>>4WCE:HELIX   47 AF2 LEU N   31  GLN N   71  1                                  41    
LYKVAKQQVMKSGQYAFRDRRQRKRDFRKLWITRINAAARQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 47 AF2 LEU N 31 GLN N 71 1 41 ATOM 73506 N LEU N 31 15.690-106.420 -33.663 1.00 6.70 N ANISOU73506 N LEU N 31 712 817 1018 327 372 483 N ATOM 73507 CA LEU N 31 16.155-105.033 -33.778 1.00 6.71 C ANISOU73507 CA LEU N 31 714 817 1019 328 372 483 C ATOM 73508 C LEU N 31 17.654-104.927 -34.023 1.00 6.68 C ANISOU73508 C LEU N 31 713 811 1016 326 372 480 C ATOM 73509 O LEU N 31 18.417-105.790 -33.588 1.00 6.64 O ANISOU73509 O LEU N 31 710 803 1011 324 372 476 O ATOM 73510 CB LEU N 31 15.782-104.226 -32.544 1.00 6.70 C ANISOU73510 CB LEU N 31 715 812 1019 327 371 480 C ATOM 73511 CG LEU N 31 14.298-104.231 -32.210 1.00 6.73 C ANISOU73511 CG LEU N 31 716 818 1022 328 371 483 C ATOM 73512 CD1 LEU N 31 14.000-103.061 -31.303 1.00 6.73 C ANISOU73512 CD1 LEU N 31 718 815 1023 328 371 482 C ATOM 73513 CD2 LEU N 31 13.438-104.180 -33.461 1.00 6.78 C ANISOU73513 CD2 LEU N 31 717 831 1028 331 372 490 C ATOM 73514 N TYR N 32 18.085-103.860 -34.694 1.00 10.25 N ANISOU73514 N TYR N 32 1164 1263 1467 327 373 482 N ATOM 73515 CA TYR N 32 19.498-103.759 -35.039 1.00 10.22 C ANISOU73515 CA TYR N 32 1163 1258 1464 326 373 479 C ATOM 73516 C TYR N 32 20.423-103.465 -33.859 1.00 10.18 C ANISOU73516 C TYR N 32 1162 1246 1459 323 372 473 C ATOM 73517 O TYR N 32 21.256-104.299 -33.530 1.00 10.14 O ANISOU73517 O TYR N 32 1160 1239 1455 321 372 469 O ATOM 73518 CB TYR N 32 19.780-102.787 -36.190 1.00 10.26 C ANISOU73518 CB TYR N 32 1165 1265 1468 328 374 483 C ATOM 73519 CG TYR N 32 21.270-102.592 -36.386 1.00 10.23 C ANISOU73519 CG TYR N 32 1164 1259 1464 326 374 479 C ATOM 73520 CD1 TYR N 32 22.083-103.649 -36.782 1.00 10.21 C ANISOU73520 CD1 TYR N 32 1162 1256 1461 325 374 478 C ATOM 73521 CD2 TYR N 32 21.872-101.364 -36.139 1.00 10.23 C ANISOU73521 CD2 TYR N 32 1166 1255 1465 325 374 478 C ATOM 73522 CE1 TYR N 32 23.450-103.481 -36.939 1.00 10.18 C ANISOU73522 CE1 TYR N 32 1161 1250 1458 323 374 475 C ATOM 73523 CE2 TYR N 32 23.240-101.188 -36.296 1.00 10.20 C ANISOU73523 CE2 TYR N 32 1165 1250 1462 324 374 475 C ATOM 73524 CZ TYR N 32 24.022-102.249 -36.694 1.00 10.18 C ANISOU73524 CZ TYR N 32 1163 1247 1458 323 374 473 C ATOM 73525 OH TYR N 32 25.378-102.075 -36.853 1.00 10.16 O ANISOU73525 OH TYR N 32 1162 1241 1455 321 374 471 O ATOM 73526 N LYS N 33 20.272-102.312 -33.211 1.00 10.54 N ANISOU73526 N LYS N 33 1209 1290 1506 322 372 472 N ATOM 73527 CA LYS N 33 21.295-101.849 -32.274 1.00 10.51 C ANISOU73527 CA LYS N 33 1209 1280 1502 320 371 467 C ATOM 73528 C LYS N 33 21.501-102.874 -31.158 1.00 10.46 C ANISOU73528 C LYS N 33 1206 1272 1497 317 371 463 C ATOM 73529 O LYS N 33 22.640-103.164 -30.731 1.00 10.43 O ANISOU73529 O LYS N 33 1205 1264 1492 315 370 459 