>>4QLC:HELIX   16  16 SER D   52  ASN D   81  1                                  30    
SSKAMSIMNSFVNDIFERIAAEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 16 SER D 52 ASN D 81 1 30 ATOM 9229 N SER D 52 7.295 102.572 58.376 1.00 74.49 N ATOM 9230 CA SER D 52 7.800 102.299 57.040 1.00 85.38 C ATOM 9231 C SER D 52 9.112 101.532 57.124 1.00110.05 C ATOM 9232 O SER D 52 9.821 101.610 58.127 1.00109.20 O ATOM 9233 CB SER D 52 7.991 103.603 56.261 1.00 96.06 C ATOM 9234 OG SER D 52 8.782 103.400 55.103 1.00107.43 O ATOM 9235 N SER D 53 9.414 100.778 56.072 1.00128.33 N ATOM 9236 CA SER D 53 10.606 99.936 56.035 1.00109.10 C ATOM 9237 C SER D 53 11.873 100.754 56.254 1.00114.03 C ATOM 9238 O SER D 53 12.784 100.322 56.961 1.00105.97 O ATOM 9239 CB SER D 53 10.687 99.183 54.707 1.00100.71 C ATOM 9240 OG SER D 53 9.600 98.285 54.567 1.00118.85 O ATOM 9241 N LYS D 54 11.924 101.936 55.645 1.00123.95 N ATOM 9242 CA LYS D 54 13.070 102.822 55.801 1.00116.06 C ATOM 9243 C LYS D 54 13.187 103.277 57.251 1.00 96.70 C ATOM 9244 O LYS D 54 14.287 103.381 57.792 1.00101.15 O ATOM 9245 CB LYS D 54 12.938 104.030 54.871 1.00124.41 C ATOM 9246 CG LYS D 54 14.201 104.384 54.102 1.00150.77 C ATOM 9247 CD LYS D 54 15.272 104.957 55.015 1.00129.87 C ATOM 9248 CE LYS D 54 16.392 105.594 54.209 1.00129.17 C ATOM 9249 NZ LYS D 54 15.873 106.618 53.258 1.00120.76 N ATOM 9250 N ALA D 55 12.044 103.542 57.873 1.00 83.47 N ATOM 9251 CA ALA D 55 12.004 103.956 59.270 1.00 76.17 C ATOM 9252 C ALA D 55 12.394 102.776 60.160 1.00 76.93 C ATOM 9253 O ALA D 55 13.070 102.944 61.176 1.00 65.01 O ATOM 9254 CB ALA D 55 10.635 104.490 59.633 1.00 79.48 C ATOM 9255 N MET D 56 11.949 101.585 59.767 1.00 88.29 N ATOM 9256 CA MET D 56 12.277 100.346 60.470 1.00 78.47 C ATOM 9257 C MET D 56 13.765 100.047 60.384 1.00 83.55 C ATOM 9258 O MET D 56 14.370 99.571 61.346 1.00 85.22 O ATOM 9259 CB MET D 56 11.478 99.168 59.906 1.00 53.39 C ATOM 9260 CG MET D 56 11.852 97.827 60.526 1.00 78.67 C ATOM 9261 SD MET D 56 11.590 97.681 62.306 1.00121.93 S ATOM 9262 CE MET D 56 9.807 97.620 62.399 1.00 91.01 C ATOM 9263 N SER D 57 14.344 100.327 59.222 1.00 79.49 N ATOM 9264 CA SER D 57 15.775 100.165 59.017 1.00 87.60 C ATOM 9265 C SER D 57 16.536 101.040 60.001 1.00 78.36 C ATOM 9266 O SER D 57 17.446 100.575 60.688 1.00 75.24 O ATOM 9267 CB SER D 57 16.162 100.518 57.580 1.00100.70 C ATOM 9268 OG SER D 57 17.569 100.479 57.408 1.00115.19 O ATOM 9269 N ILE D 58 16.168 102.316 60.040 1.00 74.70 N ATOM 9270 CA ILE D 58 16.746 103.265 60.982 1.00 75.59 C ATOM 9271 C ILE D 58 16.647 102.755 62.423 1.00 76.37 C ATOM 9272 O ILE D 58 17.603 102.858 63.194 1.00 78.74 O ATOM 9273 CB ILE D 