138 32.772 0.05 12.95 N ANISOU 1311 N THR A 77 1858 1032 2031 -74 152 -125 N ATOM 1312 CA THR A 77 18.295 39.259 33.827 0.05 12.78 C ANISOU 1312 CA THR A 77 1822 979 2056 -21 128 -130 C ATOM 1313 C THR A 77 18.626 39.923 35.172 0.05 12.47 C ANISOU 1313 C THR A 77 1772 931 2036 -4 82 -96 C ATOM 1314 O THR A 77 19.049 41.077 35.279 0.05 12.45 O ANISOU 1314 O THR A 77 1766 944 2023 -35 75 -80 O ATOM 1315 CB THR A 77 18.857 37.789 33.671 0.05 13.31 C ANISOU 1315 CB THR A 77 1845 1047 2166 8 165 -176 C ATOM 1316 OG1 THR A 77 18.265 36.924 34.634 0.05 13.29 O ANISOU 1316 OG1 THR A 77 1856 1000 2194 52 152 -181 O ATOM 1317 CG2 THR A 77 20.396 37.684 33.875 0.05 13.60 C ANISOU 1317 CG2 THR A 77 1817 1105 2244 22 162 -181 C ATOM 1318 H THR A 77 19.401 40.697 33.035 0.05 13.01 H ANISOU 1318 H THR A 77 1848 1048 2047 -85 152 -116 H ATOM 1319 HA THR A 77 17.330 39.199 33.738 0.05 12.62 H ANISOU 1319 HA THR A 77 1830 941 2024 -18 118 -127 H ATOM 1320 HB THR A 77 18.630 37.503 32.778 0.05 13.59 H ANISOU 1320 HB THR A 77 1885 1100 2180 -16 202 -202 H ATOM 1321 HG1 THR A 77 18.848 36.538 35.089 0.05 13.36 H ANISOU 1321 HG1 THR A 77 1843 998 2234 83 136 -174 H ATOM 1322 HG21 THR A 77 20.627 36.755 34.044 0.05 14.04 H ANISOU 1322 HG21 THR A 77 1842 1177 2317 23 200 -214 H ATOM 1323 HG22 THR A 77 20.882 37.977 33.090 0.05 13.48 H ANISOU 1323 HG22 THR A 77 1804 1107 2212 -10 155 -163 H ATOM 1324 HG23 THR A 77 20.682 38.205 34.639 0.05 13.54 H ANISOU 1324 HG23 THR A 77 1797 1080 2267 60 130 -170 H ATOM 1325 N LYS A 78 18.421 39.236 36.251 0.05 12.30 N ANISOU 1325 N LYS A 78 1755 881 2036 37 52 -82 N ATOM 1326 CA LYS A 78 18.664 39.733 37.592 0.05 12.09 C ANISOU 1326 CA LYS A 78 1730 849 2014 57 8 -53 C ATOM 1327 C LYS A 78 19.943 40.523 37.764 0.05 12.35 C ANISOU 1327 C LYS A 78 1719 911 2065 48 -3 -63 C ATOM 1328 O LYS A 78 21.037 40.105 37.536 0.05 12.79 O ANISOU 1328 O LYS A 78 1724 982 2152 62 9 -88 O ATOM 1329 CB LYS A 78 18.710 38.509 38.527 0.05 12.22 C ANISOU 1329 CB LYS A 78 1751 836 2055 109 -9 -43 C ATOM 1330 CG LYS A 78 18.849 38.841 40.001 0.05 12.22 C ANISOU 1330 CG LYS A 78 1755 838 2050 136 -55 -15 C ATOM 1331 CD LYS A 78 19.356 37.570 40.735 0.05 12.59 C ANISOU 1331 CD LYS A 78 1809 855 2118 192 -71 4 C ATOM 1332 CE LYS A 78 19.233 37.691 42.220 0.05 12.79 C ANISOU 1332 CE LYS A 78 1840 895 2125 220 -122 32 C ATOM 1333 NZ LYS A 78 19.615 36.412 42.858 0.05 13.30 N ANISOU 1333 NZ LYS A 78 1919 931 2205 279 -144 63 N ATOM 1334 H LYS A 78 18.142 38.414 36.241 0.05 12.36 H ANISOU 1334 H LYS A 78 1771 872 2055 55 59 -90 H ATOM 1335 HA LYS A 78 17.914 40.273 37.852 0.05 11.81 H ANISOU 1335 HA LYS A 78 1723 808 1957 43 -3 -36 H ATOM 1336 HB2 LYS A 78 17.883 38.022 38.410 0.05 12.07 H ANISOU 1336 HB2 LYS A 78 1761 796 2026 105 0 -37 H ATOM 1337 HB3 LYS A 78 19.470 37.980 38.265 0.05 12.54 H ANISOU 1337 HB3 LYS A 78 1766 876 2123 128 3 -62 H ATOM 1338 HG2 LYS A 78 19.522 39.524 40.125 0.05 12.39 H ANISOU 1338 HG2 LYS A 78 1745 883 2078 134 -69 -25 H ATOM 1339 HG3 LYS A 78 18.007 39.136 40.371 0.05 11.95 H ANISOU 1339 HG3 LYS A 78 1748 801 1990 121 -62 -1 H ATOM 1340 HD2 LYS A 78 18.832 36.805 40.454 0.05 12.48 H ANISOU 1340 HD2 LYS A 78 1829 813 2099 191 -56 16 H ATOM 1341 HD3 LYS A 78 20.294 37.443 40.526 0.05 12.90 H ANISOU 1341 HD3 LYS A 78 1820 893 2190 212 -62 -13 H ATOM 1342 HE2 LYS A 78 19.819 38.387 42.553 0.05 12.96 H ANISOU 1342 HE2 LYS A 78 1824 946 2154 219 -141 16 H ATOM 1343 HE3 LYS A 78 18.310 37.883 42.448 0.05 12.53 H ANISOU 1343 HE3 LYS A 78 1837 863 2060 203 -124 45 H ATOM 1344 HZ1 LYS A 78 18.892 35.910 42.949 0.05 13.21 H ANISOU 1344 HZ1 LYS A 78 1947 892 2181 276 -130 83 H ATOM 1345 HZ2 LYS A 78 20.209 35.991 42.351 0.05 13.56 H ANISOU 1345 HZ2 LYS A 78 1926 952 2272 298 -135 49 H ATOM 1346 HZ3 LYS A 78 19.975 36.573 43.656 0.05 13.53 H ANISOU 1346 HZ3 LYS A 78 1942 979 2220 296 -180 75 H ATOM 1347 N GLY A 79 19.734 41.737 38.261 0.05 12.17 N ANISOU 1347 N GLY A 79 1711 891 2024 24 -27 -48 N ATOM 1348 CA GLY A 79 20.821 42.656 38.621 0.05 12.49 C ANISOU 1348 CA GLY A 79 1711 954 2081 2 -41 -62 C ATOM 1349 C GLY A 79 21.131 43.663 37.552 0.05 12.67 C ANISOU 1349 C GLY A 79 1730 985 2099 -57 -5 -68 C ATOM 1350 O GLY A 79 21.746 44.688 37.878 0.05 12.94 O ANISOU 1350 O GLY A 79 1744 1025 2146 -91 -15 -77 O ATOM 1351 H GLY A 79 18.956 42.034 38.411 0.05 11.92 H ANISOU 1351 H GLY A 79 1710 846 1973 19 -33 -33 H ATOM 1352 HA2 GLY A 79 20.589 43.124 39.433 0.05 12.40 H ANISOU 1352 HA2 GLY A 79 1714 936 2060 5 -70 -54 H ATOM 1353 HA3 GLY A 79 21.636 42.167 38.772 0.05 12.80 H ANISOU 1353 HA3 GLY A 79 1709 1009 2146 21 -46 -78 H ATOM 1354 N ASP A 80 20.767 43.431 36.322 0.05 12.65 N ANISOU 1354 N ASP A 80 1749 982 2075 -76 36 -65 N ATOM 1355 CA ASP A 80 21.089 44.367 35.261 0.05 12.95 C ANISOU 1355 CA ASP A 80 1796 1029 2097 -136 74 -60 C ATOM 1356 C ASP A 80 20.269 45.648 35.417 0.05 12.77 C ANISOU 1356 C ASP A 80 1827 973 2052 -160 51 -25 C ATOM 1357 O ASP A 80 19.147 45.657 35.901 0.05 12.36 O ANISOU 1357 O ASP A 80 1812 898 1986 -131 20 -6 O ATOM 1358 CB ASP A 80 20.815 43.757 33.873 0.05 13.08 C ANISOU 1358 CB ASP A 80 1834 1058 2076 -148 119 -64 C ATOM 1359 CG ASP A 80 21.712 42.551 33.549 0.05 13.44 C ANISOU 1359 CG ASP A 80 1828 1130 2150 -127 156 -109 C ATOM 1360 OD1 ASP A 80 22.744 42.377 34.200 0.05 13.73 O ANISOU 1360 OD1 ASP A 80 1800 1180 2236 -108 151 -133 O ATOM 1361 OD2 ASP A 80 21.368 41.775 32.618 0.05 13.54 O ANISOU 1361 OD2 ASP A 80 1863 1150 2133 -126 187 -124 O ATOM 1362 H ASP A 80 20.348 42.731 36.065 0.05 12.53 H ANISOU 1362 H ASP A 80 1746 962 2051 -58 43 -65 H ATOM 1363 HA ASP A 80 22.026 44.572 35.304 0.05 13.32 H ANISOU 1363 HA ASP A 80 1800 1092 2167 -153 87 -79 H ATOM 1364 HB2 ASP A 80 19.896 43.467 33.818 0.05 12.77 H ANISOU 1364 HB2 ASP A 80 1830 1006 2017 -131 102 -51 H ATOM 1365 HB3 ASP A 80 20.992 44.420 33.192 0.05 13.33 H ANISOU 1365 HB3 ASP A 80 1882 1096 2088 -189 143 -53 H ATOM 1366 N ALEU A 81 20.920 46.747 35.057 0.03 13.20 N ANISOU 1366 N ALEU A 81 1880 1024 2112 -215 73 -19 N ATOM 1367 N BLEU A 81 20.901 46.732 34.971 0.02 13.21 N ANISOU 1367 N BLEU A 81 1882 1025 2111 -215 74 -19 N ATOM 1368 CA ALEU A 81 20.282 48.061 34.999 0.03 13.25 C ANISOU 1368 CA ALEU A 81 1942 986 2105 -241 60 16 C ATOM 1369 CA BLEU A 81 20.307 48.070 34.916 0.02 13.28 C ANISOU 1369 CA BLEU A 81 1945 991 2108 -244 63 16 C ATOM 1370 C ALEU A 81 20.362 48.578 33.590 0.03 13.70 C ANISOU 1370 C ALEU A 81 2035 1042 2127 -292 104 47 C ATOM 1371 C BLEU A 81 20.298 48.570 33.497 0.02 13.70 C ANISOU 1371 C BLEU A 81 2038 1043 2124 -292 106 49 C ATOM 1372 O ALEU A 81 21.372 48.439 32.924 0.03 14.18 O ANISOU 1372 O ALEU A 81 2064 1134 2189 -333 154 31 O ATOM 1373 O BLEU A 81 21.259 48.399 32.765 0.02 14.17 O ANISOU 1373 O BLEU A 81 2069 1135 2180 -332 156 34 O ATOM 1374 CB ALEU A 81 20.981 49.046 35.910 0.03 13.54 C ANISOU 1374 CB ALEU A 81 1958 1004 2183 -269 44 -3 C ATOM 1375 CB BLEU A 81 21.119 49.022 35.761 0.02 13.62 C ANISOU 1375 CB BLEU A 81 1962 1018 2193 -276 52 -4 C ATOM 1376 CG ALEU A 81 21.560 48.669 37.258 0.03 13.45 C ANISOU 1376 CG ALEU A 81 1892 1017 2202 -237 8 -44 C ATOM 1377 CG BLEU A 81 21.137 48.645 37.217 0.02 13.34 C ANISOU 1377 CG BLEU A 81 1898 990 2180 -232 3 -34 C ATOM 1378 CD1ALEU A 81 22.197 49.855 