>>4V1M:HELIX   30  30 THR A  809  GLU A  846  1                                  38    
TPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 30 30 THR A 809 GLU A 846 1 38 ATOM 6294 N THR A 809 209.647 190.001 157.338 1.00 88.08 N ATOM 6295 CA THR A 809 210.653 188.954 157.137 1.00 88.40 C ATOM 6296 C THR A 809 210.537 187.962 158.322 1.00 91.02 C ATOM 6297 O THR A 809 210.022 188.360 159.372 1.00 90.40 O ATOM 6298 CB THR A 809 212.047 189.554 157.075 1.00 96.73 C ATOM 6299 OG1 THR A 809 212.364 190.093 158.356 1.00 96.43 O ATOM 6300 CG2 THR A 809 212.198 190.599 155.966 1.00 96.49 C ATOM 6301 N PRO A 810 210.977 186.684 158.206 1.00 86.39 N ATOM 6302 CA PRO A 810 210.828 185.750 159.345 1.00 84.75 C ATOM 6303 C PRO A 810 211.337 186.297 160.677 1.00 87.85 C ATOM 6304 O PRO A 810 210.653 186.161 161.697 1.00 85.14 O ATOM 6305 CB PRO A 810 211.594 184.510 158.889 1.00 87.23 C ATOM 6306 CG PRO A 810 211.520 184.569 157.410 1.00 92.63 C ATOM 6307 CD PRO A 810 211.587 186.010 157.042 1.00 88.70 C ATOM 6308 N GLN A 811 212.504 186.983 160.638 1.00 86.44 N ATOM 6309 CA GLN A 811 213.138 187.630 161.788 1.00 86.05 C ATOM 6310 C GLN A 811 212.179 188.723 162.317 1.00 89.03 C ATOM 6311 O GLN A 811 211.740 188.623 163.473 1.00 88.14 O ATOM 6312 CB GLN A 811 214.527 188.193 161.426 1.00 88.62 C ATOM 6313 CG GLN A 811 215.443 187.216 160.668 1.00106.31 C ATOM 6314 CD GLN A 811 215.324 187.337 159.159 1.00126.09 C ATOM 6315 OE1 GLN A 811 214.783 186.464 158.491 1.00117.10 O ATOM 6316 NE2 GLN A 811 215.826 188.419 158.578 1.00125.65 N ATOM 6317 N GLU A 812 211.758 189.690 161.447 1.00 84.65 N ATOM 6318 CA GLU A 812 210.785 190.736 161.808 1.00 82.99 C ATOM 6319 C GLU A 812 209.533 190.074 162.436 1.00 85.19 C ATOM 6320 O GLU A 812 209.113 190.490 163.515 1.00 83.94 O ATOM 6321 CB GLU A 812 210.359 191.553 160.570 1.00 84.69 C ATOM 6322 CG GLU A 812 211.291 192.665 160.124 1.00 93.71 C ATOM 6323 CD GLU A 812 210.840 193.388 158.865 1.00115.63 C ATOM 6324 OE1 GLU A 812 210.349 192.716 157.926 1.00116.77 O ATOM 6325 OE2 GLU A 812 210.983 194.630 158.809 1.00106.43 O1- ATOM 6326 N PHE A 813 208.987 189.013 161.783 1.00 80.66 N ATOM 6327 CA PHE A 813 207.818 188.278 162.235 1.00 79.38 C ATOM 6328 C PHE A 813 207.942 187.718 163.647 1.00 83.78 C ATOM 6329 O PHE A 813 206.992 187.840 164.436 1.00 81.71 O ATOM 6330 CB PHE A 813 207.445 187.170 161.244 1.00 81.70 C ATOM 6331 CG PHE A 813 206.212 186.370 161.637 1.00 82.19 C ATOM 6332 CD1 PHE A 813 204.931 186.828 161.318 1.00 84.24 C ATOM 6333 CD2 PHE A 813 206.333 185.160 162.315 1.00 83.40 C ATOM 6334 CE1 PHE A 813 203.802 