>>4V1M:HELIX  133 133 ASP K   82  GLN K  112  1                                  31    
DPKDALKNACNSIINKLGALKTNFETEWNLQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 133 133 ASP K 82 GLN K 112 1 31 ATOM 28083 N ASP K 82 143.063 216.587 147.659 1.00105.94 N ATOM 28084 CA ASP K 82 143.061 215.609 148.725 1.00102.89 C ATOM 28085 C ASP K 82 144.253 214.683 148.591 1.00102.55 C ATOM 28086 O ASP K 82 144.515 214.165 147.508 1.00101.91 O ATOM 28087 CB ASP K 82 141.755 214.814 148.735 1.00104.86 C ATOM 28088 CG ASP K 82 141.612 213.959 149.963 1.00106.36 C ATOM 28089 OD1 ASP K 82 142.182 212.868 149.984 1.00102.73 O ATOM 28090 OD2 ASP K 82 140.999 214.423 150.933 1.00114.66 O1- ATOM 28091 N PRO K 83 144.970 214.423 149.690 1.00 96.71 N ATOM 28092 CA PRO K 83 146.121 213.512 149.607 1.00 94.64 C ATOM 28093 C PRO K 83 145.742 212.069 149.226 1.00 98.00 C ATOM 28094 O PRO K 83 146.531 211.394 148.556 1.00 97.69 O ATOM 28095 CB PRO K 83 146.759 213.617 151.002 1.00 94.99 C ATOM 28096 CG PRO K 83 146.210 214.872 151.587 1.00100.81 C ATOM 28097 CD PRO K 83 144.818 214.958 151.054 1.00 98.12 C ATOM 28098 N LYS K 84 144.535 211.596 149.615 1.00 93.31 N ATOM 28099 CA LYS K 84 144.092 210.245 149.261 1.00 91.69 C ATOM 28100 C LYS K 84 143.985 210.167 147.743 1.00 94.88 C ATOM 28101 O LYS K 84 144.497 209.215 147.162 1.00 92.93 O ATOM 28102 CB LYS K 84 142.773 209.860 149.965 1.00 94.74 C ATOM 28103 CG LYS K 84 142.891 209.613 151.484 1.00100.17 C ATOM 28104 CD LYS K 84 141.526 209.536 152.204 1.00108.64 C ATOM 28105 CE LYS K 84 140.761 208.254 151.911 1.00121.96 C ATOM 28106 NZ LYS K 84 139.449 208.176 152.608 1.00132.59 N1+ ATOM 28107 N ASP K 85 143.430 211.230 147.104 1.00 93.73 N ATOM 28108 CA ASP K 85 143.308 211.385 145.644 1.00 94.98 C ATOM 28109 C ASP K 85 144.682 211.445 144.989 1.00 97.55 C ATOM 28110 O ASP K 85 144.869 210.870 143.919 1.00 97.18 O ATOM 28111 CB ASP K 85 142.537 212.665 145.276 1.00 99.26 C ATOM 28112 CG ASP K 85 141.062 212.689 145.622 1.00118.03 C ATOM 28113 OD1 ASP K 85 140.449 211.595 145.707 1.00119.10 O ATOM 28114 OD2 ASP K 85 140.503 213.804 145.751 1.00129.10 O1- ATOM 28115 N ALA K 86 145.640 212.145 145.626 1.00 93.36 N ATOM 28116 CA ALA K 86 147.010 212.261 145.140 1.00 92.57 C ATOM 28117 C ALA K 86 147.623 210.867 145.035 1.00 96.26 C ATOM 28118 O ALA K 86 148.145 210.496 143.976 1.00 96.83 O ATOM 28119 CB ALA K 86 147.822 213.131 146.082 1.00 92.44 C ATOM 28120 N LEU K 87 147.476 210.075 146.116 1.00 91.41 N ATOM 28121 