37.938 0.03 13.95 C ANISOU 1378 CD1ALEU A 81 1930 1069 2299 -281 -6 -71 C ATOM 1379 CD1BLEU A 81 22.317 49.198 37.924 0.02 13.85 C ANISOU 1379 CD1BLEU A 81 1911 1067 2284 -266 -9 -72 C ATOM 1380 CD2ALEU A 81 20.462 48.045 38.138 0.03 12.89 C ANISOU 1380 CD2ALEU A 81 1851 933 2112 -175 -34 -36 C ATOM 1381 CD2BLEU A 81 19.886 49.091 37.861 0.02 12.98 C ANISOU 1381 CD2BLEU A 81 1908 903 2119 -201 -30 -15 C ATOM 1382 H ALEU A 81 21.741 46.753 34.828 0.05 13.54 H ANISOU 1382 H ALEU A 81 1890 1086 2169 -238 98 -36 H ATOM 1383 H BLEU A 81 21.701 46.714 34.677 0.05 13.55 H ANISOU 1383 H BLEU A 81 1892 1087 2168 -238 100 -35 H ATOM 1384 HA ALEU A 81 19.358 48.003 35.259 0.05 12.91 H ANISOU 1384 HA ALEU A 81 1928 926 2050 -211 35 30 H ATOM 1385 HA BLEU A 81 19.405 48.052 35.248 0.05 12.94 H ANISOU 1385 HA BLEU A 81 1931 930 2056 -214 36 30 H ATOM 1386 HB2ALEU A 81 21.714 49.417 35.399 0.05 13.98 H ANISOU 1386 HB2ALEU A 81 1998 1066 2248 -314 75 -6 H ATOM 1387 HB2BLEU A 81 22.035 49.010 35.445 0.05 14.00 H ANISOU 1387 HB2BLEU A 81 1973 1089 2257 -309 80 -21 H ATOM 1388 HB3ALEU A 81 20.319 49.727 36.093 0.05 13.46 H ANISOU 1388 HB3ALEU A 81 1989 958 2169 -266 26 15 H ATOM 1389 HB3BLEU A 81 20.741 49.909 35.679 0.05 13.74 H ANISOU 1389 HB3BLEU A 81 2018 996 2206 -296 48 18 H ATOM 1390 HG ALEU A 81 22.244 47.987 37.128 0.05 13.53 H ANISOU 1390 HG ALEU A 81 1861 1060 2220 -227 21 -60 H ATOM 1391 HG BLEU A 81 21.168 47.672 37.290 0.05 13.14 H ANISOU 1391 HG BLEU A 81 1851 991 2151 -198 0 -42 H ATOM 1392 HD11ALEU A 81 21.500 50.478 38.204 0.05 13.89 H ANISOU 1392 HD11ALEU A 81 1966 1024 2288 -285 -20 -60 H ATOM 1393 HD11BLEU A 81 23.121 48.809 37.552 0.05 14.12 H ANISOU 1393 HD11BLEU A 81 1897 1133 2333 -279 12 -88 H ATOM 1394 HD12ALEU A 81 22.679 49.537 38.721 0.05 13.97 H ANISOU 1394 HD12ALEU A 81 1894 1099 2316 -259 -33 -97 H ATOM 1395 HD12BLEU A 81 22.335 50.162 37.816 0.05 14.12 H ANISOU 1395 HD12BLEU A 81 1968 1071 2327 -307 0 -67 H ATOM 1396 HD13ALEU A 81 22.814 50.287 37.325 0.05 14.37 H ANISOU 1396 HD13ALEU A 81 1964 1128 2366 -327 27 -73 H ATOM 1397 HD13BLEU A 81 22.253 48.960 38.867 0.05 13.72 H ANISOU 1397 HD13BLEU A 81 1885 1057 2270 -236 -46 -88 H ATOM 1398 HD21ALEU A 81 20.828 47.803 38.995 0.05 12.93 H ANISOU 1398 HD21ALEU A 81 1831 952 2129 -159 -60 -57 H ATOM 1399 HD21BLEU A 81 19.803 48.636 38.711 0.05 12.78 H ANISOU 1399 HD21BLEU A 81 1871 891 2095 -168 -55 -31 H ATOM 1400 HD22ALEU A 81 19.772 48.719 38.238 0.05 12.84 H ANISOU 1400 HD22ALEU A 81 1884 894 2099 -181 -40 -21 H ATOM 1401 HD22BLEU A 81 19.941 50.051 38.006 0.05 13.23 H ANISOU 1401 HD22BLEU A 81 1959 906 2163 -227 -33 -16 H ATOM 1402 HD23ALEU A 81 20.096 47.268 37.687 0.05 12.63 H ANISOU 1402 HD23ALEU A 81 1825 911 2065 -151 -26 -26 H ATOM 1403 HD23BLEU A 81 19.137 48.871 37.290 0.05 12.77 H ANISOU 1403 HD23BLEU A 81 1911 870 2071 -187 -22 10 H ATOM 1404 N AILE A 82 19.283 49.195 33.137 0.02 13.66 N ANISOU 1404 N AILE A 82 2096 1003 2090 -288 87 93 N ATOM 1405 N BILE A 82 19.180 49.179 33.120 0.03 13.64 N ANISOU 1405 N BILE A 82 2096 999 2086 -285 84 94 N ATOM 1406 CA AILE A 82 19.271 49.775 31.818 0.02 14.21 C ANISOU 1406 CA AILE A 82 2216 1070 2113 -332 119 136 C ATOM 1407 CA BILE A 82 18.989 49.769 31.810 0.03 14.12 C ANISOU 1407 CA BILE A 82 2213 1056 2097 -322 110 141 C ATOM 1408 C AILE A 82 18.548 51.112 31.864 0.02 14.46 C ANISOU 1408 C AILE A 82 2312 1035 2146 -337 92 189 C ATOM 1409 C BILE A 82 18.563 51.204 32.007 0.03 14.43 C ANISOU 1409 C BILE A 82 2308 1028 2146 -334 88 188 C ATOM 1410 O AILE A 82 17.440 51.214 32.364 0.02 14.09 O ANISOU 1410 O AILE A 82 2284 961 2110 -286 43 199 O ATOM 1411 O BILE A 82 17.641 51.460 32.752 0.03 14.09 O ANISOU 1411 O BILE A 82 2280 951 2124 -288 42 194 O ATOM 1412 CB AILE A 82 18.697 48.761 30.798 0.02 14.12 C ANISOU 1412 CB AILE A 82 2221 1102 2041 -314 126 138 C ATOM 1413 CB BILE A 82 17.853 49.085 31.030 0.03 13.89 C ANISOU 1413 CB BILE A 82 2211 1053 2014 -287 91 155 C ATOM 1414 CG1AILE A 82 18.812 49.244 29.353 0.02 14.85 C ANISOU 1414 CG1AILE A 82 2368 1209 2066 -365 164 180 C ATOM 1415 CG1BILE A 82 18.077 47.573 30.868 0.03 13.82 C ANISOU 1415 CG1BILE A 82 2161 1101 1991 -284 125 107 C ATOM 1416 CG2AILE A 82 17.285 48.458 31.153 0.02 13.61 C ANISOU 1416 CG2AILE A 82 2177 1024 1971 -257 68 151 C ATOM 1417 CG2BILE A 82 17.692 49.748 29.662 0.03 14.48 C ANISOU 1417 CG2BILE A 82 2356 1118 2027 -315 93 215 C ATOM 1418 CD1AILE A 82 18.800 48.121 28.313 0.02 14.97 C ANISOU 1418 CD1AILE A 82 2391 1281 2015 -363 184 161 C ATOM 1419 CD1BILE A 82 18.858 47.181 29.648 0.03 14.54 C ANISOU 1419 CD1BILE A 82 2257 1229 2040 -343 194 103 C ATOM 1420 H AILE A 82 18.552 49.259 33.564 0.05 13.38 H ANISOU 1420 H AILE A 82 2077 949 2058 -258 56 101 H ATOM 1421 H BILE A 82 18.497 49.236 33.621 0.05 13.37 H ANISOU 1421 H BILE A 82 2074 945 2060 -256 53 100 H ATOM 1422 HA AILE A 82 20.184 49.957 31.566 0.05 14.60 H ANISOU 1422 HA AILE A 82 2245 1132 2170 -374 158 125 H ATOM 1423 HA BILE A 82 19.803 49.749 31.292 0.05 14.51 H ANISOU 1423 HA BILE A 82 2248 1127 2140 -362 152 133 H ATOM 1424 HB AILE A 82 19.205 47.941 30.886 0.05 14.00 H ANISOU 1424 HB AILE A 82 2164 1119 2038 -307 144 100 H ATOM 1425 HB BILE A 82 17.034 49.221 31.529 0.05 13.51 H ANISOU 1425 HB BILE A 82 2162 990 1980 -248 53 154 H ATOM 1426 HG12AILE A 82 18.059 49.823 29.160 0.05 14.98 H ANISOU 1426 HG12AILE A 82 2430 1193 2066 -361 136 224 H ATOM 1427 HG12BILE A 82 18.538 47.228 31.646 0.05 13.60 H ANISOU 1427 HG12BILE A 82 2088 1074 2003 -269 125 75 H ATOM 1428 HG13AILE A 82 19.640 49.730 29.241 0.05 15.24 H ANISOU 1428 HG13AILE A 82 2404 1261 2126 -408 206 175 H ATOM 1429 HG13BILE A 82 17.206 47.157 30.803 0.05 13.63 H ANISOU 1429 HG13BILE A 82 2150 1086 1942 -260 105 107 H ATOM 1430 HG21AILE A 82 17.003 47.663 30.673 0.05 13.57 H ANISOU 1430 HG21AILE A 82 2173 1047 1934 -248 69 142 H ATOM 1431 HG21BILE A 82 17.450 50.680 29.787 0.05 14.44 H ANISOU 1431 HG21BILE A 82 2379 1077 2033 -293 57 244 H ATOM 1432 HG22AILE A 82 17.227 48.311 32.105 0.05 13.24 H ANISOU 1432 HG22AILE A 82 2102 967 1962 -230 50 129 H ATOM 1433 HG22BILE A 82 18.524 49.688 29.169 0.05 14.94 H ANISOU 1433 HG22BILE A 82 2424 1173 2080 -360 131 226 H ATOM 1434 HG23AILE A 82 16.736 49.222 30.911 0.05 13.80 H ANISOU 1434 HG23AILE A 82 2240 1018 1985 -257 48 190 H ATOM 1435 HG23BILE A 82 16.990 49.292 29.174 0.05 14.50 H ANISOU 1435 HG23BILE A 82 2366 1154 1987 -308 94 211 H ATOM 1436 HD11AILE A 82 18.249 48.399 27.565 0.05 15.27 H ANISOU 1436 HD11AILE A 82 2482 1320 2002 -371 171 201 H ATOM 1437 HD11BILE A 82 19.634 47.759 29.569 0.05 14.82 H ANISOU 1437 HD11BILE A 82 2278 1253 2100 -375 217 106 H ATOM 1438 HD12AILE A 82 19.709 47.956 28.011 0.05 15.29 H ANISOU 1438 HD12AILE A 82 2409 1350 2050 -393 235 136 H ATOM 1439 HD12BILE A 82 19.141 46.258 29.740 0.05 14.51 H ANISOU 1439 HD12BILE A 82 2220 1256 2038 -334 216 64 H ATOM 1440 HD13AILE A 82 18.432 47.321 28.723 0.05 14.50 H ANISOU 1440 HD13AILE A 82 2308 1229 1972 -323 158 133 H ATOM 1441 HD13BILE A 82 18.295 47.274 28.867 0.05 14.82 H ANISOU 1441 HD13BILE A 82 2342 1268 2023 -358 193 136 H ATOM 1442 N AILE A 83 19.249 52.113 31.347 0.02 15.19 N ANISOU 1442 N AILE A 83 2437 1102 2234 -401 130 221 N ATOM 1443 N BILE A 83 19.247 52.116 31.327 0.03 15.17 N