O ATOM 73530 CB LYS N 33 20.868-100.508 -31.687 1.00 10.52 C ANISOU73530 CB LYS N 33 1212 1281 1505 320 372 468 C ATOM 73531 CG LYS N 33 20.002 -99.707 -32.644 1.00 10.58 C ANISOU73531 CG LYS N 33 1215 1291 1512 324 373 473 C ATOM 73532 CD LYS N 33 19.409 -98.460 -32.003 1.00 10.60 C ANISOU73532 CD LYS N 33 1218 1292 1515 324 373 474 C ATOM 73533 CE LYS N 33 20.345 -97.265 -32.137 1.00 10.60 C ANISOU73533 CE LYS N 33 1221 1290 1516 324 374 473 C ATOM 73534 NZ LYS N 33 19.841 -96.008 -31.491 1.00 10.62 N ANISOU73534 NZ LYS N 33 1224 1291 1520 325 375 473 N ATOM 73535 N VAL N 34 20.395-103.483 -30.752 1.00 13.96 N ANISOU73535 N VAL N 34 1648 1716 1940 318 370 464 N ATOM 73536 CA VAL N 34 20.408-104.478 -29.695 1.00 13.92 C ANISOU73536 CA VAL N 34 1646 1709 1936 316 369 460 C ATOM 73537 C VAL N 34 21.086-105.775 -30.125 1.00 13.90 C ANISOU73537 C VAL N 34 1643 1707 1933 315 369 459 C ATOM 73538 O VAL N 34 21.902-106.334 -29.385 1.00 13.87 O ANISOU73538 O VAL N 34 1641 1699 1928 312 369 454 O ATOM 73539 CB VAL N 34 18.988-104.778 -29.249 1.00 13.94 C ANISOU73539 CB VAL N 34 1646 1713 1938 317 369 462 C ATOM 73540 CG1 VAL N 34 18.998-105.843 -28.188 1.00 13.90 C ANISOU73540 CG1 VAL N 34 1644 1706 1934 315 368 458 C ATOM 73541 CG2 VAL N 34 18.344-103.508 -28.735 1.00 13.96 C ANISOU73541 CG2 VAL N 34 1649 1714 1941 318 369 463 C ATOM 73542 N ALA N 35 20.761-106.240 -31.327 1.00 6.54 N ANISOU73542 N ALA N 35 707 778 999 317 370 463 N ATOM 73543 CA ALA N 35 21.389-107.442 -31.864 1.00 6.52 C ANISOU73543 CA ALA N 35 705 777 997 316 371 462 C ATOM 73544 C ALA N 35 22.879-107.233 -32.098 1.00 6.50 C ANISOU73544 C ALA N 35 704 771 994 315 371 459 C ATOM 73545 O ALA N 35 23.668-108.172 -32.008 1.00 6.47 O ANISOU73545 O ALA N 35 702 766 990 313 371 457 O ATOM 73546 CB ALA N 35 20.711-107.876 -33.141 1.00 6.56 C ANISOU73546 CB ALA N 35 705 787 1001 319 372 467 C ATOM 73547 N LYS N 36 23.258-105.998 -32.400 1.00 6.51 N ANISOU73547 N LYS N 36 706 773 995 315 371 460 N ATOM 73548 CA LYS N 36 24.658-105.659 -32.556 1.00 6.49 C ANISOU73548 CA LYS N 36 705 768 992 314 371 457 C ATOM 73549 C LYS N 36 25.354-105.829 -31.220 1.00 6.45 C ANISOU73549 C LYS N 36 704 757 988 311 370 452 C ATOM 73550 O LYS N 36 26.401-106.489 -31.128 1.00 6.42 O ANISOU73550 O LYS N 36 702 752 984 309 370 449 O ATOM 73551 CB LYS N 36 24.811-104.219 -33.031 1.00 6.51 C ANISOU73551 CB LYS N 36 708 771 995 315 371 459 C ATOM 73552 CG LYS N 36 26.218-103.670 -32.867 1.00 6.49 C ANISOU73552 CG LYS N 36 708 765 993 313 371 456 C ATOM 73553 CD LYS N 36 26.336-102.278 -33.468 1.00 6.52 C ANISOU73553 CD LYS N 36 711 769 996 315 372 458 C ATOM 73554 CE LYS N 36 27.765-101.777 -33.412 1.00 6.49 C ANISOU73554 CE LYS N 36 710 763 994 313 372 455 C ATOM 73555 NZ LYS N 36 27.903-100.438 -34.038 1.00 6.52 N ANISOU73555 NZ LYS N 36 713 767 998 315 373 458 N ATOM 73556 N GLN N 37 