CA LEU K 87 147.941 208.703 146.202 1.00 89.72 C ATOM 28122 C LEU K 87 147.249 207.879 145.143 1.00 92.94 C ATOM 28123 O LEU K 87 147.929 207.110 144.474 1.00 92.18 O ATOM 28124 CB LEU K 87 147.689 208.125 147.613 1.00 88.97 C ATOM 28125 CG LEU K 87 147.875 206.604 147.827 1.00 92.80 C ATOM 28126 CD1 LEU K 87 149.301 206.154 147.543 1.00 91.85 C ATOM 28127 CD2 LEU K 87 147.524 206.219 149.239 1.00 94.54 C ATOM 28128 N LYS K 88 145.919 208.068 144.963 1.00 90.29 N ATOM 28129 CA LYS K 88 145.110 207.355 143.965 1.00 91.09 C ATOM 28130 C LYS K 88 145.647 207.558 142.566 1.00 96.40 C ATOM 28131 O LYS K 88 145.800 206.580 141.841 1.00 95.71 O ATOM 28132 CB LYS K 88 143.614 207.733 144.025 1.00 95.05 C ATOM 28133 CG LYS K 88 142.779 206.880 144.979 1.00110.58 C ATOM 28134 CD LYS K 88 141.304 206.750 144.556 1.00124.57 C ATOM 28135 CE LYS K 88 140.590 205.626 145.290 1.00134.12 C ATOM 28136 NZ LYS K 88 139.333 205.198 144.609 1.00138.05 N1+ ATOM 28137 N ASN K 89 145.984 208.817 142.206 1.00 95.22 N ATOM 28138 CA ASN K 89 146.505 209.180 140.883 1.00 96.73 C ATOM 28139 C ASN K 89 147.889 208.641 140.618 1.00100.62 C ATOM 28140 O ASN K 89 148.126 208.103 139.533 1.00101.25 O ATOM 28141 CB ASN K 89 146.443 210.678 140.646 1.00 99.19 C ATOM 28142 CG ASN K 89 145.038 211.204 140.671 1.00135.66 C ATOM 28143 OD1 ASN K 89 144.136 210.704 139.978 1.00135.61 O ATOM 28144 ND2 ASN K 89 144.816 212.209 141.500 1.00131.30 N ATOM 28145 N ALA K 90 148.795 208.763 141.602 1.00 96.25 N ATOM 28146 CA ALA K 90 150.154 208.239 141.481 1.00 95.67 C ATOM 28147 C ALA K 90 150.114 206.707 141.279 1.00 99.25 C ATOM 28148 O ALA K 90 150.829 206.185 140.421 1.00 99.39 O ATOM 28149 CB ALA K 90 150.973 208.609 142.710 1.00 95.05 C ATOM 28150 N CYS K 91 149.221 206.013 142.015 1.00 95.11 N ATOM 28151 CA CYS K 91 148.995 204.574 141.927 1.00 94.95 C ATOM 28152 C CYS K 91 148.612 204.218 140.507 1.00 99.39 C ATOM 28153 O CYS K 91 149.171 203.278 139.946 1.00 99.35 O ATOM 28154 CB CYS K 91 147.895 204.153 142.894 1.00 95.86 C ATOM 28155 SG CYS K 91 148.471 203.684 144.540 1.00 98.09 S ATOM 28156 N ASN K 92 147.651 204.982 139.931 1.00 96.02 N ATOM 28157 CA ASN K 92 147.128 204.820 138.575 1.00 96.73 C ATOM 28158 C ASN K 92 148.199 205.044 137.527 1.00100.95 C ATOM 28159 O ASN K 92 148.432 204.154 136.709 1.00101.01 O ATOM 28160 CB ASN K 92 145.931 205.728 138.348 1.00 96.33 C ATOM 28161 CG ASN K 92 144.622 205.089 138.734 1.00115.83 C ATOM 28162 OD1 ASN K 92 144.309 203.952 138.351 