ANISOU 1443 N BILE A 83 2434 1101 2229 -399 128 221 N ATOM 1444 CA AILE A 83 18.795 53.501 31.298 0.02 15.68 C ANISOU 1444 CA AILE A 83 2569 1086 2303 -413 113 278 C ATOM 1445 CA BILE A 83 18.806 53.512 31.213 0.03 15.69 C ANISOU 1445 CA BILE A 83 2571 1090 2300 -413 114 280 C ATOM 1446 C AILE A 83 18.209 53.781 29.925 0.02 16.11 C ANISOU 1446 C AILE A 83 2696 1143 2283 -411 108 348 C ATOM 1447 C BILE A 83 18.173 53.686 29.869 0.03 16.07 C ANISOU 1447 C BILE A 83 2689 1143 2274 -407 106 347 C ATOM 1448 O AILE A 83 18.947 53.756 28.956 0.02 16.58 O ANISOU 1448 O AILE A 83 2768 1246 2285 -458 156 363 O ATOM 1449 O BILE A 83 18.839 53.522 28.864 0.03 16.47 O ANISOU 1449 O BILE A 83 2752 1243 2264 -448 150 360 O ATOM 1450 CB AILE A 83 19.968 54.491 31.504 0.02 16.46 C ANISOU 1450 CB AILE A 83 2674 1145 2435 -496 162 283 C ATOM 1451 CB BILE A 83 19.942 54.513 31.220 0.03 16.50 C ANISOU 1451 CB BILE A 83 2684 1158 2426 -498 167 290 C ATOM 1452 CG1AILE A 83 20.818 54.145 32.741 0.02 16.27 C ANISOU 1452 CG1AILE A 83 2563 1144 2473 -516 172 206 C ATOM 1453 CG1BILE A 83 20.789 54.358 32.456 0.03 16.36 C ANISOU 1453 CG1BILE A 83 2600 1133 2484 -515 166 224 C ATOM 1454 CG2AILE A 83 19.448 55.928 31.535 0.02 17.01 C ANISOU 1454 CG2AILE A 83 2822 1112 2530 -501 140 338 C ATOM 1455 CG2BILE A 83 19.416 55.954 31.092 0.03 17.22 C ANISOU 1455 CG2BILE A 83 2869 1159 2515 -513 157 367 C ATOM 1456 CD1AILE A 83 20.065 53.928 34.016 0.02 15.61 C ANISOU 1456 CD1AILE A 83 2454 1047 2431 -455 114 163 C ATOM 1457 CD1BILE A 83 22.096 53.885 32.081 0.03 17.08 C ANISOU 1457 CD1BILE A 83 2652 1243 2594 -604 232 205 C ATOM 1458 H AILE A 83 20.029 52.016 31.010 0.05 15.50 H ANISOU 1458 H AILE A 83 2457 1164 2267 -440 169 211 H ATOM 1459 H BILE A 83 19.979 51.961 30.915 0.05 15.46 H ANISOU 1459 H BILE A 83 2454 1164 2255 -435 168 212 H ATOM 1460 HA AILE A 83 18.125 53.662 31.974 0.05 15.38 H ANISOU 1460 HA AILE A 83 2532 1017 2294 -374 75 270 H ATOM 1461 HA BILE A 83 18.179 53.742 31.909 0.05 15.42 H ANISOU 1461 HA BILE A 83 2540 1022 2299 -377 78 272 H ATOM 1462 HB AILE A 83 20.556 54.431 30.736 0.05 16.88 H ANISOU 1462 HB AILE A 83 2738 1224 2452 -537 204 303 H ATOM 1463 HB BILE A 83 20.502 54.345 30.447 0.05 16.78 H ANISOU 1463 HB BILE A 83 2712 1235 2430 -534 210 292 H ATOM 1464 HG12AILE A 83 21.342 53.355 32.552 0.05 16.14 H ANISOU 1464 HG12AILE A 83 2502 1186 2443 -519 194 181 H ATOM 1465 HG12BILE A 83 20.912 55.225 32.879 0.05 16.47 H ANISOU 1465 HG12BILE A 83 2641 1088 2528 -509 142 230 H ATOM 1466 HG13AILE A 83 21.418 54.893 32.900 0.05 16.82 H ANISOU 1466 HG13AILE A 83 2638 1184 2570 -571 198 208 H ATOM 1467 HG13BILE A 83 20.380 53.745 33.079 0.05 15.80 H ANISOU 1467 HG13BILE A 83 2483 1102 2420 -476 146 184 H ATOM 1468 HG21AILE A 83 19.837 56.404 30.785 0.05 17.69 H ANISOU 1468 HG21AILE A 83 2941 1177 2603 -557 178 373 H ATOM 1469 HG21BILE A 83 19.991 56.444 30.483 0.05 17.68 H ANISOU 1469 HG21BILE A 83 2929 1179 2609 -564 183 362 H ATOM 1470 HG22AILE A 83 18.482 55.921 31.456 0.05 16.86 H ANISOU 1470 HG22AILE A 83 2836 1081 2488 -451 104 369 H ATOM 1471 HG22BILE A 83 18.511 55.950 30.745 0.05 17.59 H ANISOU 1471 HG22BILE A 83 2958 1218 2507 -526 170 414 H ATOM 1472 HG23AILE A 83 19.719 56.342 32.370 0.05 16.91 H ANISOU 1472 HG23AILE A 83 2788 1068 2568 -498 127 303 H ATOM 1473 HG23BILE A 83 19.417 56.371 31.966 0.05 16.93 H ANISOU 1473 HG23BILE A 83 2846 1090 2496 -460 111 371 H ATOM 1474 HD11AILE A 83 19.730 53.018 34.035 0.05 15.10 H ANISOU 1474 HD11AILE A 83 2384 1011 2343 -404 91 162 H ATOM 1475 HD11BILE A 83 22.034 52.939 31.894 0.05 16.90 H ANISOU 1475 HD11BILE A 83 2582 1283 2557 -600 252 177 H ATOM 1476 HD12AILE A 83 20.666 54.075 34.760 0.05 15.61 H ANISOU 1476 HD12AILE A 83 2401 1070 2461 -471 118 119 H ATOM 1477 HD12BILE A 83 22.391 54.344 31.281 0.05 17.66 H ANISOU 1477 HD12BILE A 83 2775 1291 2642 -645 264 252 H ATOM 1478 HD13AILE A 83 19.331 54.559 34.058 0.05 15.79 H ANISOU 1478 HD13AILE A 83 2518 1011 2472 -451 95 181 H ATOM 1479 HD13BILE A 83 22.706 54.072 32.806 0.05 17.21 H ANISOU 1479 HD13BILE A 83 2641 1237 2661 -625 225 172 H ATOM 1480 N ILE A 84 16.891 54.019 29.864 0.05 16.06 N ANISOU 1480 N ILE A 84 2731 1095 2275 -353 49 388 N ATOM 1481 CA ILE A 84 16.174 54.259 28.616 0.05 16.61 C ANISOU 1481 CA ILE A 84 2871 1166 2276 -343 25 461 C ATOM 1482 C ILE A 84 16.455 55.677 28.068 0.05 17.66 C ANISOU 1482 C ILE A 84 3087 1222 2403 -388 44 540 C ATOM 1483 O ILE A 84 16.007 56.688 28.640 0.05 17.91 O ANISOU 1483 O ILE A 84 3141 1164 2499 -379 30 554 O ATOM 1484 CB ILE A 84 14.677 54.123 28.844 0.05 16.28 C ANISOU 1484 CB ILE A 84 2829 1117 2242 -259 -49 471 C ATOM 1485 CG1 ILE A 84 14.318 52.781 29.495 0.05 15.37 C ANISOU 1485 CG1 ILE A 84 2640 1068 2134 -223 -62 401 C ATOM 1486 CG2 ILE A 84 13.894 54.411 27.520 0.05 17.04 C ANISOU 1486 CG2 ILE A 84 2993 1220 2261 -245 -87 551 C ATOM 1487 CD1 ILE A 84 14.582 51.561 28.663 0.05 15.30 C ANISOU 1487 CD1 ILE A 84 2613 1142 2060 -256 -28 374 C ATOM 1488 H AILE A 84 16.378 54.026 30.547 0.05 15.74 H ANISOU 1488 H AILE A 84 2678 1031 2272 -317 20 371 H ATOM 1489 H BILE A 84 16.404 54.089 30.561 0.05 15.78 H ANISOU 1489 H BILE A 84 2685 1032 2279 -320 22 373 H ATOM 1490 HA ILE A 84 16.431 53.603 27.960 0.05 16.64 H ANISOU 1490 HA ILE A 84 2870 1226 2228 -360 45 455 H ATOM 1491 HB ILE A 84 14.429 54.818 29.478 0.05 16.30 H ANISOU 1491 HB ILE A 84 2835 1062 2296 -237 -65 474 H ATOM 1492 HG12 ILE A 84 14.840 52.671 30.306 0.05 14.98 H ANISOU 1492 HG12 ILE A 84 2554 1009 2131 -223 -47 359 H ATOM 1493 HG13 ILE A 84 13.375 52.790 29.719 0.05 15.27 H ANISOU 1493 HG13 ILE A 84 2625 1054 2124 -176 -105 409 H ATOM 1494 HG21 ILE A 84 14.516 54.471 26.781 0.05 17.11 H ANISOU 1494 HG21 ILE A 84 3004 1287 2212 -273 -67 545 H ATOM 1495 HG22 ILE A 84 13.270 53.681 27.371 0.05 16.86 H ANISOU 1495 HG22 ILE A 84 2956 1199 2249 -191 -137 551 H ATOM 1496 HG23 ILE A 84 13.416 55.248 27.610 0.05 17.68 H ANISOU 1496 HG23 ILE A 84 3127 1248 2342 -262 -83 604 H ATOM 1497 HD11 ILE A 84 15.532 51.377 28.645 0.05 15.41 H ANISOU 1497 HD11 ILE A 84 2618 1162 2076 -298 19 358 H ATOM 1498 HD12 ILE A 84 14.114 50.818 29.075 0.05 14.78 H ANISOU 1498 HD12 ILE A 84 2506 1103 2008 -228 -40 333 H ATOM 1499 HD13 ILE A 84 14.240 51.694 27.767 0.05 15.74 H ANISOU 1499 HD13 ILE A 84 2707 1214 2059 -259 -42 410 H ATOM 1500 N PRO A 85 17.168 55.764 26.942 0.05 18.41 N ANISOU 1500 N PRO A 85 3235 1345 2415 -437 77 592 N ATOM 1501 CA PRO A 85 17.522 57.068 26.379 0.05 19.57 C ANISOU 1501 CA PRO A 85 3479 1413 2544 -476 90 687 C ATOM 1502 C PRO A 85 16.295 57.860 26.006 0.05 19.97 C ANISOU 1502 C PRO A 85 3595 1406 2587 -396 2 763 C ATOM 1503 O PRO A 85 15.273 57.357 25.583 0.05 19.70 O ANISOU 1503 O PRO A 85 3550 1425 2511 -331 -61 767 O ATOM 1504 CB PRO A 85 18.374 56.722 25.150 0.05 20.26 C ANISOU 1504 CB PRO A 85 3600 1570 2530 -553 158 714 C ATOM 1505 CG PRO A 85 18.261 55.276 24.951 0.05 19.38 C ANISOU 1505 CG PRO A 85 3391 1565 2406 -553 188 612 C ATOM 1506 CD PRO A 85 17.601 54.648 26.086 0.05 18.34 C ANISOU 1506 CD PRO A 85 3204 1440 2326 -466 116 563 C ATOM 1507 HA PRO A 85 18.056 57.571 27.013 0.05 19.70 H ANISOU 1507 HA PRO A 85 3490 1376 2619 -508 117 675 H ATOM 1508 HB2 PRO A 85 18.041 57.202 24.378 0.05 20.73 H ANISOU 1508 HB2 