>>4V1M:HELIX   74  74 LEU B  408  GLU B  438  1                                  31    
LAGPLLAQLFKTLFKKLTKDIFRYMQRTVEE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 74 74 LEU B 408 GLU B 438 1 31 ATOM 14125 N LEU B 408 207.076 163.192 177.681 1.00 88.71 N ATOM 14126 CA LEU B 408 205.950 162.748 176.858 1.00 89.77 C ATOM 14127 C LEU B 408 205.274 161.475 177.347 1.00 93.76 C ATOM 14128 O LEU B 408 205.486 161.038 178.472 1.00102.67 O ATOM 14129 CB LEU B 408 206.383 162.544 175.416 1.00 89.49 C ATOM 14130 CG LEU B 408 205.965 163.715 174.540 1.00 93.04 C ATOM 14131 CD1 LEU B 408 207.087 164.726 174.488 1.00 95.03 C ATOM 14132 CD2 LEU B 408 205.585 163.238 173.157 1.00 97.48 C ATOM 14133 N ALA B 409 204.462 160.883 176.479 1.00 87.02 N ATOM 14134 CA ALA B 409 203.715 159.683 176.824 1.00 89.33 C ATOM 14135 C ALA B 409 204.604 158.546 177.309 1.00 89.88 C ATOM 14136 O ALA B 409 204.215 157.778 178.179 1.00 90.41 O ATOM 14137 CB ALA B 409 202.902 159.232 175.644 1.00 96.26 C ATOM 14138 N GLY B 410 205.793 158.431 176.730 1.00 92.33 N ATOM 14139 CA GLY B 410 206.730 157.400 177.128 1.00 94.51 C ATOM 14140 C GLY B 410 207.066 157.519 178.598 1.00 96.60 C ATOM 14141 O GLY B 410 206.526 156.778 179.417 1.00 94.75 O ATOM 14142 N PRO B 411 207.941 158.478 178.941 1.00101.33 N ATOM 14143 CA PRO B 411 208.415 158.713 180.311 1.00102.13 C ATOM 14144 C PRO B 411 207.298 158.877 181.343 1.00 97.80 C ATOM 14145 O PRO B 411 207.510 158.560 182.515 1.00 99.70 O ATOM 14146 CB PRO B 411 209.206 160.017 180.185 1.00104.46 C ATOM 14147 CG PRO B 411 209.671 160.034 178.780 1.00105.62 C ATOM 14148 CD PRO B 411 208.572 159.396 177.976 1.00103.38 C ATOM 14149 N LEU B 412 206.136 159.371 180.927 1.00 91.17 N ATOM 14150 CA LEU B 412 205.021 159.528 181.855 1.00 85.32 C ATOM 14151 C LEU B 412 204.512 158.173 182.304 1.00 88.17 C ATOM 14152 O LEU B 412 204.215 157.974 183.481 1.00 94.35 O ATOM 14153 CB LEU B 412 203.891 160.340 181.229 1.00 78.70 C ATOM 14154 CG LEU B 412 204.149 161.841 181.256 1.00 77.61 C ATOM 14155 CD1 LEU B 412 203.187 162.563 180.333 1.00 78.12 C ATOM 14156 CD2 LEU B 412 204.030 162.341 182.682 1.00 77.93 C ATOM 14157 N LEU B 413 204.420 157.243 181.360 1.00 83.36 N ATOM 14158 CA LEU B 413 203.987 155.888 181.661 1.00 78.37 C ATOM 14159 C LEU B 413 205.072 155.163 182.421 1.00 83.45 C ATOM 14160 O LEU B 413 204.789 154.302 183.241 1.00 92.25 O ATOM 14161 CB LEU B 413 203.658 155.132 180.378 1.00 72.42 C ATOM 14162 CG LEU B 413 202.409 155.688 179.708 1.00 70.19 C ATOM 14163 CD1 LEU B 413 202.230 155.145 178.301 1.00 71.48 C ATOM 14164 CD2 LEU B 413 201.225 155.359 180.574 1.00 67.86 C ATOM 14165 N ALA B 414 206.318 155.523 