24.753-105.265 -30.174 1.00 14.17 N ANISOU73556 N GLN N 37 1684 1734 1967 311 369 451 N ATOM 73557 CA GLN N 37 25.361-105.365 -28.852 1.00 14.14 C ANISOU73557 CA GLN N 37 1683 1725 1963 308 369 446 C ATOM 73558 C GLN N 37 25.510-106.813 -28.427 1.00 14.11 C ANISOU73558 C GLN N 37 1680 1721 1959 307 368 444 C ATOM 73559 O GLN N 37 26.582-107.248 -27.983 1.00 14.08 O ANISOU73559 O GLN N 37 1679 1715 1955 305 368 440 O ATOM 73560 CB GLN N 37 24.513-104.629 -27.829 1.00 14.14 C ANISOU73560 CB GLN N 37 1684 1725 1964 308 368 446 C ATOM 73561 CG GLN N 37 24.442-103.148 -28.084 1.00 14.17 C ANISOU73561 CG GLN N 37 1687 1728 1968 309 369 448 C ATOM 73562 CD GLN N 37 23.565-102.440 -27.086 1.00 14.17 C ANISOU73562 CD GLN N 37 1689 1727 1969 309 368 447 C ATOM 73563 OE1 GLN N 37 23.505-101.212 -27.061 1.00 14.19 O ANISOU73563 OE1 GLN N 37 1691 1729 1972 310 369 448 O ATOM 73564 NE2 GLN N 37 22.873-103.210 -26.253 1.00 14.16 N ANISOU73564 NE2 GLN N 37 1687 1725 1968 309 368 446 N ATOM 73565 N GLN N 38 24.432-107.564 -28.602 1.00 7.97 N ANISOU73565 N GLN N 38 900 946 1181 308 368 446 N ATOM 73566 CA GLN N 38 24.416-108.953 -28.182 1.00 7.94 C ANISOU73566 CA GLN N 38 898 942 1178 307 368 444 C ATOM 73567 C GLN N 38 25.373-109.821 -28.997 1.00 7.94 C ANISOU73567 C GLN N 38 897 941 1177 306 369 444 C ATOM 73568 O GLN N 38 25.916-110.810 -28.496 1.00 7.91 O ANISOU73568 O GLN N 38 895 936 1174 305 369 441 O ATOM 73569 CB GLN N 38 22.995-109.505 -28.233 1.00 7.97 C ANISOU73569 CB GLN N 38 898 947 1181 308 368 447 C ATOM 73570 CG GLN N 38 22.810-110.764 -27.421 1.00 7.94 C ANISOU73570 CG GLN N 38 896 943 1179 307 368 445 C ATOM 73571 CD GLN N 38 23.374-110.653 -26.018 1.00 7.91 C ANISOU73571 CD GLN N 38 896 934 1174 304 367 440 C ATOM 73572 OE1 GLN N 38 24.035-111.573 -25.536 1.00 7.88 O ANISOU73572 OE1 GLN N 38 894 929 1171 303 367 437 O ATOM 73573 NE2 GLN N 38 23.103-109.534 -25.347 1.00 7.91 N ANISOU73573 NE2 GLN N 38 897 933 1175 304 366 439 N ATOM 73574 N VAL N 39 25.596-109.449 -30.251 1.00 6.39 N ANISOU73574 N VAL N 39 698 748 980 308 370 447 N ATOM 73575 CA VAL N 39 26.543-110.199 -31.060 1.00 6.38 C ANISOU73575 CA VAL N 39 697 747 979 308 371 447 C ATOM 73576 C VAL N 39 27.977-109.914 -30.629 1.00 6.35 C ANISOU73576 C VAL N 39 697 740 975 305 370 443 C ATOM 73577 O VAL N 39 28.785-110.836 -30.506 1.00 6.32 O ANISOU73577 O VAL N 39 695 735 972 304 370 440 O ATOM 73578 CB VAL N 39 26.344-109.948 -32.560 1.00 6.41 C ANISOU73578 CB VAL N 39 698 756 983 310 372 451 C ATOM 73579 CG1 VAL N 39 27.585-110.336 -33.333 1.00 6.40 C ANISOU73579 CG1 VAL N 39 698 754 981 310 372 450 C ATOM 73580 CG2 VAL N 39 25.145-110.739 -33.055 1.00 6.44 C ANISOU73580 CG2 VAL N 39 699 763 986 312 373 455 C ATOM 73581 N MET N 40 28.281-108.649 -30.355 1.00 11.61 N ANISOU73581 N MET N 40 1364 1405 1641 305 370 442 N ATOM 73582 CA MET N 40 29.609-108.320 -29.855 