PRO A 85 3716 1639 2521 -536 128 770 H ATOM 1509 HB3 PRO A 85 19.294 56.967 25.326 0.05 20.81 H ANISOU 1509 HB3 PRO A 85 3688 1605 2613 -615 211 730 H ATOM 1510 HG2 PRO A 85 17.754 55.107 24.141 0.05 19.68 H ANISOU 1510 HG2 PRO A 85 3452 1659 2367 -566 201 624 H ATOM 1511 HG3 PRO A 85 19.157 54.920 24.861 0.05 19.32 H ANISOU 1511 HG3 PRO A 85 3342 1560 2440 -595 238 572 H ATOM 1512 HD2 PRO A 85 16.819 54.154 25.794 0.05 18.31 H ANISOU 1512 HD2 PRO A 85 3216 1467 2274 -430 76 578 H ATOM 1513 HD3 PRO A 85 18.225 54.084 26.567 0.05 17.79 H ANISOU 1513 HD3 PRO A 85 3070 1402 2289 -469 138 499 H ATOM 1514 N LEU A 86 16.427 59.172 26.206 0.05 20.72 N ANISOU 1514 N LEU A 86 3752 1383 2738 -400 -2 820 N ATOM 1515 CA LEU A 86 15.336 60.129 26.013 0.05 21.35 C ANISOU 1515 CA LEU A 86 3895 1385 2832 -320 -80 897 C ATOM 1516 C LEU A 86 14.649 59.959 24.688 0.05 22.16 C ANISOU 1516 C LEU A 86 4069 1539 2814 -318 -109 987 C ATOM 1517 O LEU A 86 15.264 60.023 23.622 0.05 22.69 O ANISOU 1517 O LEU A 86 4176 1645 2800 -401 -47 1016 O ATOM 1518 CB LEU A 86 15.789 61.607 26.143 0.05 22.27 C ANISOU 1518 CB LEU A 86 4082 1353 3027 -342 -61 946 C ATOM 1519 CG LEU A 86 15.939 62.164 27.566 0.05 21.83 C ANISOU 1519 CG LEU A 86 3974 1250 3070 -394 -5 857 C ATOM 1520 CD1 LEU A 86 15.951 63.674 27.489 0.05 22.98 C ANISOU 1520 CD1 LEU A 86 4200 1241 3290 -440 25 902 C ATOM 1521 CD2 LEU A 86 14.842 61.697 28.534 0.05 20.67 C ANISOU 1521 CD2 LEU A 86 3736 1130 2988 -315 -48 760 C ATOM 1522 H LEU A 86 17.160 59.546 26.458 0.05 20.94 H ANISOU 1522 H LEU A 86 3785 1371 2800 -449 41 812 H ATOM 1523 HA LEU A 86 14.672 59.946 26.692 0.05 20.76 H ANISOU 1523 HA LEU A 86 3773 1324 2792 -254 -125 859 H ATOM 1524 HB2 LEU A 86 16.649 61.716 25.703 0.05 23.10 H ANISOU 1524 HB2 LEU A 86 4253 1438 3085 -393 -32 1012 H ATOM 1525 HB3 LEU A 86 15.132 62.154 25.689 0.05 22.48 H ANISOU 1525 HB3 LEU A 86 4126 1328 3087 -271 -116 971 H ATOM 1526 HG LEU A 86 16.792 61.877 27.929 0.05 21.59 H ANISOU 1526 HG LEU A 86 3912 1279 3014 -457 45 825 H ATOM 1527 HD11 LEU A 86 16.578 64.004 28.149 0.05 22.62 H ANISOU 1527 HD11 LEU A 86 4113 1168 3313 -447 37 833 H ATOM 1528 HD12 LEU A 86 16.229 63.926 26.597 0.05 23.56 H ANISOU 1528 HD12 LEU A 86 4311 1312 3331 -517 77 938 H ATOM 1529 HD13 LEU A 86 15.058 64.007 27.669 0.05 23.53 H ANISOU 1529 HD13 LEU A 86 4324 1245 3371 -384 -19 960 H ATOM 1530 HD21 LEU A 86 14.689 62.394 29.189 0.05 20.90 H ANISOU 1530 HD21 LEU A 86 3778 1077 3085 -296 -56 748 H ATOM 1531 HD22 LEU A 86 14.026 61.536 28.036 0.05 20.46 H ANISOU 1531 HD22 LEU A 86 3701 1141 2933 -252 -96 775 H ATOM 1532 HD23 LEU A 86 15.135 60.882 28.975 0.05 20.02 H ANISOU 1532 HD23 LEU A 86 3594 1108 2906 -347 -19 696 H ATOM 1533 N ASP A 87 13.346 59.742 24.814 0.05 22.31 N ANISOU 1533 N ASP A 87 4094 1571 2813 -225 -203 1023 N ATOM 1534 CA ASP A 87 12.399 59.612 23.705 0.05 23.22 C ANISOU 1534 CA ASP A 87 4277 1742 2805 -216 -250 1109 C ATOM 1535 C ASP A 87 12.521 58.327 22.833 0.05 22.76 C ANISOU 1535 C ASP A 87 4182 1824 2641 -266 -218 1054 C ATOM 1536 O ASP A 87 11.935 58.256 21.789 0.05 23.54 O ANISOU 1536 O ASP A 87 4339 1984 2623 -273 -248 1111 O ATOM 1537 CB ASP A 87 12.395 60.922 22.861 0.05 24.74 C ANISOU 1537 CB ASP A 87 4599 1855 2944 -268 -222 1232 C ATOM 1538 CG ASP A 87 11.554 62.086 23.518 0.05 25.53 C ANISOU 1538 CG ASP A 87 4757 1802 3143 -208 -265 1304 C ATOM 1539 OD1 ASP A 87 12.010 62.672 24.521 0.05 24.88 O ANISOU 1539 OD1 ASP A 87 4619 1647 3187 -186 -250 1235 O ATOM 1540 OD2 ASP A 87 10.466 62.458 22.996 0.05 26.93 O ANISOU 1540 OD2 ASP A 87 5039 1926 3268 -180 -315 1429 O ATOM 1541 H ASP A 87 12.966 59.664 25.582 0.05 21.97 H ANISOU 1541 H ASP A 87 4013 1507 2826 -166 -242 998 H ATOM 1542 HA ASP A 87 11.520 59.550 24.110 0.05 23.33 H ANISOU 1542 HA ASP A 87 4281 1754 2831 -141 -324 1127 H ATOM 1543 HB2 ASP A 87 13.306 61.234 22.767 0.05 24.73 H ANISOU 1543 HB2 ASP A 87 4606 1852 2939 -347 -143 1216 H ATOM 1544 HB3 ASP A 87 12.017 60.739 21.987 0.05 25.35 H ANISOU 1544 HB3 ASP A 87 4721 1982 2927 -263 -255 1286 H ATOM 1545 N SER A 88 13.147 57.259 23.337 0.05 21.57 N ANISOU 1545 N SER A 88 3937 1726 2531 -295 -163 941 N ATOM 1546 CA SER A 88 13.646 56.160 22.436 0.05 21.37 C ANISOU 1546 CA SER A 88 3893 1815 2413 -355 -110 892 C ATOM 1547 C SER A 88 12.818 54.991 21.763 0.05 21.51 C ANISOU 1547 C SER A 88 3910 1930 2333 -316 -181 889 C ATOM 1548 O SER A 88 13.387 54.348 20.908 0.05 22.54 O ANISOU 1548 O SER A 88 4119 2105 2340 -346 -188 950 O ATOM 1549 CB SER A 88 14.945 55.565 23.007 0.05 20.23 C ANISOU 1549 CB SER A 88 3650 1696 2341 -385 -41 778 C ATOM 1550 OG SER A 88 14.752 54.904 24.262 0.05 19.13 O ANISOU 1550 OG SER A 88 3424 1565 2280 -316 -89 706 O ATOM 1551 H SER A 88 13.309 57.146 24.170 0.05 20.96 H ANISOU 1551 H SER A 88 3812 1620 2530 -281 -155 895 H ATOM 1552 HA SER A 88 13.955 56.650 21.655 0.05 22.11 H ANISOU 1552 HA SER A 88 4045 1904 2451 -412 -64 937 H ATOM 1553 HB2 SER A 88 15.315 54.943 22.361 0.05 20.25 H ANISOU 1553 HB2 SER A 88 3644 1765 2285 -423 -1 749 H ATOM 1554 HB3 SER A 88 15.578 56.289 23.151 0.05 20.34 H ANISOU 1554 HB3 SER A 88 3670 1657 2403 -419 1 784 H ATOM 1555 HG SER A 88 15.370 54.350 24.390 0.05 18.64 H ANISOU 1555 HG SER A 88 3319 1497 2266 -331 -54 658 H ATOM 1556 N GLU A 89 11.518 54.830 21.984 0.05 20.70 N ANISOU 1556 N GLU A 89 3730 1846 2289 -246 -245 832 N ATOM 1557 CA GLU A 89 10.724 53.605 21.649 0.05 20.42 C ANISOU 1557 CA GLU A 89 3649 1910 2200 -222 -294 777 C ATOM 1558 C GLU A 89 11.293 52.349 22.327 0.05 19.30 C ANISOU 1558 C GLU A 89 3422 1810 2100 -250 -228 662 C ATOM 1559 O GLU A 89 12.372 51.887 21.966 0.05 19.36 O ANISOU 1559 O GLU A 89 3440 1854 2061 -317 -146 630 O ATOM 1560 CB GLU A 89 10.524 53.341 20.129 0.05 21.54 C ANISOU 1560 CB GLU A 89 3865 2130 2187 -251 -321 824 C ATOM 1561 CG GLU A 89 9.735 54.396 19.222 0.05 22.82 C ANISOU 1561 CG GLU A 89 4110 2266 2294 -204 -419 945 C ATOM 1562 CD GLU A 89 8.182 54.317 19.261 0.05 22.67 C ANISOU 1562 CD GLU A 89 4031 2231 2353 -102 -534 948 C ATOM 1563 OE1 GLU A 89 7.605 54.074 20.325 0.05 21.66 O ANISOU 1563 OE1 GLU A 89 3819 2057 2353 -64 -524 889 O ATOM 1564 OE2 GLU A 89 7.501 54.544 18.234 0.05 23.70 O ANISOU 1564 OE2 GLU A 89 4196 2397 2412 -60 -634 1010 O ATOM 1565 H GLU A 89 11.029 55.442 22.287 0.05 20.29 H ANISOU 1565 H GLU A 89 3646 1747 2316 -214 -256 818 H ATOM 1566 HA GLU A 89 9.837 53.744 22.008 0.05 20.26 H ANISOU 1566 HA GLU A 89 3597 1876 2225 -164 -357 777 H ATOM 1567 HB2 GLU A 89 11.401 53.263 19.751 0.05 21.81 H ANISOU 1567 HB2 GLU A 89 3937 2178 2173 -311 -253 827 H ATOM 1568 HB3 GLU A 89 10.068 52.487 20.037 0.05 21.27 H ANISOU 1568 HB3 GLU A 89 3792 2159 2130 -243 -346 769 H ATOM 1569 HG2 GLU A 89 9.989 55.293 19.490 0.05 23.22 H ANISOU 1569 HG2 GLU A 89 4211 2249 2361 -216 -393 1006 H ATOM 1570 HG3 GLU A 89 9.997 54.254 18.298 0.05 23.50 H ANISOU 1570 HG3 GLU A 89 4240 2416 2273 -227 -436 964 H ATOM 1571 N HIS A 90 10.544 51.830 23.302 0.05 18.40 N ANISOU 1571 N HIS A 90 3226 1689 2076 -196 -263 603 N ATOM 1572 CA HIS A 90 10.920 50.663 24.075 0.05 17.35 C ANISOU 1572 CA HIS A 90 3015 1576 2001 -208 -210 505 C ATOM 1573 C HIS A 90 9.715 49.825 24.368 0.05 16.79 C ANISOU 1573 C HIS A 90 2875 1537 1966 -162 -261 448 C ATOM 1574 O HIS A 90 