182.143 1.00 81.55 N ATOM 14166 CA ALA B 414 207.455 154.904 182.805 1.00 86.19 C ATOM 14167 C ALA B 414 207.492 155.297 184.277 1.00 88.99 C ATOM 14168 O ALA B 414 207.797 154.478 185.143 1.00 84.57 O ATOM 14169 CB ALA B 414 208.749 155.301 182.110 1.00 89.14 C ATOM 14170 N GLN B 415 207.173 156.558 184.549 1.00 95.46 N ATOM 14171 CA GLN B 415 207.150 157.058 185.913 1.00 99.85 C ATOM 14172 C GLN B 415 206.065 156.334 186.694 1.00 97.41 C ATOM 14173 O GLN B 415 206.268 155.957 187.843 1.00 95.87 O ATOM 14174 CB GLN B 415 206.891 158.568 185.931 1.00105.68 C ATOM 14175 CG GLN B 415 206.728 159.146 187.331 1.00115.94 C ATOM 14176 CD GLN B 415 205.639 160.202 187.406 1.00124.37 C ATOM 14177 OE1 GLN B 415 205.548 161.075 186.544 1.00129.44 O ATOM 14178 NE2 GLN B 415 204.799 160.120 188.437 1.00124.72 N ATOM 14179 N LEU B 416 204.924 156.127 186.040 1.00 96.15 N ATOM 14180 CA LEU B 416 203.746 155.535 186.667 1.00 90.75 C ATOM 14181 C LEU B 416 203.909 154.041 186.865 1.00 90.03 C ATOM 14182 O LEU B 416 203.521 153.487 187.888 1.00 91.77 O ATOM 14183 CB LEU B 416 202.508 155.777 185.804 1.00 82.25 C ATOM 14184 CG LEU B 416 201.233 155.570 186.608 1.00 80.50 C ATOM 14185 CD1 LEU B 416 200.995 156.801 187.451 1.00 82.55 C ATOM 14186 CD2 LEU B 416 200.062 155.294 185.712 1.00 79.22 C ATOM 14187 N PHE B 417 204.475 153.399 185.857 1.00 88.37 N ATOM 14188 CA PHE B 417 204.706 151.972 185.880 1.00 90.43 C ATOM 14189 C PHE B 417 205.730 151.599 186.954 1.00 96.09 C ATOM 14190 O PHE B 417 205.584 150.572 187.608 1.00 99.67 O ATOM 14191 CB PHE B 417 205.160 151.505 184.497 1.00 91.04 C ATOM 14192 CG PHE B 417 204.982 150.041 184.260 1.00 92.61 C ATOM 14193 CD1 PHE B 417 203.734 149.524 183.962 1.00 92.04 C ATOM 14194 CD2 PHE B 417 206.065 149.180 184.322 1.00 97.74 C ATOM 14195 CE1 PHE B 417 203.565 148.164 183.739 1.00 96.70 C ATOM 14196 CE2 PHE B 417 205.906 147.820 184.101 1.00102.33 C ATOM 14197 CZ PHE B 417 204.651 147.310 183.806 1.00100.73 C ATOM 14198 N LYS B 418 206.758 152.425 187.143 1.00100.78 N ATOM 14199 CA LYS B 418 207.726 152.184 188.219 1.00108.76 C ATOM 14200 C LYS B 418 207.012 152.088 189.562 1.00109.94 C ATOM 14201 O LYS B 418 207.008 151.033 190.189 1.00110.10 O ATOM 14202 CB LYS B 418 208.812 153.266 188.272 1.00116.73 C ATOM 14203 CG LYS B 418 209.931 153.093 187.249 1.00128.04 C ATOM 14204 CD LYS B 418 210.650 154.418 186.982 1.00135.91 C ATOM 14205 CE LYS B 418 211.656 154.315 185.833 1.00137.04 C ATOM 14206 NZ LYS B 418 212.214 155.644 185.424 1.00133.03 N1+ ATOM 14207 N THR B 419 206.380 153.177 189.986 1.00111.09 N ATOM 14208 CA THR B 419 205.635 153.170 191.244 1.00108.66 C ATOM 14209 C THR B 419 204.514 152.121 