186.087 161.661 1.00 83.80 C ATOM 6335 CE2 PHE A 813 205.199 184.424 162.669 1.00 84.99 C ATOM 6336 CZ PHE A 813 203.944 184.883 162.327 1.00 82.41 C ATOM 6337 N PHE A 814 209.088 187.078 163.956 1.00 82.13 N ATOM 6338 CA PHE A 814 209.305 186.505 165.282 1.00 81.73 C ATOM 6339 C PHE A 814 209.503 187.581 166.347 1.00 85.59 C ATOM 6340 O PHE A 814 208.985 187.438 167.449 1.00 83.31 O ATOM 6341 CB PHE A 814 210.455 185.495 165.277 1.00 84.53 C ATOM 6342 CG PHE A 814 210.598 184.671 166.541 1.00 85.83 C ATOM 6343 CD1 PHE A 814 209.941 183.456 166.677 1.00 88.08 C ATOM 6344 CD2 PHE A 814 211.423 185.092 167.582 1.00 88.77 C ATOM 6345 CE1 PHE A 814 210.093 182.686 167.835 1.00 88.75 C ATOM 6346 CE2 PHE A 814 211.574 184.320 168.741 1.00 91.00 C ATOM 6347 CZ PHE A 814 210.906 183.126 168.860 1.00 88.49 C ATOM 6348 N PHE A 815 210.234 188.657 166.025 1.00 84.60 N ATOM 6349 CA PHE A 815 210.455 189.737 166.984 1.00 85.06 C ATOM 6350 C PHE A 815 209.160 190.458 167.309 1.00 89.94 C ATOM 6351 O PHE A 815 208.896 190.736 168.484 1.00 88.88 O ATOM 6352 CB PHE A 815 211.551 190.702 166.516 1.00 88.25 C ATOM 6353 CG PHE A 815 212.931 190.091 166.365 1.00 91.48 C ATOM 6354 CD1 PHE A 815 213.329 189.015 167.155 1.00 94.30 C ATOM 6355 CD2 PHE A 815 213.842 190.608 165.449 1.00 95.48 C ATOM 6356 CE1 PHE A 815 214.600 188.450 167.008 1.00 96.46 C ATOM 6357 CE2 PHE A 815 215.120 190.055 165.318 1.00 99.55 C ATOM 6358 CZ PHE A 815 215.489 188.980 166.099 1.00 97.35 C ATOM 6359 N HIS A 816 208.313 190.684 166.283 1.00 88.05 N ATOM 6360 CA HIS A 816 207.004 191.306 166.455 1.00 87.59 C ATOM 6361 C HIS A 816 206.159 190.391 167.333 1.00 90.75 C ATOM 6362 O HIS A 816 205.410 190.869 168.197 1.00 89.84 O ATOM 6363 CB HIS A 816 206.326 191.589 165.100 1.00 89.31 C ATOM 6364 CG HIS A 816 205.019 192.325 165.214 1.00 92.81 C ATOM 6365 ND1 HIS A 816 204.776 193.234 166.242 1.00 94.48 N ATOM 6366 CD2 HIS A 816 203.919 192.268 164.423 1.00 94.99 C ATOM 6367 CE1 HIS A 816 203.542 193.683 166.049 1.00 93.34 C ATOM 6368 NE2 HIS A 816 202.983 193.134 164.970 1.00 93.86 N ATOM 6369 N ALA A 817 206.348 189.073 167.160 1.00 86.69 N ATOM 6370 CA ALA A 817 205.652 188.070 167.939 1.00 85.70 C ATOM 6371 C ALA A 817 206.034 188.112 169.429 1.00 89.80 C ATOM 6372 O ALA A 817 205.167 187.956 170.286 1.00 88.25 O ATOM 6373 CB ALA A 817 205.915 186.709 167.352 1.00 87.08 C ATOM 6374 N MET A 818 207.315 188.370 169.732 1.00 88.16 N ATOM 6375 CA MET A 818 207.820 188.476 171.105 1.00 87.54 C ATOM 6376 C MET A 818 207.193 189.674 171.764 1.00 89.58 C ATOM 6377 O MET A 818 206.586 189.529 172.828 1.00 