8.610 50.339 24.548 0.05 16.81 O ANISOU 1574 O HIS A 90 2857 1515 2016 -104 -327 471 O ATOM 1575 CB HIS A 90 11.644 51.044 25.396 0.05 16.77 C ANISOU 1575 CB HIS A 90 2914 1430 2028 -209 -164 491 C ATOM 1576 CG HIS A 90 10.971 52.104 26.245 0.05 16.75 C ANISOU 1576 CG HIS A 90 2910 1353 2102 -150 -215 527 C ATOM 1577 ND1 HIS A 90 11.020 53.452 25.948 0.05 17.62 N ANISOU 1577 ND1 HIS A 90 3090 1403 2202 -139 -244 614 N ATOM 1578 CD2 HIS A 90 10.282 52.009 27.413 0.05 16.09 C ANISOU 1578 CD2 HIS A 90 2767 1240 2106 -99 -236 487 C ATOM 1579 CE1 HIS A 90 10.389 54.126 26.889 0.05 17.48 C ANISOU 1579 CE1 HIS A 90 3052 1321 2269 -78 -281 619 C ATOM 1580 NE2 HIS A 90 9.928 53.290 27.789 0.05 16.56 N ANISOU 1580 NE2 HIS A 90 2857 1225 2210 -56 -274 541 N ATOM 1581 H HIS A 90 9.782 52.147 23.532 0.05 18.44 H ANISOU 1581 H HIS A 90 3220 1677 2109 -150 -317 621 H ATOM 1582 HA HIS A 90 11.523 50.113 23.556 0.05 17.46 H ANISOU 1582 HA HIS A 90 3038 1630 1966 -250 -166 480 H ATOM 1583 HB2 HIS A 90 11.738 50.245 25.931 0.05 16.15 H ANISOU 1583 HB2 HIS A 90 2785 1367 1984 -210 -139 432 H ATOM 1584 HB3 HIS A 90 12.524 51.384 25.168 0.05 17.14 H ANISOU 1584 HB3 HIS A 90 2997 1462 2055 -251 -122 516 H ATOM 1585 HD2 HIS A 90 10.084 51.227 27.873 0.05 15.50 H ANISOU 1585 HD2 HIS A 90 2644 1188 2057 -94 -224 434 H ATOM 1586 HE1 HIS A 90 10.275 55.053 26.907 0.05 18.02 H ANISOU 1586 HE1 HIS A 90 3158 1334 2355 -55 -305 670 H ATOM 1587 N HIS A 91 9.941 48.515 24.289 0.05 16.40 N ANISOU 1587 N HIS A 91 2791 1542 1899 -189 -226 372 N ATOM 1588 CA HIS A 91 9.137 47.492 24.983 0.05 15.88 C ANISOU 1588 CA HIS A 91 2659 1500 1876 -160 -257 310 C ATOM 1589 C HIS A 91 10.060 46.350 25.573 0.05 15.30 C ANISOU 1589 C HIS A 91 2548 1445 1823 -188 -190 227 C ATOM 1590 O HIS A 91 11.282 46.423 25.539 0.05 15.45 O ANISOU 1590 O HIS A 91 2586 1478 1805 -231 -123 207 O ATOM 1591 CB HIS A 91 8.030 47.006 24.024 0.05 16.57 C ANISOU 1591 CB HIS A 91 2753 1643 1900 -147 -339 320 C ATOM 1592 CG HIS A 91 8.498 46.196 22.851 0.05 17.14 C ANISOU 1592 CG HIS A 91 2858 1788 1868 -196 -329 284 C ATOM 1593 ND1 HIS A 91 9.132 46.733 21.750 0.05 18.04 N ANISOU 1593 ND1 HIS A 91 3052 1935 1870 -232 -324 332 N ATOM 1594 CD2 HIS A 91 8.326 44.876 22.574 0.05 17.10 C ANISOU 1594 CD2 HIS A 91 2821 1830 1847 -216 -330 205 C ATOM 1595 CE1 HIS A 91 9.346 45.782 20.860 0.05 18.51 C ANISOU 1595 CE1 HIS A 91 3126 2064 1844 -270 -320 277 C ATOM 1596 NE2 HIS A 91 8.891 44.640 21.345 0.05 17.93 N ANISOU 1596 NE2 HIS A 91 2984 1996 1833 -262 -321 195 N ATOM 1597 H HIS A 91 10.576 48.170 23.827 0.05 16.51 H ANISOU 1597 H HIS A 91 2818 1576 1878 -225 -181 355 H ATOM 1598 HA HIS A 91 8.701 47.928 25.728 0.05 15.52 H ANISOU 1598 HA HIS A 91 2585 1417 1896 -126 -271 315 H ATOM 1599 HB2 HIS A 91 7.433 46.431 24.536 0.05 16.25 H ANISOU 1599 HB2 HIS A 91 2661 1603 1909 -123 -362 289 H ATOM 1600 HB3 HIS A 91 7.529 47.750 23.673 0.05 17.06 H ANISOU 1600 HB3 HIS A 91 2846 1691 1944 -127 -379 380 H ATOM 1601 HD2 HIS A 91 7.925 44.249 23.130 0.05 16.64 H ANISOU 1601 HD2 HIS A 91 2714 1762 1848 -205 -329 162 H ATOM 1602 HE1 HIS A 91 9.782 45.896 20.045 0.05 19.17 H ANISOU 1602 HE1 HIS A 91 3262 2184 1839 -301 -310 291 H ATOM 1603 N AVAL A 92 9.443 45.285 26.089 0.03 14.79 N ANISOU 1603 N AVAL A 92 2425 1377 1816 -163 -206 179 N ATOM 1604 N BVAL A 92 9.423 45.305 26.081 0.02 14.74 N ANISOU 1604 N BVAL A 92 2417 1366 1816 -161 -204 180 N ATOM 1605 CA AVAL A 92 10.120 44.215 26.817 0.03 14.21 C ANISOU 1605 CA AVAL A 92 2312 1297 1790 -171 -154 112 C ATOM 1606 CA BVAL A 92 10.109 44.217 26.756 0.02 14.19 C ANISOU 1606 CA BVAL A 92 2310 1294 1790 -171 -152 111 C ATOM 1607 C AVAL A 92 9.545 42.949 26.233 0.03 14.43 C ANISOU 1607 C AVAL A 92 2326 1364 1794 -187 -168 54 C ATOM 1608 C BVAL A 92 9.533 42.941 26.200 0.02 14.44 C ANISOU 1608 C BVAL A 92 2327 1365 1794 -187 -168 55 C ATOM 1609 O AVAL A 92 8.364 42.931 25.908 0.03 14.51 O ANISOU 1609 O AVAL A 92 2309 1384 1821 -171 -222 51 O ATOM 1610 O BVAL A 92 8.342 42.889 25.885 0.02 14.52 O ANISOU 1610 O BVAL A 92 2311 1385 1821 -171 -222 52 O ATOM 1611 CB AVAL A 92 9.861 44.334 28.351 0.03 13.51 C ANISOU 1611 CB AVAL A 92 2179 1160 1794 -133 -154 110 C ATOM 1612 CB BVAL A 92 9.926 44.314 28.295 0.02 13.47 C ANISOU 1612 CB BVAL A 92 2171 1155 1792 -134 -149 104 C ATOM 1613 CG1AVAL A 92 10.661 43.361 29.161 0.03 13.04 C ANISOU 1613 CG1AVAL A 92 2087 1089 1780 -135 -107 54 C ATOM 1614 CG1BVAL A 92 10.596 43.170 29.010 0.02 13.04 C ANISOU 1614 CG1BVAL A 92 2087 1090 1778 -139 -98 47 C ATOM 1615 CG2AVAL A 92 10.155 45.788 28.839 0.03 13.41 C ANISOU 1615 CG2AVAL A 92 2184 1105 1808 -119 -148 160 C ATOM 1616 CG2BVAL A 92 10.428 45.687 28.793 0.02 13.33 C ANISOU 1616 CG2BVAL A 92 2167 1095 1805 -118 -145 152 C ATOM 1617 H AVAL A 92 8.605 45.154 25.994 0.05 14.83 H ANISOU 1617 H AVAL A 92 2413 1383 1837 -140 -249 187 H ATOM 1618 H BVAL A 92 8.579 45.204 26.016 0.05 14.72 H ANISOU 1618 H BVAL A 92 2397 1358 1837 -136 -244 191 H ATOM 1619 HA AVAL A 92 11.075 44.226 26.650 0.05 14.23 H ANISOU 1619 HA AVAL A 92 2326 1299 1780 -192 -108 102 H ATOM 1620 HA BVAL A 92 11.055 44.228 26.547 0.05 14.22 H ANISOU 1620 HA BVAL A 92 2326 1298 1780 -192 -106 101 H ATOM 1621 HB AVAL A 92 8.948 44.146 28.561 0.05 13.53 H ANISOU 1621 HB AVAL A 92 2163 1164 1812 -114 -191 113 H ATOM 1622 HB BVAL A 92 9.004 44.269 28.537 0.05 13.47 H ANISOU 1622 HB BVAL A 92 2152 1159 1809 -116 -184 104 H ATOM 1623 HG11AVAL A 92 11.590 43.404 28.889 0.05 13.06 H ANISOU 1623 HG11AVAL A 92 2097 1090 1774 -149 -70 46 H ATOM 1624 HG11BVAL A 92 11.317 42.837 28.453 0.05 13.29 H ANISOU 1624 HG11BVAL A 92 2130 1144 1777 -162 -77 19 H ATOM 1625 HG12AVAL A 92 10.587 43.625 30.089 0.05 12.68 H ANISOU 1625 HG12AVAL A 92 2019 1017 1782 -112 -109 58 H ATOM 1626 HG12BVAL A 92 10.945 43.483 29.854 0.05 12.80 H ANISOU 1626 HG12BVAL A 92 2052 1039 1774 -133 -74 54 H ATOM 1627 HG13AVAL A 92 10.311 42.463 29.052 0.05 13.16 H ANISOU 1627 HG13AVAL A 92 2094 1121 1786 -144 -111 22 H ATOM 1628 HG13BVAL A 92 9.948 42.468 29.160 0.05 12.84 H ANISOU 1628 HG13BVAL A 92 2037 1057 1786 -125 -111 31 H ATOM 1629 HG21AVAL A 92 10.278 45.806 29.799 0.05 12.99 H ANISOU 1629 HG21AVAL A 92 2105 1028 1803 -105 -132 144 H ATOM 1630 HG21BVAL A 92 10.791 45.622 29.687 0.05 12.91 H ANISOU 1630 HG21BVAL A 92 2088 1018 1799 -103 -130 135 H ATOM 1631 HG22AVAL A 92 10.960 46.117 28.405 0.05 13.64 H ANISOU 1631 HG22AVAL A 92 2238 1138 1806 -145 -121 170 H ATOM 1632 HG22BVAL A 92 11.110 46.013 28.182 0.05 13.54 H ANISOU 1632 HG22BVAL A 92 2217 1123 1803 -142 -118 163 H ATOM 1633 HG23AVAL A 92 9.401 46.349 28.593 0.05 13.63 H ANISOU 1633 HG23AVAL A 92 2221 1125 1834 -100 -187 193 H ATOM 1634 HG23BVAL A 92 9.675 46.299 28.787 0.05 13.54 H ANISOU 1634 HG23BVAL A 92 2202 1113 1830 -99 -184 185 H ATOM 1635 N ILE A 93 10.400 41.947 26.048 0.05 14.66 N ANISOU 1635 N ILE A 93 2372 1416 1784 -221 -117 5 N ATOM 1636 CA ILE A 93 10.058 40.700 25.358 0.05 14.99 C ANISOU 1636 CA ILE A 93 2407 1486 1802 -244 -119 -64 C ATOM 1637 C ILE A 93 10.503 39.595 26.233 0.05 14.47 C ANISOU 1637 C ILE A 93 2303 1376 1819 -232 -73 -116 C ATOM 1638 O ILE A 93 11.685 39.390 26.455 0.05 14.24 O ANISOU 1638 O ILE A 93 2270 1325 1817 -226 -16 -127 O ATOM 1639 CB ILE A 93 10.777 40.589 23.990 0.05 