191.286 1.00104.37 C ATOM 14210 O THR B 419 204.064 151.737 192.361 1.00109.39 O ATOM 14211 CB THR B 419 205.087 154.574 191.635 1.00120.57 C ATOM 14212 OG1 THR B 419 203.789 154.437 192.222 1.00125.94 O ATOM 14213 CG2 THR B 419 204.968 155.479 190.437 1.00112.51 C ATOM 14214 N LEU B 420 204.073 151.651 190.125 1.00 98.51 N ATOM 14215 CA LEU B 420 203.024 150.636 190.072 1.00102.55 C ATOM 14216 C LEU B 420 203.576 149.220 190.116 1.00110.03 C ATOM 14217 O LEU B 420 202.865 148.279 190.470 1.00111.41 O ATOM 14218 CB LEU B 420 202.183 150.801 188.814 1.00102.26 C ATOM 14219 CG LEU B 420 200.845 151.499 189.023 1.00102.14 C ATOM 14220 CD1 LEU B 420 200.300 151.961 187.693 1.00107.91 C ATOM 14221 CD2 LEU B 420 199.869 150.560 189.705 1.00 98.37 C ATOM 14222 N PHE B 421 204.837 149.070 189.738 1.00115.00 N ATOM 14223 CA PHE B 421 205.463 147.759 189.719 1.00117.24 C ATOM 14224 C PHE B 421 206.130 147.469 191.049 1.00121.76 C ATOM 14225 O PHE B 421 206.197 146.327 191.484 1.00124.91 O ATOM 14226 CB PHE B 421 206.480 147.656 188.593 1.00112.89 C ATOM 14227 CG PHE B 421 207.206 146.356 188.566 1.00111.88 C ATOM 14228 CD1 PHE B 421 206.535 145.185 188.272 1.00113.78 C ATOM 14229 CD2 PHE B 421 208.560 146.300 188.837 1.00113.53 C ATOM 14230 CE1 PHE B 421 207.202 143.979 188.250 1.00116.43 C ATOM 14231 CE2 PHE B 421 209.235 145.097 188.811 1.00117.41 C ATOM 14232 CZ PHE B 421 208.555 143.934 188.517 1.00117.33 C ATOM 14233 N LYS B 422 206.627 148.516 191.693 1.00124.89 N ATOM 14234 CA LYS B 422 207.142 148.376 193.042 1.00132.16 C ATOM 14235 C LYS B 422 205.970 148.176 193.999 1.00132.23 C ATOM 14236 O LYS B 422 206.134 147.635 195.088 1.00136.87 O ATOM 14237 CB LYS B 422 207.999 149.585 193.428 1.00139.11 C ATOM 14238 CG LYS B 422 209.315 149.674 192.648 1.00145.58 C ATOM 14239 CD LYS B 422 209.961 151.056 192.742 1.00148.10 C ATOM 14240 CE LYS B 422 211.090 151.210 191.724 1.00147.68 C ATOM 14241 NZ LYS B 422 211.474 152.635 191.497 1.00145.34 N1+ ATOM 14242 N LYS B 423 204.778 148.597 193.582 1.00128.18 N ATOM 14243 CA LYS B 423 203.570 148.349 194.362 1.00126.96 C ATOM 14244 C LYS B 423 203.206 146.873 194.291 1.00124.48 C ATOM 14245 O LYS B 423 202.716 146.304 195.260 1.00128.36 O ATOM 14246 CB LYS B 423 202.404 149.217 193.871 1.00128.63 C ATOM 14247 CG LYS B 423 201.046 148.915 194.517 1.00130.24 C ATOM 14248 CD LYS B 423 201.084 149.095 196.025 1.00133.36 C ATOM 14249 CE LYS B 423 199.810 148.584 196.684 1.00133.93 C ATOM 14250 NZ LYS B 423 199.985 148.422 198.157 1.00134.25 N1+ ATOM 14251 N LEU B 424 203.457 146.257 193.140 1.00120.37 N ATOM 14252 CA LEU B 424 203.174 144.836 192.942 1.00120.20 C ATOM 14253 C LEU B 424 204.261 143.947 193.542 1.00127.58 C ATOM 14254 O LEU B 424 203.973 142.919 194.156 1.00129.83 O ATOM 14255 CB LEU B 424 203.036 144.528 191.452 1.00111.01 C ATOM 14256 CG LEU B 424 202.982 143.049 191.074 1.00104.17 C ATOM 14257 CD1 LEU B 424 201.705 142.399 191.605 1.00104.82 C ATOM 14258 CD2 LEU B 424 203.113 142.883 189.565 1.00 97.79 C ATOM 14259 N THR B 425 205.512 144.350 193.342 1.00129.80 N ATOM 14260 CA THR B 425 206.666 143.625 193.856 1.00130.81 C ATOM 14261 C THR B 425 206.559 143.418 195.362 1.00137.29 C ATOM 14262 O THR B 425 206.754 142.306 195.858 1.00140.00 O ATOM 14263 CB THR B 425 207.982 144.365 193.514 1.00127.47 C ATOM 14264 OG1 THR B 425 208.395 144.019 192.189 1.00122.44 O ATOM 14265 CG2 THR B 425 209.092 143.986 194.476 1.00132.82 C ATOM 14266 N LYS B 426 206.225 144.484 196.085 1.00140.70 N ATOM 14267 CA LYS B 426 206.152 144.417 197.544 1.00145.43 C ATOM 14268 C LYS B 426 204.817 143.860 198.059 1.00145.33 C ATOM 14269 O LYS B 426 204.593 143.798 199.265 1.00151.32 O ATOM 14270 CB LYS B 426 206.474 145.781 198.186 1.00147.91 C ATOM 14271 CG LYS B 426 205.316 146.779 198.206 1.00150.75 C ATOM 14272 CD LYS B 426 205.780 148.199 198.542 1.00151.81 C ATOM 14273 CE LYS B 426 206.427 148.291 199.918 1.00152.27 C ATOM 14274 NZ LYS B 426 206.904 149.676 200.202 1.00149.62 N1+ ATOM 14275 N ASP B 427 203.935 143.452 197.152 1.00138.06 N ATOM 14276 CA ASP B 427 202.697 142.787 197.554 1.00132.89 C ATOM 14277 C ASP B 427 202.858 141.287 197.378 1.00124.11 C ATOM 14278 O ASP B 427 202.148 140.500 197.998 1.00119.19 O ATOM 14279 CB ASP B 427 201.495 143.291 196.747 1.00142.16 C ATOM 14280 CG ASP B 427 201.030 144.675 197.178 1.00149.21 C ATOM 14281 OD1 ASP B 427 201.393 145.106 198.297 1.00150.95 O ATOM 14282 OD2 ASP B 427 200.297 145.327 196.399 1.00149.57 O1- ATOM 14283 N ILE B 428 203.797 140.907 196.516 1.00126.89 N ATOM 14284 CA ILE B 428 204.165 139.509 196.329 1.00133.86 C ATOM 14285 C ILE B 428 205.002 139.042 197.515 1.00148.57 C ATOM 14286 O ILE B 428 204.828 137.928 198.007 1.00152.56 O ATOM 14287 CB ILE B 428 204.978 139.307 195.037 1.00126.30 C ATOM 14288 CG1 ILE B 428 204.147 139.680 193.811 1.00125.91 C ATOM 14289 CG2 ILE B 428 205.431 137.875 194.911 1.00121.37 C ATOM 14290 CD1 ILE B 428 204.893 139.515 192.499 1.00123.06 C ATOM 14291 N PHE B 429 205.908 139.906 197.973 1.00156.45 N ATOM 14292 CA PHE B 429 206.717 139.630 199.162 1.00164.44 C ATOM 14293 C PHE B 429 205.835 139.408 200.392 1.00170.46 C ATOM 14294 O PHE B 429 206.049 138.459 201.153 1.00172.40 O ATOM 14295 CB PHE B 429 207.700 140.776 199.427 1.00164.44 C ATOM 14296 CG PHE B 429 208.912 140.371 200.229 1.00166.20 C ATOM 14297 CD1 PHE B 