58 16.028 104.623 60.865 1.00 52.93 C ATOM 9274 CG1 ILE D 58 16.290 105.240 59.489 1.00 65.93 C ATOM 9275 CG2 ILE D 58 16.411 105.544 62.016 1.00 51.08 C ATOM 9276 CD1 ILE D 58 15.492 106.485 59.215 1.00 80.57 C ATOM 9277 N MET D 59 15.491 102.199 62.780 1.00 71.92 N ATOM 9278 CA MET D 59 15.296 101.614 64.106 1.00 64.41 C ATOM 9279 C MET D 59 16.185 100.394 64.336 1.00 79.06 C ATOM 9280 O MET D 59 16.713 100.196 65.432 1.00 73.59 O ATOM 9281 CB MET D 59 13.829 101.237 64.322 1.00 69.05 C ATOM 9282 CG MET D 59 12.929 102.419 64.632 1.00 77.67 C ATOM 9283 SD MET D 59 13.471 103.314 66.107 1.00 73.88 S ATOM 9284 CE MET D 59 13.312 102.045 67.362 1.00 51.73 C ATOM 9285 N ASN D 60 16.343 99.578 63.297 1.00 66.87 N ATOM 9286 CA ASN D 60 17.183 98.391 63.384 1.00 72.70 C ATOM 9287 C ASN D 60 18.648 98.767 63.537 1.00 84.55 C ATOM 9288 O ASN D 60 19.393 98.125 64.276 1.00 85.13 O ATOM 9289 CB ASN D 60 16.994 97.504 62.153 1.00 92.76 C ATOM 9290 CG ASN D 60 17.651 96.143 62.307 1.00108.08 C ATOM 9291 OD1 ASN D 60 17.326 95.385 63.222 1.00107.78 O ATOM 9292 ND2 ASN D 60 18.582 95.828 61.413 1.00 75.16 N ATOM 9293 N SER D 61 19.069 99.791 62.806 1.00 73.32 N ATOM 9294 CA SER D 61 20.437 100.263 62.914 1.00 70.17 C ATOM 9295 C SER D 61 20.695 100.821 64.310 1.00 80.51 C ATOM 9296 O SER D 61 21.774 100.639 64.870 1.00 83.69 O ATOM 9297 CB SER D 61 20.725 101.329 61.854 1.00 89.53 C ATOM 9298 OG SER D 61 20.563 100.807 60.547 1.00 95.14 O ATOM 9299 N PHE D 62 19.693 101.501 64.864 1.00 88.69 N ATOM 9300 CA PHE D 62 19.810 102.092 66.194 1.00 77.12 C ATOM 9301 C PHE D 62 19.987 101.068 67.317 1.00 76.76 C ATOM 9302 O PHE D 62 20.851 101.236 68.178 1.00 78.12 O ATOM 9303 CB PHE D 62 18.571 102.954 66.466 1.00 76.68 C ATOM 9304 CG PHE D 62 18.422 103.384 67.899 1.00 87.03 C ATOM 9305 CD1 PHE D 62 19.188 104.420 68.407 1.00 77.45 C ATOM 9306 CD2 PHE D 62 17.506 102.762 68.732 1.00 80.30 C ATOM 9307 CE1 PHE D 62 19.049 104.824 69.721 1.00 72.84 C ATOM 9308 CE2 PHE D 62 17.363 103.160 70.049 1.00 72.89 C ATOM 9309 CZ PHE D 62 18.135 104.192 70.544 1.00 69.42 C ATOM 9310 N VAL D 63 19.175 100.012 67.308 1.00 82.10 N ATOM 9311 CA VAL D 63 19.266 98.971 68.335 1.00 87.79 C ATOM 9312 C VAL D 63 20.611 98.248 68.254 1.00 77.98 C ATOM 9313 O VAL D 63 21.263 98.005 69.269 1.00 70.01 O ATOM 9314 CB VAL D 63 18.093 97.956 68.256 1.00 90.57 C ATOM 9315 CG1 VAL D 63 16.809 98.594 68.769 1.00 78.63 C ATOM 9316 CG2 VAL D 63 17.898 97.432 66.849 1.00 91.73 C ATOM 9317 N ASN D 64 21.006 97.907 67.029 1.00 89.29 N ATOM 9318 CA ASN D 64 22.279 97.253 66.746 1.00 96.71 C ATOM 9319 C ASN D 64 23.449 98.132 67.170 1.00 81.37 C ATOM 9320 O ASN D 64 24.464 97.644 67.665 1.00 