15.75 C ANISOU 1639 CB ILE A 93 2554 1631 1798 -287 -84 -89 C ATOM 1640 CG1 ILE A 93 10.349 41.685 23.027 0.05 16.42 C ANISOU 1640 CG1 ILE A 93 2692 1760 1788 -299 -134 -23 C ATOM 1641 CG2 ILE A 93 10.466 39.204 23.342 0.05 16.20 C ANISOU 1641 CG2 ILE A 93 2611 1714 1830 -315 -80 -178 C ATOM 1642 CD1 ILE A 93 11.322 41.881 21.830 0.05 17.15 C ANISOU 1642 CD1 ILE A 93 2844 1893 1778 -343 -76 -23 C ATOM 1643 H AILE A 93 11.196 41.934 26.353 0.05 14.71 H ANISOU 1643 H AILE A 93 2392 1421 1777 -233 -79 8 H ATOM 1644 H BILE A 93 11.191 41.938 26.365 0.05 14.71 H ANISOU 1644 H BILE A 93 2392 1420 1777 -233 -79 7 H ATOM 1645 HA ILE A 93 9.102 40.629 25.235 0.05 15.16 H ANISOU 1645 HA ILE A 93 2418 1522 1819 -240 -169 -61 H ATOM 1646 HB ILE A 93 11.732 40.641 24.130 0.05 15.62 H ANISOU 1646 HB ILE A 93 2539 1602 1794 -290 -30 -95 H ATOM 1647 HG12 ILE A 93 9.472 41.476 22.674 0.05 16.77 H ANISOU 1647 HG12 ILE A 93 2736 1833 1802 -302 -186 -32 H ATOM 1648 HG13 ILE A 93 10.317 42.519 23.518 0.05 16.15 H ANISOU 1648 HG13 ILE A 93 2654 1699 1784 -276 -151 32 H ATOM 1649 HG21 ILE A 93 10.802 39.201 22.433 0.05 16.75 H ANISOU 1649 HG21 ILE A 93 2716 1820 1829 -342 -57 -197 H ATOM 1650 HG22 ILE A 93 10.899 38.503 23.850 0.05 15.87 H ANISOU 1650 HG22 ILE A 93 2543 1637 1849 -306 -44 -215 H ATOM 1651 HG23 ILE A 93 9.506 39.084 23.336 0.05 16.35 H ANISOU 1651 HG23 ILE A 93 2620 1747 1844 -315 -136 -176 H ATOM 1652 HD11 ILE A 93 11.188 41.153 21.199 0.05 17.50 H ANISOU 1652 HD11 ILE A 93 2896 1966 1787 -365 -58 -82 H ATOM 1653 HD12 ILE A 93 11.130 42.726 21.397 0.05 17.61 H ANISOU 1653 HD12 ILE A 93 2942 1974 1776 -349 -111 31 H ATOM 1654 HD13 ILE A 93 12.235 41.864 22.145 0.05 16.86 H ANISOU 1654 HD13 ILE A 93 2799 1832 1777 -343 -22 -19 H ATOM 1655 N ASN A 94 9.530 38.834 26.737 0.05 14.37 N ANISOU 1655 N ASN A 94 2260 1350 1851 -228 -99 -146 N ATOM 1656 CA ASN A 94 9.831 37.647 27.545 0.05 14.07 C ANISOU 1656 CA ASN A 94 2197 1262 1886 -220 -56 -192 C ATOM 1657 C ASN A 94 9.463 36.371 26.802 0.05 14.65 C ANISOU 1657 C ASN A 94 2279 1344 1945 -257 -49 -268 C ATOM 1658 O ASN A 94 8.304 35.978 26.770 0.05 14.87 O ANISOU 1658 O ASN A 94 2287 1376 1987 -275 -87 -288 O ATOM 1659 CB ASN A 94 9.075 37.680 28.875 0.05 13.55 C ANISOU 1659 CB ASN A 94 2095 1159 1896 -193 -75 -163 C ATOM 1660 CG ASN A 94 9.380 36.494 29.757 0.05 13.36 C ANISOU 1660 CG ASN A 94 2058 1079 1940 -184 -32 -195 C ATOM 1661 OD1 ASN A 94 10.303 35.747 29.499 0.05 13.53 O ANISOU 1661 OD1 ASN A 94 2094 1082 1967 -186 12 -233 O ATOM 1662 ND2 ASN A 94 8.618 36.349 30.818 0.05 13.10 N ANISOU 1662 ND2 ASN A 94 2000 1017 1960 -172 -41 -175 N ATOM 1663 H ASN A 94 8.701 38.996 26.632 0.05 14.54 H ANISOU 1663 H ASN A 94 2273 1388 1864 -230 -141 -138 H ATOM 1664 HA ASN A 94 10.775 37.611 27.734 0.05 13.93 H ANISOU 1664 HA ASN A 94 2183 1228 1880 -211 -16 -194 H ATOM 1665 HB2 ASN A 94 9.335 38.471 29.366 0.05 13.23 H ANISOU 1665 HB2 ASN A 94 2052 1111 1865 -171 -77 -122 H ATOM 1666 HB3 ASN A 94 8.122 37.703 28.721 0.05 13.74 H ANISOU 1666 HB3 ASN A 94 2105 1199 1916 -202 -111 -164 H ATOM 1667 HD21 ASN A 94 8.898 35.859 31.460 0.05 12.96 H ANISOU 1667 HD21 ASN A 94 1981 965 1978 -160 -17 -177 H ATOM 1668 HD22 ASN A 94 7.863 36.745 30.869 0.05 13.12 H ANISOU 1668 HD22 ASN A 94 1987 1036 1961 -174 -69 -160 H ATOM 1669 N ASN A 95 10.464 35.755 26.193 0.05 15.01 N ANISOU 1669 N ASN A 95 2349 1391 1964 -270 4 -318 N ATOM 1670 CA ASN A 95 10.285 34.470 25.490 0.05 15.70 C ANISOU 1670 CA ASN A 95 2453 1481 2033 -307 18 -405 C ATOM 1671 C ASN A 95 10.457 33.210 26.361 0.05 15.61 C ANISOU 1671 C ASN A 95 2423 1391 2117 -297 52 -447 C ATOM 1672 O ASN A 95 10.400 32.038 25.880 0.05 16.23 O ANISOU 1672 O ASN A 95 2515 1452 2200 -329 65 -524 O ATOM 1673 CB ASN A 95 11.317 34.337 24.361 0.05 16.31 C ANISOU 1673 CB ASN A 95 2567 1592 2040 -325 71 -454 C ATOM 1674 CG ASN A 95 11.033 35.208 23.160 0.05 16.65 C ANISOU 1674 CG ASN A 95 2644 1711 1972 -346 45 -411 C ATOM 1675 OD1 ASN A 95 11.973 35.581 22.467 0.05 16.65 O ANISOU 1675 OD1 ASN A 95 2658 1727 1943 -341 91 -385 O ATOM 1676 ND2 ASN A 95 9.804 35.551 22.924 0.05 17.03 N ANISOU 1676 ND2 ASN A 95 2703 1805 1962 -371 -27 -401 N ATOM 1677 H ASN A 95 11.262 36.058 26.157 0.05 14.93 H ANISOU 1677 H ASN A 95 2345 1381 1947 -260 34 -308 H ATOM 1678 HA ASN A 95 9.396 34.444 25.106 0.05 16.00 H ANISOU 1678 HA ASN A 95 2491 1550 2038 -331 -28 -411 H ATOM 1679 HB2 ASN A 95 12.193 34.568 24.702 0.05 16.10 H ANISOU 1679 HB2 ASN A 95 2530 1537 2050 -301 117 -452 H ATOM 1680 HB3 ASN A 95 11.320 33.416 24.054 0.05 16.83 H ANISOU 1680 HB3 ASN A 95 2644 1656 2092 -350 79 -517 H ATOM 1681 HD21 ASN A 95 9.630 36.300 22.551 0.05 17.36 H ANISOU 1681 HD21 ASN A 95 2771 1890 1934 -383 -46 -377 H ATOM 1682 HD22 ASN A 95 9.168 35.018 23.145 0.05 17.01 H ANISOU 1682 HD22 ASN A 95 2681 1791 1991 -375 -57 -417 H ATOM 1683 N AASN A 96 10.646 33.404 27.636 0.03 14.95 N ANISOU 1683 N AASN A 96 2315 1257 2108 -255 63 -397 N ATOM 1684 N BASN A 96 10.659 33.433 27.654 0.02 14.94 N ANISOU 1684 N BASN A 96 2315 1256 2107 -254 65 -397 N ATOM 1685 CA AASN A 96 10.940 32.351 28.563 0.03 14.92 C ANISOU 1685 CA AASN A 96 2306 1173 2191 -235 100 -417 C ATOM 1686 CA BASN A 96 10.912 32.380 28.627 0.02 14.89 C ANISOU 1686 CA BASN A 96 2302 1169 2189 -233 101 -415 C ATOM 1687 C AASN A 96 9.654 31.873 29.255 0.03 14.84 C ANISOU 1687 C AASN A 96 2279 1125 2234 -250 76 -403 C ATOM 1688 C BASN A 96 9.627 31.858 29.239 0.02 14.85 C ANISOU 1688 C BASN A 96 2282 1127 2235 -250 76 -405 C ATOM 1689 O AASN A 96 8.597 32.490 29.149 0.03 14.75 O ANISOU 1689 O AASN A 96 2248 1155 2202 -271 29 -380 O ATOM 1690 O BASN A 96 8.555 32.451 29.115 0.02 14.80 O ANISOU 1690 O BASN A 96 2255 1162 2206 -274 29 -384 O ATOM 1691 CB AASN A 96 12.050 32.796 29.529 0.03 14.44 C ANISOU 1691 CB AASN A 96 2232 1085 2169 -179 128 -373 C ATOM 1692 CB BASN A 96 11.839 32.874 29.757 0.02 14.34 C ANISOU 1692 CB BASN A 96 2216 1070 2161 -176 122 -362 C ATOM 1693 CG AASN A 96 13.350 33.250 28.799 0.03 14.43 C ANISOU 1693 CG AASN A 96 2232 1138 2113 -174 142 -365 C ATOM 1694 CG BASN A 96 13.185 33.353 29.252 0.02 14.44 C ANISOU 1694 CG BASN A 96 2230 1118 2138 -163 153 -370 C ATOM 1695 OD1AASN A 96 13.425 34.346 28.211 0.03 14.08 O ANISOU 1695 OD1AASN A 96 2184 1134 2032 -176 112 -312 O ATOM 1696 OD1BASN A 96 14.042 32.561 28.884 0.02 15.02 O ANISOU 1696 OD1BASN A 96 2316 1192 2199 -171 196 -434 O ATOM 1697 ND2AASN A 96 14.367 32.469 28.925 0.03 14.92 N ANISOU 1697 ND2AASN A 96 2300 1196 2174 -169 194 -420 N ATOM 1698 ND2BASN A 96 13.369 34.660 29.231 0.02 13.97 N ANISOU 1698 ND2BASN A 96 2156 1090 2061 -147 137 -311 N ATOM 1699 H AASN A 96 10.613 34.186 28.007 0.03 14.56 H ANISOU 1699 H AASN A 96 2255 1218 2057 -237 48 -348 H ATOM 1700 H BASN A 96 10.656 34.226 28.006 0.02 14.55 H ANISOU 1700 H BASN A 96 2256 1218 2055 -235 51 -348 H ATOM 1701 HA AASN A 96 11.293 31.582 28.078 0.03 15.41 H ANISOU 1701 HA AASN A 96 2383 1219 2252 -248 128 -475 H ATOM 1702 HA BASN A 96 11.351 31.629 28.190 0.02 15.36 H ANISOU 1702 HA BASN A 96 2376 1209 2250 -242 131 -470 H ATOM 1703 HB2AASN A 96 11.724 33.553 30.043 0.03 14.01 H ANISOU 1703 HB2AASN A 96 2165 1023 2135 -164 107 -324 H ATOM 1704 HB2BASN A 96 11.408 33.626 30.197 0.02 13.92 H ANISOU 1704 HB2BASN