429 208.806 140.059 201.575 1.00166.31 C ATOM 14298 CD2 PHE B 429 210.161 140.307 199.629 1.00166.82 C ATOM 14299 CE1 PHE B 429 209.921 139.688 202.305 1.00166.75 C ATOM 14300 CE2 PHE B 429 211.280 139.940 200.355 1.00165.58 C ATOM 14301 CZ PHE B 429 211.159 139.629 201.693 1.00166.07 C ATOM 14302 N ARG B 430 204.848 140.286 200.581 1.00171.98 N ATOM 14303 CA ARG B 430 203.872 140.149 201.661 1.00170.41 C ATOM 14304 C ARG B 430 203.166 138.814 201.562 1.00167.08 C ATOM 14305 O ARG B 430 202.709 138.275 202.565 1.00169.48 O ATOM 14306 CB ARG B 430 202.830 141.273 201.626 1.00172.75 C ATOM 14307 CG ARG B 430 203.301 142.589 202.218 1.00177.32 C ATOM 14308 CD ARG B 430 202.195 143.643 202.210 1.00181.40 C ATOM 14309 NE ARG B 430 202.705 144.958 202.596 1.00186.97 N ATOM 14310 CZ ARG B 430 202.956 145.948 201.745 1.00191.53 C ATOM 14311 NH1 ARG B 430 202.726 145.791 200.447 1.00192.61 N1+ ATOM 14312 NH2 ARG B 430 203.431 147.106 202.189 1.00192.59 N ATOM 14313 N TYR B 431 203.076 138.283 200.346 1.00163.79 N ATOM 14314 CA TYR B 431 202.483 136.973 200.134 1.00164.11 C ATOM 14315 C TYR B 431 203.458 135.845 200.431 1.00167.36 C ATOM 14316 O TYR B 431 203.060 134.822 200.979 1.00173.67 O ATOM 14317 CB TYR B 431 201.952 136.815 198.713 1.00161.56 C ATOM 14318 CG TYR B 431 201.411 135.428 198.449 1.00159.33 C ATOM 14319 CD1 TYR B 431 200.123 135.080 198.837 1.00156.97 C ATOM 14320 CD2 TYR B 431 202.191 134.465 197.824 1.00159.69 C ATOM 14321 CE1 TYR B 431 199.625 133.819 198.605 1.00158.48 C ATOM 14322 CE2 TYR B 431 201.703 133.198 197.587 1.00161.76 C ATOM 14323 CZ TYR B 431 200.417 132.881 197.978 1.00162.43 C ATOM 14324 OH TYR B 431 199.916 131.621 197.744 1.00165.98 O ATOM 14325 N MET B 432 204.720 136.016 200.054 1.00164.85 N ATOM 14326 CA MET B 432 205.708 134.962 200.274 1.00166.80 C ATOM 14327 C MET B 432 205.943 134.707 201.757 1.00172.54 C ATOM 14328 O MET B 432 206.314 133.602 202.153 1.00177.90 O ATOM 14329 CB MET B 432 207.023 135.292 199.587 1.00161.53 C ATOM 14330 CG MET B 432 206.929 135.328 198.088 1.00158.54 C ATOM 14331 SD MET B 432 208.546 135.673 197.400 1.00144.11 S ATOM 14332 CE MET B 432 209.112 136.959 198.509 1.00222.80 C ATOM 14333 N GLN B 433 205.725 135.730 202.573 1.00168.89 N ATOM 14334 CA GLN B 433 205.761 135.565 204.018 1.00165.54 C ATOM 14335 C GLN B 433 204.527 134.797 204.494 1.00167.01 C ATOM 14336 O GLN B 433 204.638 133.851 205.274 1.00168.12 O ATOM 14337 CB GLN B 433 205.859 136.925 204.705 1.00160.43 C ATOM 14338 CG GLN B 433 207.157 137.654 204.409 1.00157.49 C ATOM 14339 CD GLN B 433 207.152 139.088 204.898 1.00154.29 C ATOM 14340 OE1 GLN B 433 206.101 139.729 204.984 1.00151.79 O ATOM 14341 