87.49 O ATOM 6378 CB MET A 818 209.350 188.606 171.123 1.00 90.95 C ATOM 6379 CG MET A 818 210.055 187.334 170.774 1.00 95.28 C ATOM 6380 SD MET A 818 211.793 187.611 170.452 1.00101.10 S ATOM 6381 CE MET A 818 212.446 187.388 172.069 1.00 97.79 C ATOM 6382 N GLY A 819 207.310 190.823 171.086 1.00 87.39 N ATOM 6383 CA GLY A 819 206.756 192.111 171.496 1.00 87.45 C ATOM 6384 C GLY A 819 205.250 192.095 171.675 1.00 89.97 C ATOM 6385 O GLY A 819 204.732 192.703 172.624 1.00 88.21 O ATOM 6386 N GLY A 820 204.576 191.358 170.778 1.00 86.17 N ATOM 6387 CA GLY A 820 203.131 191.154 170.770 1.00 85.08 C ATOM 6388 C GLY A 820 202.647 190.347 171.961 1.00 87.60 C ATOM 6389 O GLY A 820 201.631 190.690 172.583 1.00 86.54 O ATOM 6390 N ARG A 821 203.402 189.275 172.293 1.00 83.05 N ATOM 6391 CA ARG A 821 203.148 188.393 173.421 1.00 81.46 C ATOM 6392 C ARG A 821 203.206 189.172 174.737 1.00 87.86 C ATOM 6393 O ARG A 821 202.377 188.915 175.602 1.00 87.36 O ATOM 6394 CB ARG A 821 204.134 187.224 173.407 1.00 78.34 C ATOM 6395 CG ARG A 821 204.266 186.442 174.706 1.00 79.64 C ATOM 6396 CD ARG A 821 203.231 185.352 174.891 1.00 80.06 C ATOM 6397 NE ARG A 821 203.712 184.049 174.434 1.00 89.98 N ATOM 6398 CZ ARG A 821 203.555 183.591 173.193 1.00112.78 C ATOM 6399 NH1 ARG A 821 202.925 184.327 172.279 1.00101.14 N1+ ATOM 6400 NH2 ARG A 821 204.028 182.396 172.853 1.00101.23 N ATOM 6401 N GLU A 822 204.122 190.159 174.873 1.00 86.56 N ATOM 6402 CA GLU A 822 204.243 190.966 176.098 1.00 86.41 C ATOM 6403 C GLU A 822 202.928 191.646 176.530 1.00 88.10 C ATOM 6404 O GLU A 822 202.592 191.642 177.727 1.00 86.08 O ATOM 6405 CB GLU A 822 205.378 192.002 175.993 1.00 88.90 C ATOM 6406 CG GLU A 822 205.889 192.439 177.364 1.00100.87 C ATOM 6407 CD GLU A 822 206.850 193.612 177.459 1.00121.24 C ATOM 6408 OE1 GLU A 822 206.910 194.444 176.522 1.00113.55 O ATOM 6409 OE2 GLU A 822 207.519 193.715 178.512 1.00113.81 O1- ATOM 6410 N GLY A 823 202.223 192.216 175.545 1.00 84.64 N ATOM 6411 CA GLY A 823 200.956 192.923 175.737 1.00 83.43 C ATOM 6412 C GLY A 823 199.828 192.000 176.156 1.00 84.04 C ATOM 6413 O GLY A 823 199.010 192.344 177.021 1.00 82.36 O ATOM 6414 N LEU A 824 199.807 190.806 175.553 1.00 78.45 N ATOM 6415 CA LEU A 824 198.849 189.774 175.876 1.00 76.62 C ATOM 6416 C LEU A 824 199.052 189.309 177.298 1.00 79.37 C ATOM 6417 O LEU A 824 198.076 189.029 177.972 1.00 78.01 O ATOM 6418 CB LEU A 824 198.968 188.609 174.900 1.00 76.99 C ATOM 6419 CG LEU A 824 198.236 188.835 173.596 1.00 82.26 C ATOM 6420 CD1 LEU A 824 198.937 188.170 172.445 1.00 82.52 C ATOM 6421 CD2 LEU A 