83.59 O ATOM 9321 CB ASN D 64 22.381 96.904 65.261 1.00103.44 C ATOM 9322 CG ASN D 64 22.874 95.488 65.029 1.00128.89 C ATOM 9323 OD1 ASN D 64 23.830 95.038 65.662 1.00138.07 O ATOM 9324 ND2 ASN D 64 22.217 94.773 64.122 1.00113.26 N ATOM 9325 N ASP D 65 23.292 99.433 66.960 1.00 84.55 N ATOM 9326 CA ASP D 65 24.298 100.412 67.343 1.00 90.45 C ATOM 9327 C ASP D 65 24.447 100.376 68.859 1.00 90.26 C ATOM 9328 O ASP D 65 25.531 100.098 69.373 1.00 88.61 O ATOM 9329 CB ASP D 65 23.921 101.816 66.865 1.00 88.01 C ATOM 9330 CG ASP D 65 25.040 102.823 67.070 1.00 90.32 C ATOM 9331 OD1 ASP D 65 26.168 102.404 67.404 1.00100.65 O ATOM 9332 OD2 ASP D 65 24.793 104.035 66.896 1.00 90.93 O ATOM 9333 N ILE D 66 23.351 100.651 69.562 1.00 86.40 N ATOM 9334 CA ILE D 66 23.326 100.652 71.024 1.00 75.72 C ATOM 9335 C ILE D 66 23.899 99.358 71.600 1.00 71.84 C ATOM 9336 O ILE D 66 24.635 99.391 72.588 1.00 75.77 O ATOM 9337 CB ILE D 66 21.887 100.854 71.548 1.00 68.58 C ATOM 9338 CG1 ILE D 66 21.409 102.275 71.248 1.00 84.62 C ATOM 9339 CG2 ILE D 66 21.805 100.583 73.040 1.00 67.90 C ATOM 9340 CD1 ILE D 66 22.241 103.350 71.914 1.00 74.93 C ATOM 9341 N PHE D 67 23.567 98.226 70.985 1.00 77.54 N ATOM 9342 CA PHE D 67 24.120 96.943 71.411 1.00 84.22 C ATOM 9343 C PHE D 67 25.645 96.995 71.409 1.00 83.23 C ATOM 9344 O PHE D 67 26.294 96.686 72.411 1.00 60.61 O ATOM 9345 CB PHE D 67 23.641 95.810 70.500 1.00 89.28 C ATOM 9346 CG PHE D 67 24.177 94.460 70.886 1.00100.18 C ATOM 9347 CD1 PHE D 67 23.598 93.733 71.914 1.00105.92 C ATOM 9348 CD2 PHE D 67 25.279 93.927 70.233 1.00 93.62 C ATOM 9349 CE1 PHE D 67 24.099 92.494 72.272 1.00 87.10 C ATOM 9350 CE2 PHE D 67 25.784 92.693 70.590 1.00103.42 C ATOM 9351 CZ PHE D 67 25.194 91.977 71.613 1.00100.11 C ATOM 9352 N GLU D 68 26.200 97.387 70.266 1.00 90.97 N ATOM 9353 CA GLU D 68 27.643 97.445 70.064 1.00 83.72 C ATOM 9354 C GLU D 68 28.316 98.447 71.001 1.00 69.67 C ATOM 9355 O GLU D 68 29.407 98.198 71.513 1.00 64.37 O ATOM 9356 CB GLU D 68 27.950 97.808 68.609 1.00 87.78 C ATOM 9357 CG GLU D 68 27.567 96.734 67.602 1.00 92.09 C ATOM 9358 CD GLU D 68 27.760 97.188 66.166 1.00107.87 C ATOM 9359 OE1 GLU D 68 28.003 98.395 65.949 1.00 94.90 O ATOM 9360 OE2 GLU D 68 27.664 96.340 65.254 1.00 93.99 O ATOM 9361 N ARG D 69 27.657 99.583 71.208 1.00 72.59 N ATOM 9362 CA ARG D 69 28.143 100.623 72.110 1.00 72.62 C ATOM 9363 C ARG D 69 28.285 100.131 73.551 1.00 79.27 C ATOM 9364 O ARG D 69 29.339 100.286 74.170 1.00 92.31 O ATOM 9365 CB ARG D 69 27.195 101.825 72.051 1.00 83.44 C ATOM 9366 CG ARG D 69 27.106 102.456 70.666 1.00 82.51 C ATOM 9367 CD ARG D 69 26.414 103.811 70.671 1.00 89.35 C ATOM 9368 NE ARG D 