1.00 11.58 C ANISOU73582 CA MET N 40 1363 1398 1638 303 369 438 C ATOM 73583 C MET N 40 29.890-109.101 -28.572 1.00 11.54 C ANISOU73583 C MET N 40 1362 1390 1634 301 369 434 C ATOM 73584 O MET N 40 30.912-109.818 -28.457 1.00 11.52 O ANISOU73584 O MET N 40 1361 1386 1630 299 369 432 O ATOM 73585 CB MET N 40 29.707-106.828 -29.561 1.00 11.58 C ANISOU73585 CB MET N 40 1365 1397 1639 303 369 438 C ATOM 73586 CG MET N 40 29.648-105.957 -30.786 1.00 11.62 C ANISOU73586 CG MET N 40 1367 1404 1642 305 370 442 C ATOM 73587 SD MET N 40 29.391-104.216 -30.381 1.00 11.63 S ANISOU73587 SD MET N 40 1370 1405 1645 306 370 443 S ATOM 73588 CE MET N 40 30.717-103.922 -29.212 1.00 11.59 C ANISOU73588 CE MET N 40 1369 1395 1641 303 370 437 C ATOM 73589 N LYS N 41 28.949-109.019 -27.631 1.00 9.32 N ANISOU73589 N LYS N 41 1081 1109 1353 301 368 434 N ATOM 73590 CA LYS N 41 29.138-109.684 -26.349 1.00 9.29 C ANISOU73590 CA LYS N 41 1080 1102 1349 299 367 430 C ATOM 73591 C LYS N 41 29.274-111.177 -26.585 1.00 9.29 C ANISOU73591 C LYS N 41 1078 1101 1348 298 368 430 C ATOM 73592 O LYS N 41 30.047-111.858 -25.902 1.00 9.26 O ANISOU73592 O LYS N 41 1077 1096 1345 297 367 427 O ATOM 73593 CB LYS N 41 27.960-109.404 -25.414 1.00 9.30 C ANISOU73593 CB LYS N 41 1081 1103 1350 299 367 431 C ATOM 73594 CG LYS N 41 28.075-110.067 -24.044 1.00 9.27 C ANISOU73594 CG LYS N 41 1079 1096 1347 297 366 427 C ATOM 73595 CD LYS N 41 28.300-109.048 -22.935 1.00 9.26 C ANISOU73595 CD LYS N 41 1080 1092 1346 296 365 425 C ATOM 73596 CE LYS N 41 29.628-108.332 -23.114 1.00 9.25 C ANISOU73596 CE LYS N 41 1080 1089 1344 295 365 423 C ATOM 73597 NZ LYS N 41 29.793-107.199 -22.168 1.00 9.24 N ANISOU73597 NZ LYS N 41 1082 1087 1344 294 365 422 N ATOM 73598 N SER N 42 28.564-111.664 -27.600 1.00 6.27 N ANISOU73598 N SER N 42 693 722 966 300 369 433 N ATOM 73599 CA SER N 42 28.626-113.071 -27.965 1.00 6.27 C ANISOU73599 CA SER N 42 692 722 966 300 369 433 C ATOM 73600 C SER N 42 30.031-113.463 -28.415 1.00 6.25 C ANISOU73600 C SER N 42 692 719 964 299 370 432 C ATOM 73601 O SER N 42 30.511-114.561 -28.113 1.00 6.23 O ANISOU73601 O SER N 42 691 715 962 298 370 430 O ATOM 73602 CB SER N 42 27.623-113.361 -29.080 1.00 6.30 C ANISOU73602 CB SER N 42 693 731 970 303 371 438 C ATOM 73603 OG SER N 42 26.726-114.387 -28.707 1.00 6.30 O ANISOU73603 OG SER N 42 693 731 971 303 371 438 O ATOM 73604 N GLY N 43 30.707-112.551 -29.105 1.00 13.25 N ANISOU73604 N GLY N 43 1578 1606 1850 300 370 432 N ATOM 73605 CA GLY N 43 32.050-112.845 -29.562 1.00 13.23 C ANISOU73605 CA GLY N 43 1577 1603 1848 299 371 431 C ATOM 73606 C GLY N 43 33.026-112.879 -28.405 1.00 13.20 C ANISOU73606 C GLY N 43 1576 1595 1843 296 370 427 C ATOM 73607 O GLY N 43 33.883-113.777 -28.320 1.00 13.18 O ANISOU73607 O GLY N 43 1575 1591 1841 295 370 425 O ATOM 73608 N GLN N 44 32.863-111.931 -27.483 1.00 9.21 