824 196.777 188.391 173.708 1.00 87.38 C ATOM 6422 N ILE A 825 200.302 189.282 177.775 1.00 77.31 N ATOM 6423 CA ILE A 825 200.592 188.882 179.146 1.00 77.59 C ATOM 6424 C ILE A 825 200.047 189.915 180.115 1.00 84.94 C ATOM 6425 O ILE A 825 199.324 189.541 181.039 1.00 83.44 O ATOM 6426 CB ILE A 825 202.077 188.519 179.406 1.00 80.88 C ATOM 6427 CG1 ILE A 825 202.518 187.344 178.532 1.00 81.27 C ATOM 6428 CG2 ILE A 825 202.294 188.163 180.872 1.00 81.14 C ATOM 6429 CD1 ILE A 825 203.926 187.429 178.122 1.00 86.63 C ATOM 6430 N ASP A 826 200.352 191.205 179.911 1.00 86.27 N ATOM 6431 CA ASP A 826 199.794 192.170 180.847 1.00 87.85 C ATOM 6432 C ASP A 826 198.258 192.238 180.755 1.00 91.68 C ATOM 6433 O ASP A 826 197.614 192.125 181.799 1.00 90.26 O ATOM 6434 CB ASP A 826 200.547 193.515 180.900 1.00 91.83 C ATOM 6435 CG ASP A 826 200.009 194.576 179.964 1.00119.50 C ATOM 6436 OD1 ASP A 826 200.183 194.421 178.734 1.00133.46 O ATOM 6437 OD2 ASP A 826 199.418 195.578 180.467 1.00121.39 O1- ATOM 6438 N THR A 827 197.672 192.226 179.524 1.00 89.56 N ATOM 6439 CA THR A 827 196.204 192.187 179.359 1.00 89.61 C ATOM 6440 C THR A 827 195.626 191.106 180.268 1.00 96.22 C ATOM 6441 O THR A 827 194.740 191.405 181.061 1.00 95.49 O ATOM 6442 CB THR A 827 195.790 192.037 177.873 1.00 96.91 C ATOM 6443 OG1 THR A 827 195.631 193.334 177.301 1.00 99.08 O ATOM 6444 CG2 THR A 827 194.485 191.260 177.678 1.00 93.18 C ATOM 6445 N ALA A 828 196.212 189.883 180.215 1.00 95.69 N ATOM 6446 CA ALA A 828 195.836 188.706 180.999 1.00 95.89 C ATOM 6447 C ALA A 828 195.960 188.945 182.500 1.00102.38 C ATOM 6448 O ALA A 828 194.970 188.767 183.219 1.00102.45 O ATOM 6449 CB ALA A 828 196.683 187.511 180.590 1.00 96.88 C ATOM 6450 N VAL A 829 197.158 189.366 182.970 1.00 99.82 N ATOM 6451 CA VAL A 829 197.420 189.600 184.390 1.00 99.70 C ATOM 6452 C VAL A 829 196.614 190.768 184.936 1.00104.92 C ATOM 6453 O VAL A 829 195.727 190.535 185.760 1.00103.05 O ATOM 6454 CB VAL A 829 198.918 189.722 184.717 1.00103.68 C ATOM 6455 CG1 VAL A 829 199.129 189.950 186.211 1.00103.38 C ATOM 6456 CG2 VAL A 829 199.677 188.493 184.240 1.00103.79 C ATOM 6457 N LYS A 830 196.902 192.008 184.460 1.00104.16 N ATOM 6458 CA LYS A 830 196.227 193.254 184.859 1.00104.79 C ATOM 6459 C LYS A 830 194.774 193.001 185.260 1.00108.31 C ATOM 6460 O LYS A 830 194.393 193.380 186.365 1.00109.49 O ATOM 6461 CB LYS A 830 196.328 194.354 183.764 1.00108.38 C ATOM 6462 CG LYS A 830 197.275 195.540 184.095 1.00129.99 C ATOM 6463 CD LYS A 830 198.803 195.191 184.076 1.00139.16 C ATOM 6464 CE LYS A 830 199.713 196.405 184.070 