69 26.638 104.566 71.899 1.00123.64 N ATOM 9369 CZ ARG D 69 26.153 105.784 72.118 1.00119.92 C ATOM 9370 NH1 ARG D 69 25.414 106.381 71.191 1.00 78.00 N ATOM 9371 NH2 ARG D 69 26.404 106.405 73.263 1.00116.19 N ATOM 9372 N ILE D 70 27.214 99.544 74.074 1.00 74.60 N ATOM 9373 CA ILE D 70 27.161 99.056 75.454 1.00 84.65 C ATOM 9374 C ILE D 70 28.141 97.911 75.723 1.00 85.40 C ATOM 9375 O ILE D 70 28.865 97.913 76.720 1.00 89.23 O ATOM 9376 CB ILE D 70 25.740 98.609 75.840 1.00 82.14 C ATOM 9377 CG1 ILE D 70 24.804 99.819 75.884 1.00 79.35 C ATOM 9378 CG2 ILE D 70 25.752 97.913 77.192 1.00 67.06 C ATOM 9379 CD1 ILE D 70 23.354 99.471 76.145 1.00 58.60 C ATOM 9380 N ALA D 71 28.172 96.954 74.803 1.00 79.18 N ATOM 9381 CA ALA D 71 29.034 95.780 74.906 1.00 83.48 C ATOM 9382 C ALA D 71 30.520 96.124 74.859 1.00 78.80 C ATOM 9383 O ALA D 71 31.314 95.526 75.585 1.00 87.71 O ATOM 9384 CB ALA D 71 28.692 94.788 73.806 1.00 95.20 C ATOM 9385 N ALA D 72 30.899 97.070 74.006 1.00 73.45 N ATOM 9386 CA ALA D 72 32.296 97.477 73.906 1.00 74.90 C ATOM 9387 C ALA D 72 32.774 98.018 75.251 1.00 83.38 C ATOM 9388 O ALA D 72 33.852 97.657 75.722 1.00 86.21 O ATOM 9389 CB ALA D 72 32.477 98.518 72.815 1.00 87.92 C ATOM 9390 N GLU D 73 31.977 98.888 75.863 1.00103.16 N ATOM 9391 CA GLU D 73 32.326 99.459 77.162 1.00101.68 C ATOM 9392 C GLU D 73 32.378 98.409 78.265 1.00 87.58 C ATOM 9393 O GLU D 73 33.302 98.408 79.078 1.00 91.56 O ATOM 9394 CB GLU D 73 31.351 100.567 77.557 1.00103.32 C ATOM 9395 CG GLU D 73 31.794 101.328 78.800 1.00 80.37 C ATOM 9396 CD GLU D 73 33.073 102.113 78.587 1.00 96.24 C ATOM 9397 OE1 GLU D 73 33.319 102.563 77.448 1.00125.89 O ATOM 9398 OE2 GLU D 73 33.839 102.267 79.561 1.00 74.23 O ATOM 9399 N ALA D 74 31.385 97.524 78.298 1.00 77.89 N ATOM 9400 CA ALA D 74 31.374 96.449 79.282 1.00 87.55 C ATOM 9401 C ALA D 74 32.615 95.582 79.109 1.00100.84 C ATOM 9402 O ALA D 74 33.204 95.123 80.088 1.00102.09 O ATOM 9403 CB ALA D 74 30.112 95.613 79.150 1.00 71.56 C ATOM 9404 N SER D 75 33.013 95.381 77.856 1.00 98.72 N ATOM 9405 CA SER D 75 34.217 94.624 77.541 1.00101.35 C ATOM 9406 C SER D 75 35.424 95.314 78.172 1.00 94.73 C ATOM 9407 O SER D 75 36.252 94.675 78.823 1.00 81.56 O ATOM 9408 CB SER D 75 34.396 94.490 76.028 1.00 78.73 C ATOM 9409 OG SER D 75 35.594 93.804 75.711 1.00103.40 O ATOM 9410 N ARG D 76 35.514 96.625 77.963 1.00 90.72 N ATOM 9411 CA ARG D 76 36.593 97.427 78.524 1.00 79.37 C ATOM 9412 C ARG D 76 36.551 97.440 80.048 1.00 92.28 C ATOM 9413 O ARG D 76 37.593 97.400 80.703 1.00108.20 O ATOM 9414 CB ARG D 76 36.522 98.862 77.998 1.00 92.65 C ATOM 9415 CG ARG D 76 37.349 99.121 76.752 1.00 89.80 C ATOM 9416 CD ARG