1.00108.55 O ATOM 28163 ND2 ASN K 92 143.799 205.830 139.456 1.00108.17 N ATOM 28164 N SER K 93 148.887 206.203 137.588 1.00 97.71 N ATOM 28165 CA SER K 93 149.997 206.552 136.702 1.00 98.28 C ATOM 28166 C SER K 93 151.000 205.383 136.616 1.00100.17 C ATOM 28167 O SER K 93 151.275 204.920 135.511 1.00100.59 O ATOM 28168 CB SER K 93 150.682 207.826 137.187 1.00102.52 C ATOM 28169 OG SER K 93 151.945 208.008 136.565 1.00115.49 O ATOM 28170 N ILE K 94 151.469 204.866 137.782 1.00 93.94 N ATOM 28171 CA ILE K 94 152.380 203.718 137.889 1.00 92.24 C ATOM 28172 C ILE K 94 151.862 202.532 137.034 1.00 96.37 C ATOM 28173 O ILE K 94 152.597 202.029 136.181 1.00 96.76 O ATOM 28174 CB ILE K 94 152.592 203.323 139.386 1.00 93.00 C ATOM 28175 CG1 ILE K 94 153.531 204.308 140.089 1.00 92.51 C ATOM 28176 CG2 ILE K 94 153.122 201.894 139.531 1.00 92.24 C ATOM 28177 CD1 ILE K 94 153.567 204.245 141.665 1.00 98.49 C ATOM 28178 N ILE K 95 150.592 202.119 137.248 1.00 91.79 N ATOM 28179 CA ILE K 95 149.967 200.998 136.543 1.00 91.81 C ATOM 28180 C ILE K 95 150.004 201.205 135.045 1.00 96.49 C ATOM 28181 O ILE K 95 150.497 200.343 134.317 1.00 96.20 O ATOM 28182 CB ILE K 95 148.547 200.693 137.102 1.00 94.76 C ATOM 28183 CG1 ILE K 95 148.653 199.850 138.394 1.00 93.41 C ATOM 28184 CG2 ILE K 95 147.665 199.981 136.073 1.00 96.85 C ATOM 28185 CD1 ILE K 95 147.510 200.011 139.394 1.00 99.06 C ATOM 28186 N ASN K 96 149.550 202.378 134.603 1.00 94.31 N ATOM 28187 CA ASN K 96 149.505 202.757 133.199 1.00 96.64 C ATOM 28188 C ASN K 96 150.913 202.761 132.581 1.00100.81 C ATOM 28189 O ASN K 96 151.079 202.323 131.439 1.00101.60 O ATOM 28190 CB ASN K 96 148.769 204.101 133.025 1.00 99.67 C ATOM 28191 CG ASN K 96 147.374 204.163 133.650 1.00126.26 C ATOM 28192 OD1 ASN K 96 146.545 203.233 133.555 1.00117.61 O ATOM 28193 ND2 ASN K 96 147.078 205.286 134.294 1.00118.51 N ATOM 28194 N LYS K 97 151.931 203.179 133.368 1.00 96.40 N ATOM 28195 CA LYS K 97 153.337 203.187 132.939 1.00 96.07 C ATOM 28196 C LYS K 97 153.817 201.743 132.752 1.00 99.82 C ATOM 28197 O LYS K 97 154.411 201.435 131.716 1.00101.05 O ATOM 28198 CB LYS K 97 154.236 203.966 133.928 1.00 96.18 C ATOM 28199 CG LYS K 97 154.028 205.487 133.891 1.00109.47 C ATOM 28200 CD LYS K 97 154.815 206.254 134.968 1.00116.11 C ATOM 28201 CE LYS K 97 154.883 207.740 134.672 1.00116.20 C ATOM 28202 NZ LYS K 97 156.170 208.338 135.121 1.00113.28 N1+ ATOM 28203 N LEU K 98 153.471 200.845 133.721 1.00 94.04 N ATOM 28204 CA LEU K 