1.00137.47 C ATOM 6465 NZ LYS A 830 201.140 196.010 183.944 1.00135.86 N1+ ATOM 6466 N THR A 831 194.019 192.254 184.419 1.00101.60 N ATOM 6467 CA THR A 831 192.625 191.834 184.579 1.00 99.53 C ATOM 6468 C THR A 831 192.175 191.428 186.024 1.00101.00 C ATOM 6469 O THR A 831 191.070 191.785 186.443 1.00100.35 O ATOM 6470 CB THR A 831 192.286 190.866 183.422 1.00108.65 C ATOM 6471 OG1 THR A 831 191.598 191.579 182.396 1.00107.08 O ATOM 6472 CG2 THR A 831 191.486 189.630 183.844 1.00109.37 C ATOM 6473 N ALA A 832 193.030 190.713 186.777 1.00 96.13 N ATOM 6474 CA ALA A 832 192.710 190.257 188.139 1.00 95.03 C ATOM 6475 C ALA A 832 193.242 191.167 189.225 1.00 95.06 C ATOM 6476 O ALA A 832 192.605 191.305 190.264 1.00 93.69 O ATOM 6477 CB ALA A 832 193.239 188.860 188.344 1.00 96.59 C ATOM 6478 N GLU A 833 194.440 191.738 188.994 1.00 90.71 N ATOM 6479 CA GLU A 833 195.148 192.715 189.829 1.00 90.03 C ATOM 6480 C GLU A 833 194.221 193.959 189.952 1.00 90.68 C ATOM 6481 O GLU A 833 193.881 194.391 191.066 1.00 90.04 O ATOM 6482 CB GLU A 833 196.459 193.101 189.107 1.00 92.24 C ATOM 6483 CG GLU A 833 197.751 192.867 189.881 1.00109.57 C ATOM 6484 CD GLU A 833 199.023 193.371 189.202 1.00144.75 C ATOM 6485 OE1 GLU A 833 199.127 193.263 187.954 1.00147.93 O ATOM 6486 OE2 GLU A 833 199.928 193.855 189.925 1.00134.35 O1- ATOM 6487 N THR A 834 193.773 194.469 188.772 1.00 84.20 N ATOM 6488 CA THR A 834 192.866 195.592 188.567 1.00 82.68 C ATOM 6489 C THR A 834 191.507 195.332 189.247 1.00 85.05 C ATOM 6490 O THR A 834 190.898 196.242 189.826 1.00 84.52 O ATOM 6491 CB THR A 834 192.833 195.970 187.051 1.00 87.97 C ATOM 6492 OG1 THR A 834 192.844 197.384 186.896 1.00 93.34 O ATOM 6493 CG2 THR A 834 191.664 195.355 186.263 1.00 82.73 C ATOM 6494 N GLY A 835 191.065 194.085 189.192 1.00 80.75 N ATOM 6495 CA GLY A 835 189.799 193.676 189.777 1.00 79.98 C ATOM 6496 C GLY A 835 189.788 193.795 191.284 1.00 81.52 C ATOM 6497 O GLY A 835 188.830 194.331 191.865 1.00 80.42 O ATOM 6498 N TYR A 836 190.866 193.284 191.909 1.00 76.15 N ATOM 6499 CA TYR A 836 191.012 193.292 193.349 1.00 75.69 C ATOM 6500 C TYR A 836 191.180 194.707 193.875 1.00 79.55 C ATOM 6501 O TYR A 836 190.556 195.033 194.896 1.00 79.72 O ATOM 6502 CB TYR A 836 192.111 192.333 193.797 1.00 77.42 C ATOM 6503 CG TYR A 836 192.396 192.282 195.284 1.00 80.31 C ATOM 6504 CD1 TYR A 836 191.400 191.949 196.196 1.00 82.08 C ATOM 6505 CD2 TYR A 836 193.690 192.439 195.767 1.00 82.50 C ATOM 6506 CE1 TYR A 836 191.668 191.860 197.565 1.00 83.92 C ATOM 6507 CE2 TYR A 836 193.978 192.314 197.126 1.00 84.02 C ATOM 6508 CZ TYR A 836 192.965 192.032 198.024 1.00 91.40 C ATOM 6509 OH TYR A 836 193.260 191.990 199.367 1.00 93.50 O ATOM 6510 N ILE A 837 191.935 195.580 193.136 1.00 74.01 N ATOM 6511 CA ILE A 837 192.112 197.003 193.503 1.00 71.75 C ATOM 6512 C ILE A 837 190.731 197.646 193.675 1.00 72.48 C ATOM 6513 O ILE A 837 190.480 198.315 194.688 1.00 70.57 O ATOM 6514 CB ILE A 837 192.984 197.775 192.478 1.00 73.84 C ATOM 6515 CG1 ILE A 837 194.451 197.377 192.604 1.00 74.65 C ATOM 6516 CG2 ILE A 837 192.802 199.286 192.615 1.00 72.56 C ATOM 6517 CD1 ILE A 837 195.402 198.432 192.136 1.00 85.47 C ATOM 6518 N GLN A 838 189.826 197.368 192.690 1.00 68.02 N ATOM 6519 CA GLN A 838 188.454 197.872 192.632 1.00 66.86 C ATOM 6520 C GLN A 838 187.721 197.475 193.927 1.00 67.78 C ATOM 6521 O GLN A 838 187.273 198.358 194.659 1.00 67.62 O ATOM 6522 CB GLN A 838 187.749 197.408 191.324 1.00 67.93 C ATOM 6523 CG GLN A 838 186.519 198.242 190.884 1.00 89.05 C ATOM 6524 CD GLN A 838 185.163 197.760 191.427 1.00116.38 C ATOM 6525 OE1 GLN A 838 185.053 196.778 192.191 1.00115.53 O ATOM 6526 NE2 GLN A 838 184.079 198.454 191.053 1.00101.30 N ATOM 6527 N ARG A 839 187.755 196.176 194.278 1.00 61.32 N ATOM 6528 CA ARG A 839 187.125 195.604 195.469 1.00 59.42 C ATOM 6529 C ARG A 839 187.508 196.305 196.772 1.00 60.35 C ATOM 6530 O ARG A 839 186.649 196.621 197.607 1.00 57.25 O ATOM 6531 CB ARG A 839 187.498 194.120 195.581 1.00 58.49 C ATOM 6532 CG ARG A 839 186.344 193.260 196.059 1.00 64.44 C ATOM 6533 CD ARG A 839 186.747 192.188 197.037 1.00 56.93 C ATOM 6534 NE ARG A 839 185.665 192.024 197.997 1.00 59.62 N ATOM 6535 CZ ARG A 839 185.790 191.429 199.175 1.00 86.89 C ATOM 6536 NH1 ARG A 839 186.965 190.906 199.547 1.00 76.95 N1+ ATOM 6537 NH2 ARG A 839 184.746 191.345 199.993 1.00 75.48 N ATOM 6538 N ARG A 840 188.820 196.481 196.958 1.00 57.61 N ATOM 6539 CA ARG A 840 189.373 197.093 198.150 1.00 57.56 C ATOM 6540 C ARG A 840 188.909 198.530 198.232 1.00 61.70 C ATOM 6541 O ARG A 840 188.462 198.932 199.301 1.00 63.39 O ATOM 6542 CB ARG A 840 190.890 197.024 198.141 1.00 56.96 C ATOM 6543 CG ARG A 840 191.466 195.644 198.304 1.00 62.54 C ATOM 6544 CD ARG A 840 192.628 195.490 197.352 1.00 70.06 C ATOM 6545 NE ARG A 840 193.763 196.361 197.657 1.00 78.17 N ATOM 6546 CZ ARG A 840 194.809 196.532 196.851 1.00 95.06 C ATOM 6547 NH1 ARG A 840 194.879 195.881 195.688 1.00 85.34 N1+ ATOM 6548 NH2 ARG A 840 195.789 197.361 197.193 1.00 74.05 N ATOM 6549 N LEU A 841 188.959 199.293 197.113 1.00 55.58 N ATOM 6550 CA LEU A 841 188.467 200.666 197.119 1.00 54.69 C ATOM 6551 C LEU A 841 186.998 