D 76 36.888 100.392 76.055 1.00 92.84 C ATOM 9417 NE ARG D 76 37.388 100.483 74.686 1.00129.28 N ATOM 9418 CZ ARG D 76 36.734 101.073 73.691 1.00131.19 C ATOM 9419 NH1 ARG D 76 35.546 101.621 73.908 1.00112.08 N ATOM 9420 NH2 ARG D 76 37.266 101.112 72.476 1.00121.79 N ATOM 9421 N LEU D 77 35.344 97.510 80.607 1.00 90.30 N ATOM 9422 CA LEU D 77 35.169 97.512 82.057 1.00 96.01 C ATOM 9423 C LEU D 77 35.716 96.232 82.673 1.00110.59 C ATOM 9424 O LEU D 77 36.437 96.269 83.669 1.00116.01 O ATOM 9425 CB LEU D 77 33.695 97.684 82.425 1.00 78.95 C ATOM 9426 CG LEU D 77 33.128 99.099 82.306 1.00 88.77 C ATOM 9427 CD1 LEU D 77 31.614 99.080 82.425 1.00 93.34 C ATOM 9428 CD2 LEU D 77 33.740 100.006 83.360 1.00 98.26 C ATOM 9429 N ALA D 78 35.364 95.104 82.064 1.00 98.95 N ATOM 9430 CA ALA D 78 35.832 93.795 82.501 1.00 97.82 C ATOM 9431 C ALA D 78 37.348 93.705 82.390 1.00 90.14 C ATOM 9432 O ALA D 78 38.010 93.051 83.194 1.00110.35 O ATOM 9433 CB ALA D 78 35.172 92.695 81.689 1.00106.27 C ATOM 9434 N HIS D 79 37.887 94.347 81.363 1.00 89.87 N ATOM 9435 CA HIS D 79 39.323 94.353 81.129 1.00108.74 C ATOM 9436 C HIS D 79 40.091 95.188 82.156 1.00102.57 C ATOM 9437 O HIS D 79 41.079 94.720 82.723 1.00 98.84 O ATOM 9438 CB HIS D 79 39.624 94.864 79.719 1.00110.49 C ATOM 9439 CG HIS D 79 41.084 94.924 79.400 1.00119.18 C ATOM 9440 ND1 HIS D 79 41.828 93.801 79.109 1.00107.23 N ATOM 9441 CD2 HIS D 79 41.941 95.971 79.329 1.00128.32 C ATOM 9442 CE1 HIS D 79 43.078 94.153 78.871 1.00127.82 C ATOM 9443 NE2 HIS D 79 43.174 95.464 78.998 1.00135.67 N ATOM 9444 N TYR D 80 39.646 96.423 82.380 1.00 98.89 N ATOM 9445 CA TYR D 80 40.313 97.323 83.322 1.00112.85 C ATOM 9446 C TYR D 80 40.471 96.750 84.733 1.00102.26 C ATOM 9447 O TYR D 80 41.447 97.046 85.423 1.00 93.48 O ATOM 9448 CB TYR D 80 39.539 98.641 83.427 1.00111.59 C ATOM 9449 CG TYR D 80 39.531 99.484 82.171 1.00115.84 C ATOM 9450 CD1 TYR D 80 40.573 99.424 81.255 1.00111.22 C ATOM 9451 CD2 TYR D 80 38.482 100.361 81.915 1.00 97.51 C ATOM 9452 CE1 TYR D 80 40.560 100.200 80.108 1.00118.61 C ATOM 9453 CE2 TYR D 80 38.462 101.142 80.778 1.00 81.20 C ATOM 9454 CZ TYR D 80 39.503 101.061 79.879 1.00109.20 C ATOM 9455 OH TYR D 80 39.482 101.839 78.743 1.00 92.08 O ATOM 9456 N ASN D 81 39.514 95.931 85.156 1.00102.41 N ATOM 9457 CA ASN D 81 39.541 95.343 86.494 1.00118.95 C ATOM 9458 C ASN D 81 39.984 93.876 86.477 1.00117.57 C ATOM 9459 O ASN D 81 39.719 93.134 87.424 1.00 84.22 O ATOM 9460 CB ASN D 81 38.184 95.503 87.194 1.00101.10 C ATOM 9461 CG ASN D 81 37.077 94.717 86.531 1.00134.81 C ATOM 9462 OD1 ASN D 81 37.207 94.280 85.393 1.00138.31 O ATOM 9463 ND2 ASN D 81 35.969 94.543 87.242 1.00150.19 N