98 153.832 199.421 133.699 1.00 92.57 C ATOM 28205 C LEU K 98 153.127 198.686 132.574 1.00 99.67 C ATOM 28206 O LEU K 98 153.705 197.786 131.963 1.00 99.91 O ATOM 28207 CB LEU K 98 153.553 198.736 135.043 1.00 89.65 C ATOM 28208 CG LEU K 98 154.272 199.286 136.257 1.00 90.97 C ATOM 28209 CD1 LEU K 98 153.660 198.749 137.513 1.00 89.95 C ATOM 28210 CD2 LEU K 98 155.743 198.981 136.221 1.00 89.67 C ATOM 28211 N GLY K 99 151.895 199.094 132.297 1.00 98.27 N ATOM 28212 CA GLY K 99 151.093 198.522 131.228 1.00100.86 C ATOM 28213 C GLY K 99 151.763 198.707 129.886 1.00108.11 C ATOM 28214 O GLY K 99 151.821 197.767 129.088 1.00110.01 O ATOM 28215 N ALA K 100 152.308 199.916 129.651 1.00104.45 N ATOM 28216 CA ALA K 100 153.008 200.234 128.416 1.00106.03 C ATOM 28217 C ALA K 100 154.323 199.446 128.357 1.00108.24 C ATOM 28218 O ALA K 100 154.645 198.869 127.318 1.00109.73 O ATOM 28219 CB ALA K 100 153.273 201.728 128.338 1.00107.23 C ATOM 28220 N LEU K 101 155.036 199.366 129.495 1.00101.42 N ATOM 28221 CA LEU K 101 156.317 198.666 129.642 1.00 99.95 C ATOM 28222 C LEU K 101 156.221 197.201 129.244 1.00102.21 C ATOM 28223 O LEU K 101 157.098 196.693 128.541 1.00102.04 O ATOM 28224 CB LEU K 101 156.817 198.804 131.095 1.00 97.40 C ATOM 28225 CG LEU K 101 158.329 198.817 131.353 1.00101.12 C ATOM 28226 CD1 LEU K 101 158.797 197.512 131.956 1.00 99.69 C ATOM 28227 CD2 LEU K 101 159.146 199.261 130.121 1.00105.75 C ATOM 28228 N LYS K 102 155.133 196.543 129.676 1.00 97.64 N ATOM 28229 CA LYS K 102 154.833 195.156 129.361 1.00 97.90 C ATOM 28230 C LYS K 102 154.598 195.070 127.855 1.00104.28 C ATOM 28231 O LYS K 102 155.339 194.360 127.172 1.00104.95 O ATOM 28232 CB LYS K 102 153.598 194.679 130.151 1.00 99.43 C ATOM 28233 CG LYS K 102 153.282 193.191 129.989 1.00109.03 C ATOM 28234 CD LYS K 102 151.906 192.791 130.534 1.00113.76 C ATOM 28235 CE LYS K 102 151.957 192.296 131.962 1.00111.98 C ATOM 28236 NZ LYS K 102 150.615 191.894 132.448 1.00113.41 N1+ ATOM 28237 N THR K 103 153.619 195.851 127.335 1.00102.09 N ATOM 28238 CA THR K 103 153.261 195.905 125.908 1.00104.56 C ATOM 28239 C THR K 103 154.528 196.059 125.043 1.00109.44 C ATOM 28240 O THR K 103 154.777 195.215 124.187 1.00109.84 O ATOM 28241 CB THR K 103 152.139 196.948 125.634 1.00107.31 C ATOM 28242 OG1 THR K 103 151.078 196.785 126.578 1.00 99.63 O ATOM 28243 CG2 THR K 103 151.566 196.828 124.241 1.00107.54 C ATOM 28244 N ASN K 104 155.367 197.066 125.356 1.00106.00 N ATOM 28245 CA ASN K 104 156.635 