200.669 197.570 1.00 60.21 C ATOM 6552 O LEU A 841 186.627 201.440 198.452 1.00 60.59 O ATOM 6553 CB LEU A 841 188.545 201.296 195.730 1.00 54.18 C ATOM 6554 CG LEU A 841 189.893 201.579 195.140 1.00 58.77 C ATOM 6555 CD1 LEU A 841 189.738 202.163 193.748 1.00 58.51 C ATOM 6556 CD2 LEU A 841 190.679 202.515 196.012 1.00 61.62 C ATOM 6557 N VAL A 842 186.176 199.769 197.004 1.00 56.67 N ATOM 6558 CA VAL A 842 184.754 199.702 197.334 1.00 55.98 C ATOM 6559 C VAL A 842 184.491 199.306 198.770 1.00 63.70 C ATOM 6560 O VAL A 842 183.713 199.953 199.488 1.00 64.27 O ATOM 6561 CB VAL A 842 183.951 198.877 196.330 1.00 57.42 C ATOM 6562 CG1 VAL A 842 182.486 198.842 196.723 1.00 56.41 C ATOM 6563 CG2 VAL A 842 184.105 199.462 194.943 1.00 57.21 C ATOM 6564 N LYS A 843 185.170 198.276 199.202 1.00 61.50 N ATOM 6565 CA LYS A 843 184.961 197.856 200.560 1.00 61.20 C ATOM 6566 C LYS A 843 185.416 198.898 201.593 1.00 65.79 C ATOM 6567 O LYS A 843 184.725 199.059 202.591 1.00 65.50 O ATOM 6568 CB LYS A 843 185.429 196.411 200.770 1.00 61.70 C ATOM 6569 CG LYS A 843 184.382 195.400 200.304 1.00 43.38 C ATOM 6570 CD LYS A 843 183.345 195.114 201.433 1.00 52.33 C ATOM 6571 CE LYS A 843 181.951 194.706 200.984 1.00 72.30 C ATOM 6572 NZ LYS A 843 181.871 193.379 200.288 1.00 85.49 N1+ ATOM 6573 N ALA A 844 186.449 199.709 201.283 1.00 63.71 N ATOM 6574 CA ALA A 844 186.920 200.766 202.204 1.00 65.41 C ATOM 6575 C ALA A 844 185.988 201.971 202.244 1.00 72.32 C ATOM 6576 O ALA A 844 185.890 202.658 203.277 1.00 73.17 O ATOM 6577 CB ALA A 844 188.341 201.215 201.854 1.00 66.30 C ATOM 6578 N LEU A 845 185.291 202.219 201.123 1.00 67.88 N ATOM 6579 CA LEU A 845 184.442 203.396 201.023 1.00 66.70 C ATOM 6580 C LEU A 845 182.944 203.171 201.159 1.00 68.26 C ATOM 6581 O LEU A 845 182.259 204.109 201.563 1.00 67.78 O ATOM 6582 CB LEU A 845 184.785 204.236 199.771 1.00 66.52 C ATOM 6583 CG LEU A 845 186.271 204.539 199.462 1.00 70.80 C ATOM 6584 CD1 LEU A 845 186.391 205.540 198.324 1.00 71.02 C ATOM 6585 CD2 LEU A 845 187.053 205.010 200.691 1.00 71.44 C ATOM 6586 N GLU A 846 182.435 201.955 200.854 1.00 63.52 N ATOM 6587 CA GLU A 846 181.000 201.620 200.871 1.00 63.16 C ATOM 6588 C GLU A 846 180.051 202.499 201.741 1.00 68.26 C ATOM 6589 O GLU A 846 179.263 203.278 201.172 1.00 68.10 O ATOM 6590 CB GLU A 846 180.735 200.103 200.982 1.00 63.92 C ATOM 6591 CG GLU A 846 180.945 199.484 202.351 1.00 73.49 C ATOM 6592 CD GLU A 846 180.946 197.968 202.390 1.00 96.44 C ATOM 6593 OE1 GLU A 846 180.219 197.343 201.586 1.00 90.46 O ATOM 6594 OE2 GLU A 846 181.633 197.404 203.271 1.00 94.94 O1-