A 96 2150 1029 2108 -168 95 -312 H ATOM 1705 HB3AASN A 96 12.283 32.084 30.140 0.03 14.65 H ANISOU 1705 HB3AASN A 96 2262 1065 2239 -162 159 -398 H ATOM 1706 HB3BASN A 96 11.998 32.180 30.412 0.02 14.41 H ANISOU 1706 HB3BASN A 96 2225 1026 2223 -157 144 -370 H ATOM 1707 HD21AASN A 96 14.880 32.311 28.252 0.03 15.00 H ANISOU 1707 HD21AASN A 96 2308 1237 2153 -170 211 -419 H ATOM 1708 HD21BASN A 96 14.150 34.977 29.067 0.02 14.00 H ANISOU 1708 HD21BASN A 96 2153 1103 2063 -136 160 -311 H ATOM 1709 HD22AASN A 96 14.526 32.117 29.692 0.03 15.22 H ANISOU 1709 HD22AASN A 96 2343 1198 2242 -165 215 -459 H ATOM 1710 HD22BASN A 96 12.712 35.190 29.385 0.02 13.68 H ANISOU 1710 HD22BASN A 96 2117 1062 2018 -149 106 -275 H ATOM 1711 N GLN A 97 9.781 30.756 29.952 0.05 14.98 N ANISOU 1711 N GLN A 97 2304 1062 2324 -236 113 -417 N ATOM 1712 CA GLN A 97 8.688 30.095 30.617 0.05 15.07 C ANISOU 1712 CA GLN A 97 2309 1022 2394 -257 111 -404 C ATOM 1713 C GLN A 97 8.407 30.665 31.998 0.05 14.43 C ANISOU 1713 C GLN A 97 2209 935 2338 -222 101 -321 C ATOM 1714 O GLN A 97 7.413 30.295 32.578 0.05 14.51 O ANISOU 1714 O GLN A 97 2209 921 2384 -244 101 -303 O ATOM 1715 CB GLN A 97 9.058 28.590 30.719 0.05 15.65 C ANISOU 1715 CB GLN A 97 2414 997 2537 -254 161 -447 C ATOM 1716 CG GLN A 97 8.896 27.807 29.415 0.05 16.47 C ANISOU 1716 CG GLN A 97 2541 1088 2629 -293 181 -546 C ATOM 1717 CD GLN A 97 7.441 27.568 29.106 0.05 16.93 C ANISOU 1717 CD GLN A 97 2587 1179 2668 -370 148 -591 C ATOM 1718 OE1 GLN A 97 6.865 28.111 28.163 0.05 17.13 O ANISOU 1718 OE1 GLN A 97 2605 1284 2618 -401 113 -627 O ATOM 1719 NE2 GLN A 97 6.824 26.819 29.942 0.05 17.16 N ANISOU 1719 NE2 GLN A 97 2609 1151 2760 -403 154 -582 N ATOM 1720 H AGLN A 97 10.530 30.369 30.089 0.05 15.08 H ANISOU 1720 H AGLN A 97 2327 1045 2356 -213 143 -430 H ATOM 1721 H BGLN A 97 10.537 30.387 30.103 0.05 15.06 H ANISOU 1721 H BGLN A 97 2325 1043 2354 -212 142 -428 H ATOM 1722 HA GLN A 97 7.886 30.200 30.089 0.05 15.30 H ANISOU 1722 HA GLN A 97 2327 1082 2406 -297 86 -427 H ATOM 1723 HB2 GLN A 97 9.986 28.526 30.986 0.05 15.48 H ANISOU 1723 HB2 GLN A 97 2399 951 2533 -208 180 -424 H ATOM 1724 HB3 GLN A 97 8.503 28.174 31.394 0.05 15.75 H ANISOU 1724 HB3 GLN A 97 2426 972 2588 -271 165 -431 H ATOM 1725 HG2 GLN A 97 9.287 28.308 28.681 0.05 16.44 H ANISOU 1725 HG2 GLN A 97 2539 1129 2579 -282 182 -563 H ATOM 1726 HG3 GLN A 97 9.330 26.943 29.506 0.05 16.83 H ANISOU 1726 HG3 GLN A 97 2607 1062 2727 -281 215 -566 H ATOM 1727 HE21 GLN A 97 6.350 26.164 29.655 0.05 17.69 H ANISOU 1727 HE21 GLN A 97 2677 1206 2838 -449 153 -630 H ATOM 1728 HE22 GLN A 97 6.889 26.987 30.782 0.05 16.82 H ANISOU 1728 HE22 GLN A 97 2561 1086 2746 -380 160 -529 H ATOM 1729 N GLU A 98 9.294 31.517 32.503 0.05 13.91 N ANISOU 1729 N GLU A 98 2140 887 2256 -173 99 -276 N ATOM 1730 CA GLU A 98 9.119 32.111 33.840 0.05 13.42 C ANISOU 1730 CA GLU A 98 2067 821 2212 -145 89 -207 C ATOM 1731 C GLU A 98 8.871 33.637 33.754 0.05 12.96 C ANISOU 1731 C GLU A 98 1985 832 2107 -139 51 -174 C ATOM 1732 O GLU A 98 9.298 34.319 32.795 0.05 12.95 O ANISOU 1732 O GLU A 98 1984 877 2059 -144 34 -187 O ATOM 1733 CB GLU A 98 10.293 31.854 34.806 0.05 13.32 C ANISOU 1733 CB GLU A 98 2071 757 2233 -93 112 -172 C ATOM 1734 CG GLU A 98 11.337 30.729 34.596 0.05 13.73 C ANISOU 1734 CG GLU A 98 2140 764 2312 -66 141 -208 C ATOM 1735 CD GLU A 98 12.660 31.403 34.083 0.05 13.49 C ANISOU 1735 CD GLU A 98 2091 787 2249 -40 136 -215 C ATOM 1736 OE1 GLU A 98 12.635 32.073 33.020 0.05 13.06 O ANISOU 1736 OE1 GLU A 98 2021 795 2148 -53 109 -192 O ATOM 1737 OE2 GLU A 98 13.727 31.356 34.740 0.05 13.84 O ANISOU 1737 OE2 GLU A 98 2135 806 2319 -9 162 -243 O ATOM 1738 H GLU A 98 10.012 31.757 32.105 0.05 13.88 H ANISOU 1738 H GLU A 98 2141 899 2233 -158 105 -285 H ATOM 1739 HA GLU A 98 8.328 31.742 34.257 0.05 13.56 H ANISOU 1739 HA GLU A 98 2081 822 2252 -167 92 -203 H ATOM 1740 HB2 GLU A 98 10.796 32.677 34.866 0.05 12.95 H ANISOU 1740 HB2 GLU A 98 2015 739 2168 -69 97 -142 H ATOM 1741 HB3 GLU A 98 9.907 31.679 35.680 0.05 13.43 H ANISOU 1741 HB3 GLU A 98 2094 736 2274 -96 121 -152 H ATOM 1742 HG2 GLU A 98 11.517 30.287 35.443 0.05 13.83 H ANISOU 1742 HG2 GLU A 98 2164 732 2358 -36 150 -181 H ATOM 1743 HG3 GLU A 98 11.013 30.099 33.935 0.05 14.12 H ANISOU 1743 HG3 GLU A 98 2198 796 2369 -93 154 -253 H ATOM 1744 N ASP A 99 8.134 34.121 34.741 0.05 12.73 N ANISOU 1744 N ASP A 99 1940 806 2092 -133 41 -134 N ATOM 1745 CA ASP A 99 7.863 35.569 34.885 0.05 12.37 C ANISOU 1745 CA ASP A 99 1874 809 2017 -117 8 -100 C ATOM 1746 C ASP A 99 9.159 36.317 34.810 0.05 12.05 C ANISOU 1746 C ASP A 99 1848 779 1952 -85 6 -83 C ATOM 1747 O ASP A 99 10.151 35.948 35.347 0.05 11.97 O ANISOU 1747 O ASP A 99 1850 741 1958 -61 27 -76 O ATOM 1748 CB ASP A 99 7.291 35.797 36.279 0.05 12.22 C ANISOU 1748 CB ASP A 99 1843 777 2022 -102 18 -63 C ATOM 1749 CG ASP A 99 5.832 35.429 36.461 0.05 12.59 C ANISOU 1749 CG ASP A 99 1859 826 2097 -137 24 -75 C ATOM 1750 OD1 ASP A 99 5.028 35.427 35.509 0.05 12.88 O ANISOU 1750 OD1 ASP A 99 1868 897 2130 -166 -3 -105 O ATOM 1751 OD2 ASP A 99 5.476 35.190 37.670 0.05 12.65 O ANISOU 1751 OD2 ASP A 99 1869 808 2128 -135 56 -52 O ATOM 1752 H ASP A 99 7.778 33.655 35.355 0.05 12.84 H ANISOU 1752 H ASP A 99 1955 792 2131 -139 56 -126 H ATOM 1753 HA ASP A 99 7.249 35.891 34.217 0.05 12.52 H ANISOU 1753 HA ASP A 99 1879 859 2019 -135 -15 -113 H ATOM 1754 HB2 ASP A 99 7.834 35.332 36.920 0.05 12.17 H ANISOU 1754 HB2 ASP A 99 1855 740 2028 -86 38 -49 H ATOM 1755 HB3 ASP A 99 7.339 36.760 36.441 0.05 12.00 H ANISOU 1755 HB3 ASP A 99 1806 773 1978 -84 0 -45 H ATOM 1756 N PHE A 100 9.072 37.468 34.146 0.05 11.97 N ANISOU 1756 N PHE A 100 1833 810 1905 -86 -22 -72 N ATOM 1757 CA PHE A 100 10.154 38.450 34.123 0.05 11.74 C ANISOU 1757 CA PHE A 100 1813 791 1855 -67 -24 -50 C ATOM 1758 C PHE A 100 9.742 39.665 34.960 0.05 11.48 C ANISOU 1758 C PHE A 100 1773 761 1827 -45 -45 -12 C ATOM 1759 O PHE A 100 8.731 40.301 34.681 0.05 11.59 O ANISOU 1759 O PHE A 100 1776 793 1833 -47 -73 -1 O ATOM 1760 CB PHE A 100 10.467 38.889 32.703 0.05 12.00 C ANISOU 1760 CB PHE A 100 1860 860 1838 -90 -32 -61 C ATOM 1761 CG PHE A 100 11.555 39.943 32.639 0.05 11.88 C ANISOU 1761 CG PHE A 100 1855 854 1807 -82 -25 -37 C ATOM 1762 CD1 PHE A 100 12.857 39.595 32.905 0.05 11.86 C ANISOU 1762 CD1 PHE A 100 1845 839 1821 -73 8 -52 C ATOM 1763 CD2 PHE A 100 11.262 41.290 32.374 0.05 11.91 C ANISOU 1763 CD2 PHE A 100 1869 870 1784 -83 -53 1 C ATOM 1764 CE1 PHE A 100 13.874 40.513 32.880 0.05 11.86 C ANISOU 1764 CE1 PHE A 100 1843 849 1814 -76 18 -36 C ATOM 1765 CE2 PHE A 100 12.302 42.233 32.333 0.05 11.91 C ANISOU 1765 CE2 PHE A 100 1880 869 1776 -87 -40 21 C ATOM 1766 CZ PHE A 100 13.571 41.838 32.583 0.05 11.88 C ANISOU 1766 CZ PHE A 100 1863 861 1790 -89 -4 0 C ATOM 1767 H PHE A 100 8.380 37.704 33.714 0.05 12.10 H ANISOU 1767 H PHE A 100 1841 848 1910 -99 -42 -75 H ATOM 1768 HA PHE A 100 10.947 38.067 34.514 0.05 11.68 H ANISOU 1768 HA PHE A 100 1809 765 1862 -54 -4 -54 H ATOM 1769 HB2 PHE A 100 10.789 38.131 32.200 0.05 12.21 H ANISOU 1769 HB2 PHE A 100 1893 886 1860 -103 -13 -92 H ATOM 1770 HB3 PHE A 100 9.668 39.256 32.301 0.05 12.13 H ANISOU 1770 HB3 PHE A 100 1875 896 1837 -99 -59 -54 H ATOM 