197.340 124.678 1.00107.30 C ATOM 28246 C ASN K 104 157.634 196.188 124.757 1.00109.80 C ATOM 28247 O ASN K 104 158.293 195.917 123.749 1.00111.31 O ATOM 28248 CB ASN K 104 157.264 198.627 125.192 1.00110.53 C ATOM 28249 CG ASN K 104 156.642 199.860 124.603 1.00149.61 C ATOM 28250 OD1 ASN K 104 156.627 200.054 123.383 1.00153.22 O ATOM 28251 ND2 ASN K 104 156.144 200.734 125.458 1.00141.73 N ATOM 28252 N PHE K 105 157.753 195.510 125.937 1.00102.93 N ATOM 28253 CA PHE K 105 158.652 194.359 126.070 1.00101.74 C ATOM 28254 C PHE K 105 158.138 193.216 125.204 1.00109.42 C ATOM 28255 O PHE K 105 158.909 192.640 124.426 1.00111.56 O ATOM 28256 CB PHE K 105 158.810 193.875 127.523 1.00 99.68 C ATOM 28257 CG PHE K 105 159.778 192.707 127.649 1.00100.26 C ATOM 28258 CD1 PHE K 105 161.158 192.920 127.679 1.00102.25 C ATOM 28259 CD2 PHE K 105 159.313 191.395 127.714 1.00101.63 C ATOM 28260 CE1 PHE K 105 162.052 191.846 127.794 1.00102.34 C ATOM 28261 CE2 PHE K 105 160.210 190.322 127.816 1.00103.99 C ATOM 28262 CZ PHE K 105 161.572 190.557 127.865 1.00101.60 C ATOM 28263 N GLU K 106 156.837 192.889 125.348 1.00105.22 N ATOM 28264 CA GLU K 106 156.202 191.826 124.594 1.00106.51 C ATOM 28265 C GLU K 106 156.484 191.997 123.109 1.00114.65 C ATOM 28266 O GLU K 106 157.090 191.093 122.532 1.00115.72 O ATOM 28267 CB GLU K 106 154.707 191.762 124.902 1.00107.37 C ATOM 28268 CG GLU K 106 154.394 191.054 126.209 1.00115.37 C ATOM 28269 CD GLU K 106 153.047 191.352 126.845 1.00140.66 C ATOM 28270 OE1 GLU K 106 152.284 192.181 126.295 1.00141.45 O ATOM 28271 OE2 GLU K 106 152.756 190.750 127.905 1.00133.96 O1- ATOM 28272 N THR K 107 156.166 193.191 122.523 1.00113.34 N ATOM 28273 CA THR K 107 156.399 193.497 121.100 1.00116.58 C ATOM 28274 C THR K 107 157.844 193.224 120.707 1.00122.11 C ATOM 28275 O THR K 107 158.076 192.478 119.758 1.00124.47 O ATOM 28276 CB THR K 107 155.969 194.927 120.679 1.00124.65 C ATOM 28277 OG1 THR K 107 155.360 195.644 121.749 1.00124.47 O ATOM 28278 CG2 THR K 107 155.066 194.931 119.458 1.00125.59 C ATOM 28279 N GLU K 108 158.803 193.778 121.472 1.00117.04 N ATOM 28280 CA GLU K 108 160.241 193.630 121.237 1.00117.82 C ATOM 28281 C GLU K 108 160.748 192.183 121.349 1.00121.76 C ATOM 28282 O GLU K 108 161.651 191.799 120.604 1.00122.73 O ATOM 28283 CB GLU K 108 161.036 194.577 122.153 1.00117.10 C ATOM 28284 CG GLU K 108 161.649 195.768 121.437 1.00128.26 C ATOM 28285 CD GLU K 108 162.917 195.465 120.663 1.00154.05 C ATOM 28286 OE1 GLU