NE2 GLN B 433 208.331 139.602 205.221 1.00153.06 N ATOM 14342 N ARG B 434 203.356 135.200 204.007 1.00167.32 N ATOM 14343 CA ARG B 434 202.098 134.548 204.367 1.00170.20 C ATOM 14344 C ARG B 434 202.032 133.080 203.953 1.00167.82 C ATOM 14345 O ARG B 434 201.279 132.303 204.534 1.00167.37 O ATOM 14346 CB ARG B 434 200.906 135.288 203.745 1.00175.27 C ATOM 14347 CG ARG B 434 200.432 136.515 204.507 1.00179.10 C ATOM 14348 CD ARG B 434 199.105 137.049 203.948 1.00182.29 C ATOM 14349 NE ARG B 434 199.284 138.070 202.915 1.00183.70 N ATOM 14350 CZ ARG B 434 198.970 137.912 201.631 1.00182.99 C ATOM 14351 NH1 ARG B 434 198.452 136.766 201.208 1.00184.02 N1+ ATOM 14352 NH2 ARG B 434 199.171 138.903 200.770 1.00179.73 N ATOM 14353 N THR B 435 202.805 132.698 202.945 1.00168.83 N ATOM 14354 CA THR B 435 202.695 131.351 202.402 1.00176.58 C ATOM 14355 C THR B 435 203.879 130.462 202.765 1.00178.99 C ATOM 14356 O THR B 435 203.889 129.271 202.459 1.00181.59 O ATOM 14357 CB THR B 435 202.508 131.364 200.876 1.00183.47 C ATOM 14358 OG1 THR B 435 202.247 130.033 200.418 1.00190.25 O ATOM 14359 CG2 THR B 435 203.752 131.902 200.182 1.00183.22 C ATOM 14360 N VAL B 436 204.883 131.041 203.409 1.00179.07 N ATOM 14361 CA VAL B 436 205.990 130.243 203.917 1.00183.80 C ATOM 14362 C VAL B 436 205.748 129.936 205.396 1.00190.68 C ATOM 14363 O VAL B 436 206.324 129.001 205.954 1.00192.89 O ATOM 14364 CB VAL B 436 207.351 130.946 203.712 1.00181.29 C ATOM 14365 CG1 VAL B 436 207.525 132.094 204.693 1.00180.69 C ATOM 14366 CG2 VAL B 436 208.492 129.947 203.834 1.00182.01 C ATOM 14367 N GLU B 437 204.875 130.721 206.018 1.00193.51 N ATOM 14368 CA GLU B 437 204.512 130.530 207.418 1.00197.13 C ATOM 14369 C GLU B 437 203.642 129.289 207.607 1.00202.86 C ATOM 14370 O GLU B 437 203.824 128.531 208.558 1.00203.56 O ATOM 14371 CB GLU B 437 203.801 131.781 207.955 1.00194.28 C ATOM 14372 CG GLU B 437 203.055 131.587 209.272 1.00194.90 C ATOM 14373 CD GLU B 437 201.570 131.319 209.079 1.00194.29 C ATOM 14374 OE1 GLU B 437 200.917 132.096 208.351 1.00191.77 O ATOM 14375 OE2 GLU B 437 201.057 130.331 209.650 1.00195.68 O1- ATOM 14376 N GLU B 438 202.699 129.085 206.691 1.00206.61 N ATOM 14377 CA GLU B 438 201.759 127.970 206.777 1.00209.98 C ATOM 14378 C GLU B 438 202.035 126.907 205.716 1.00212.25 C ATOM 14379 O GLU B 438 201.283 125.935 205.600 1.00214.46 O ATOM 14380 CB GLU B 438 200.315 128.478 206.659 1.00209.51 C ATOM 14381 CG GLU B 438 200.062 129.321 205.413 1.00208.28 C ATOM 14382 CD GLU B 438 198.681 129.949 205.380 1.00206.38 C ATOM 14383 OE1 GLU B 438 197.954 129.843 206.390 1.00207.38 O ATOM 14384 OE2 GLU B 438 198.327 130.556 204.342 1.00202.90 O1-