1771 HD1 PHE A 100 13.065 38.708 33.094 0.05 11.91 H ANISOU 1771 HD1 PHE A 100 1847 831 1849 -66 25 -74 H ATOM 1772 HD2 PHE A 100 10.387 41.535 32.193 0.05 12.00 H ANISOU 1772 HD2 PHE A 100 1880 890 1788 -82 -80 12 H ATOM 1773 HE1 PHE A 100 14.742 40.242 33.047 0.05 11.92 H ANISOU 1773 HE1 PHE A 100 1837 854 1838 -70 39 -50 H ATOM 1774 HE2 PHE A 100 12.099 43.115 32.145 0.05 11.99 H ANISOU 1774 HE2 PHE A 100 1904 879 1774 -89 -57 48 H ATOM 1775 HZ PHE A 100 14.262 42.460 32.569 0.05 11.94 H ANISOU 1775 HZ PHE A 100 1871 870 1796 -97 6 10 H ATOM 1776 N HIS A 101 10.525 39.905 35.995 0.05 11.25 N ANISOU 1776 N HIS A 101 1746 714 1812 -22 -34 2 N ATOM 1777 CA HIS A 101 10.243 41.023 36.924 0.05 11.08 C ANISOU 1777 CA HIS A 101 1724 691 1796 -2 -47 27 C ATOM 1778 C HIS A 101 11.294 42.120 36.780 0.05 11.03 C ANISOU 1778 C HIS A 101 1727 687 1777 0 -54 37 C ATOM 1779 O HIS A 101 12.487 41.851 36.713 0.05 11.04 O ANISOU 1779 O HIS A 101 1727 689 1779 -4 -41 27 O ATOM 1780 CB HIS A 101 10.351 40.585 38.368 0.05 11.00 C ANISOU 1780 CB HIS A 101 1715 662 1801 18 -33 33 C ATOM 1781 CG HIS A 101 9.405 39.506 38.794 0.05 11.14 C ANISOU 1781 CG HIS A 101 1730 668 1836 11 -14 30 C ATOM 1782 ND1 HIS A 101 8.453 39.731 39.750 0.05 11.22 N ANISOU 1782 ND1 HIS A 101 1732 678 1851 18 -4 39 N ATOM 1783 CD2 HIS A 101 9.340 38.172 38.492 0.05 11.33 C ANISOU 1783 CD2 HIS A 101 1758 673 1875 -4 5 17 C ATOM 1784 CE1 HIS A 101 7.794 38.613 39.998 0.05 11.44 C ANISOU 1784 CE1 HIS A 101 1759 693 1897 0 21 37 C ATOM 1785 NE2 HIS A 101 8.324 37.657 39.249 0.05 11.51 N ANISOU 1785 NE2 HIS A 101 1777 684 1913 -13 24 25 N ATOM 1786 H HIS A 101 11.252 39.522 36.162 0.05 11.23 H ANISOU 1786 H HIS A 101 1748 704 1817 -16 -21 -3 H ATOM 1787 HA HIS A 101 9.363 41.373 36.764 0.05 11.16 H ANISOU 1787 HA HIS A 101 1726 707 1806 -3 -60 31 H ATOM 1788 HB2 HIS A 101 11.253 40.279 38.532 0.05 10.98 H ANISOU 1788 HB2 HIS A 101 1719 654 1801 24 -28 30 H ATOM 1789 HB3 HIS A 101 10.154 41.330 38.956 0.05 10.95 H ANISOU 1789 HB3 HIS A 101 1711 656 1793 30 -39 41 H ATOM 1790 HD2 HIS A 101 9.872 37.722 37.887 0.05 11.39 H ANISOU 1790 HD2 HIS A 101 1770 674 1883 -9 8 4 H ATOM 1791 HE1 HIS A 101 7.087 38.527 40.586 0.05 11.59 H ANISOU 1791 HE1 HIS A 101 1770 713 1922 -4 37 41 H ATOM 1792 N PHE A 102 10.824 43.385 36.799 0.05 11.07 N ANISOU 1792 N PHE A 102 1738 689 1780 5 -74 55 N ATOM 1793 CA PHE A 102 11.724 44.543 36.839 0.05 11.12 C ANISOU 1793 CA PHE A 102 1759 684 1784 0 -77 65 C ATOM 1794 C PHE A 102 10.997 45.647 37.548 0.05 11.19 C ANISOU 1794 C PHE A 102 1773 671 1807 21 -92 75 C ATOM 1795 O PHE A 102 9.807 45.711 37.559 0.05 11.27 O ANISOU 1795 O PHE A 102 1775 682 1826 39 -103 79 O ATOM 1796 CB PHE A 102 12.204 44.949 35.444 0.05 11.37 C ANISOU 1796 CB PHE A 102 1805 726 1788 -29 -76 77 C ATOM 1797 CG PHE A 102 11.142 45.475 34.552 0.05 11.63 C ANISOU 1797 CG PHE A 102 1853 763 1802 -28 -103 102 C ATOM 1798 CD1 PHE A 102 10.308 44.658 33.800 0.05 11.74 C ANISOU 1798 CD1 PHE A 102 1858 803 1797 -31 -115 94 C ATOM 1799 CD2 PHE A 102 11.014 46.873 34.372 0.05 11.91 C ANISOU 1799 CD2 PHE A 102 1914 773 1837 -24 -120 135 C ATOM 1800 CE1 PHE A 102 9.358 45.197 32.964 0.05 12.11 C ANISOU 1800 CE1 PHE A 102 1914 862 1823 -27 -152 118 C ATOM 1801 CE2 PHE A 102 10.071 47.392 33.541 0.05 12.28 C ANISOU 1801 CE2 PHE A 102 1977 823 1867 -14 -154 166 C ATOM 1802 CZ PHE A 102 9.244 46.578 32.837 0.05 12.39 C ANISOU 1802 CZ PHE A 102 1975 874 1859 -13 -174 158 C ATOM 1803 H PHE A 102 10.003 43.597 36.838 0.05 11.13 H ANISOU 1803 H PHE A 102 1741 696 1791 13 -84 60 H ATOM 1804 HA PHE A 102 12.496 44.327 37.370 0.05 11.05 H ANISOU 1804 HA PHE A 102 1744 675 1781 1 -68 55 H ATOM 1805 HB2 PHE A 102 12.874 45.638 35.567 0.05 11.45 H ANISOU 1805 HB2 PHE A 102 1822 724 1802 -38 -73 83 H ATOM 1806 HB3 PHE A 102 12.629 44.203 34.999 0.05 11.39 H ANISOU 1806 HB3 PHE A 102 1802 744 1781 -41 -61 64 H ATOM 1807 HD1 PHE A 102 10.387 43.738 33.899 0.05 11.62 H ANISOU 1807 HD1 PHE A 102 1831 796 1787 -36 -101 71 H ATOM 1808 HD2 PHE A 102 11.566 47.423 34.861 0.05 11.90 H ANISOU 1808 HD2 PHE A 102 1919 750 1850 -28 -112 135 H ATOM 1809 HE1 PHE A 102 8.793 44.645 32.476 0.05 12.24 H ANISOU 1809 HE1 PHE A 102 1921 902 1828 -32 -165 107 H ATOM 1810 HE2 PHE A 102 9.989 48.313 33.467 0.05 12.53 H ANISOU 1810 HE2 PHE A 102 2029 829 1904 -6 -166 192 H ATOM 1811 HZ PHE A 102 8.600 46.946 32.274 0.05 12.72 H ANISOU 1811 HZ PHE A 102 2024 923 1887 -4 -205 180 H ATOM 1812 N TYR A 103 11.797 46.544 38.141 0.05 11.25 N ANISOU 1812 N TYR A 103 1792 659 1822 18 -92 71 N ATOM 1813 CA TYR A 103 11.287 47.788 38.726 0.05 11.45 C ANISOU 1813 CA TYR A 103 1833 652 1866 35 -102 73 C ATOM 1814 C TYR A 103 11.688 48.944 37.835 0.05 11.78 C ANISOU 1814 C TYR A 103 1902 664 1910 15 -111 97 C ATOM 1815 O TYR A 103 12.819 49.035 37.472 0.05 11.85 O ANISOU 1815 O TYR A 103 1915 676 1911 -20 -100 98 O ATOM 1816 CB TYR A 103 11.820 47.966 40.148 0.05 11.44 C ANISOU 1816 CB TYR A 103 1833 645 1869 41 -97 44 C ATOM 1817 CG TYR A 103 10.847 48.806 41.006 0.05 11.66 C ANISOU 1817 CG TYR A 103 1871 648 1912 71 -96 29 C ATOM 1818 CD1 TYR A 103 9.883 48.234 41.779 0.05 11.63 C ANISOU 1818 CD1 TYR A 103 1854 661 1905 97 -82 18 C ATOM 1819 CD2 TYR A 103 10.862 50.211 40.959 0.05 12.03 C ANISOU 1819 CD2 TYR A 103 1942 647 1982 72 -104 26 C ATOM 1820 CE1 TYR A 103 8.924 48.970 42.494 0.05 11.94 C ANISOU 1820 CE1 TYR A 103 1895 682 1961 127 -71 -1 C ATOM 1821 CE2 TYR A 103 9.937 50.933 41.669 0.05 12.34 C ANISOU 1821 CE2 TYR A 103 1988 659 2042 107 -98 6 C ATOM 1822 CZ TYR A 103 8.966 50.347 42.395 0.05 12.30 C ANISOU 1822 CZ TYR A 103 1961 680 2032 136 -81 -10 C ATOM 1823 OH TYR A 103 8.066 51.177 43.040 0.05 12.74 O ANISOU 1823 OH TYR A 103 2019 707 2113 172 -68 -36 O ATOM 1824 H TYR A 103 12.632 46.458 38.213 0.05 11.23 H ANISOU 1824 H TYR A 103 1788 661 1819 5 -86 64 H ATOM 1825 HA TYR A 103 10.325 47.750 38.742 0.05 11.49 H ANISOU 1825 HA TYR A 103 1831 657 1877 56 -107 76 H ATOM 1826 HB2 TYR A 103 11.896 47.106 40.583 0.05 11.28 H ANISOU 1826 HB2 TYR A 103 1802 646 1839 46 -91 37 H ATOM 1827 HB3 TYR A 103 12.679 48.407 40.113 0.05 11.54 H ANISOU 1827 HB3 TYR A 103 1852 650 1884 21 -99 39 H ATOM 1828 HD1 TYR A 103 9.845 47.300 41.802 0.05 11.45 H ANISOU 1828 HD1 TYR A 103 1819 661 1871 93 -75 23 H ATOM 1829 HD2 TYR A 103 11.492 50.635 40.434 0.05 12.13 H ANISOU 1829 HD2 TYR A 103 1966 645 1998 49 -109 36 H ATOM 1830 HE1 TYR A 103 8.277 48.549 43.001 0.05 11.98 H ANISOU 1830 HE1 TYR A 103 1887 702 1963 140 -54 -10 H ATOM 1831 HE2 TYR A 103 9.950 51.855 41.612 0.05 12.64 H ANISOU 1831 HE2 TYR A 103 2046 658 2101 109 -102 3 H ATOM 1832 HH TYR A 103 7.288 50.875 42.938 0.05 12.78 H ANISOU 1832 HH TYR A 103 2003 722 2131 192 -65 -28 H ATOM 1833 N THR A 104 10.708 49.741 37.463 0.05 12.08 N ANISOU 1833 N THR A 104 1953 675 1960 40 -129 119 N ATOM 1834 CA THR A 104 11.000 50.972 36.706 0.05 12.56 C ANISOU 1834 CA THR A 104 2053 691 2026 26 -139 154 C ATOM 1835 C THR A 104 10.832 52.207 37.598 0.05 12.88 C ANISOU 1835 C THR A 104 2114 671 2108 45 -140 139 C ATOM 1836 O THR A 104 9.939 52.297 38.406 0.05 12.89 O ANISOU 1836 O THR A 104 2101 665 2133 87 -142 116 O ATOM 1837 CB THR A 104 10.150 51.098 35.440 0.05 12.90 C ANISOU 1837 CB THR A 104 2108 738