K 108 163.854 194.887 121.260 1.00144.17 O ATOM 28287 OE2 GLU K 108 162.985 195.834 119.468 1.00156.77 O1- ATOM 28288 N TRP K 109 160.175 191.393 122.281 1.00116.99 N ATOM 28289 CA TRP K 109 160.557 189.996 122.505 1.00117.02 C ATOM 28290 C TRP K 109 160.173 189.139 121.311 1.00123.45 C ATOM 28291 O TRP K 109 160.991 188.367 120.808 1.00123.58 O ATOM 28292 CB TRP K 109 159.937 189.449 123.806 1.00113.26 C ATOM 28293 CG TRP K 109 160.162 187.978 123.992 1.00114.50 C ATOM 28294 CD1 TRP K 109 159.311 186.970 123.650 1.00118.57 C ATOM 28295 CD2 TRP K 109 161.360 187.349 124.464 1.00113.63 C ATOM 28296 NE1 TRP K 109 159.892 185.750 123.906 1.00117.88 N ATOM 28297 CE2 TRP K 109 161.154 185.952 124.401 1.00118.25 C ATOM 28298 CE3 TRP K 109 162.585 187.831 124.960 1.00113.95 C ATOM 28299 CZ2 TRP K 109 162.119 185.030 124.829 1.00117.30 C ATOM 28300 CZ3 TRP K 109 163.551 186.919 125.368 1.00115.13 C ATOM 28301 CH2 TRP K 109 163.315 185.537 125.302 1.00116.51 C ATOM 28302 N ASN K 110 158.922 189.293 120.864 1.00122.14 N ATOM 28303 CA ASN K 110 158.357 188.592 119.716 1.00125.65 C ATOM 28304 C ASN K 110 159.215 188.791 118.457 1.00134.00 C ATOM 28305 O ASN K 110 159.248 187.898 117.611 1.00137.09 O ATOM 28306 CB ASN K 110 156.908 189.053 119.460 1.00126.38 C ATOM 28307 CG ASN K 110 155.942 188.811 120.600 1.00137.54 C ATOM 28308 OD1 ASN K 110 156.130 187.926 121.445 1.00127.45 O ATOM 28309 ND2 ASN K 110 154.874 189.598 120.641 1.00127.51 N ATOM 28310 N LEU K 111 159.924 189.941 118.354 1.00129.99 N ATOM 28311 CA LEU K 111 160.804 190.263 117.223 1.00132.27 C ATOM 28312 C LEU K 111 162.098 189.435 117.244 1.00138.56 C ATOM 28313 O LEU K 111 162.693 189.209 116.185 1.00141.06 O ATOM 28314 CB LEU K 111 161.146 191.768 117.156 1.00131.49 C ATOM 28315 CG LEU K 111 160.036 192.815 117.318 1.00133.96 C ATOM 28316 CD1 LEU K 111 160.573 194.197 117.043 1.00134.25 C ATOM 28317 CD2 LEU K 111 158.810 192.526 116.442 1.00136.98 C ATOM 28318 N GLN K 112 162.531 188.991 118.443 1.00133.93 N ATOM 28319 CA GLN K 112 163.752 188.198 118.622 1.00134.32 C ATOM 28320 C GLN K 112 163.555 186.759 118.166 1.00142.54 C ATOM 28321 O GLN K 112 162.457 186.206 118.309 1.00141.57 O ATOM 28322 CB GLN K 112 164.230 188.215 120.090 1.00131.60 C ATOM 28323 CG GLN K 112 164.378 189.603 120.710 1.00133.57 C ATOM 28324 CD GLN K 112 165.315 190.503 119.945 1.00143.36 C ATOM 28325 OE1 GLN K 112 166.500 190.205 119.766 1.00138.72 O ATOM 28326 NE2 GLN K 112 164.803 191.635 119.489 1.00131.75 N