N ANISOU73608 N GLN N 44 1073 1089 1339 296 369 425 N ATOM 73609 CA GLN N 44 33.778-111.837 -26.346 1.00 9.18 C ANISOU73609 CA GLN N 44 1072 1082 1335 294 368 422 C ATOM 73610 C GLN N 44 33.679-113.089 -25.476 1.00 9.17 C ANISOU73610 C GLN N 44 1071 1079 1333 292 368 420 C ATOM 73611 O GLN N 44 34.700-113.710 -25.070 1.00 9.14 O ANISOU73611 O GLN N 44 1070 1074 1330 291 368 417 O ATOM 73612 CB GLN N 44 33.430-110.610 -25.513 1.00 9.18 C ANISOU73612 CB GLN N 44 1073 1081 1335 293 367 421 C ATOM 73613 CG GLN N 44 34.473-110.263 -24.479 1.00 9.16 C ANISOU73613 CG GLN N 44 1073 1075 1332 291 367 418 C ATOM 73614 CD GLN N 44 35.641-109.511 -25.075 1.00 9.16 C ANISOU73614 CD GLN N 44 1073 1075 1331 291 367 417 C ATOM 73615 OE1 GLN N 44 35.463-108.478 -25.723 1.00 9.18 O ANISOU73615 OE1 GLN N 44 1075 1078 1334 292 367 419 O ATOM 73616 NE2 GLN N 44 36.846-110.029 -24.868 1.00 9.14 N ANISOU73616 NE2 GLN N 44 1072 1071 1328 290 367 415 N ATOM 73617 N TYR N 45 32.434-113.479 -25.229 1.00 10.53 N ANISOU73617 N TYR N 45 1243 1253 1506 293 368 421 N ATOM 73618 CA TYR N 45 32.183-114.689 -24.478 1.00 10.52 C ANISOU73618 CA TYR N 45 1242 1250 1505 292 368 419 C ATOM 73619 C TYR N 45 32.739-115.872 -25.243 1.00 10.52 C ANISOU73619 C TYR N 45 1242 1250 1505 292 369 419 C ATOM 73620 O TYR N 45 33.226-116.804 -24.632 1.00 10.50 O ANISOU73620 O TYR N 45 1241 1246 1503 291 369 417 O ATOM 73621 CB TYR N 45 30.688-114.916 -24.260 1.00 10.53 C ANISOU73621 CB TYR N 45 1242 1253 1507 293 368 421 C ATOM 73622 CG TYR N 45 30.023-114.017 -23.246 1.00 10.53 C ANISOU73622 CG TYR N 45 1243 1252 1507 293 366 420 C ATOM 73623 CD1 TYR N 45 30.764-113.249 -22.363 1.00 10.51 C ANISOU73623 CD1 TYR N 45 1243 1248 1504 292 365 418 C ATOM 73624 CD2 TYR N 45 28.640-113.950 -23.172 1.00 10.55 C ANISOU73624 CD2 TYR N 45 1243 1256 1509 294 366 422 C ATOM 73625 CE1 TYR N 45 30.142-112.433 -21.444 1.00 10.51 C ANISOU73625 CE1 TYR N 45 1244 1247 1504 291 365 417 C ATOM 73626 CE2 TYR N 45 28.013-113.144 -22.260 1.00 10.55 C ANISOU73626 CE2 TYR N 45 1244 1255 1509 294 365 422 C ATOM 73627 CZ TYR N 45 28.763-112.386 -21.398 1.00 10.53 C ANISOU73627 CZ TYR N 45 1244 1250 1507 293 364 419 C ATOM 73628 OH TYR N 45 28.117-111.578 -20.489 1.00 10.53 O ANISOU73628 OH TYR N 45 1245 1250 1507 293 363 419 O ATOM 73629 N ALA N 46 32.679-115.842 -26.575 1.00 12.48 N ANISOU73629 N ALA N 46 1487 1500 1753 294 370 422 N ATOM 73630 CA ALA N 46 33.151-116.992 -27.351 1.00 12.48 C ANISOU73630 CA ALA N 46 1487 1501 1754 294 371 423 C ATOM 73631 C ALA N 46 34.649-117.208 -27.182 1.00 12.46 C ANISOU73631 C ALA N 46 1486 1496 1751 293 371 420 C ATOM 73632 O ALA N 46 35.114-118.340 -27.003 1.00 12.45 O ANISOU73632 O ALA N 46 1486 1493 1750 292 372 418 O ATOM 73633 CB ALA N 46 32.807-116.827 -28.812 1.00 12.51 C ANISOU73633 CB ALA N 46 1488 1507 1757 296 373 426 C ATOM 73634 N PHE N 47 35.389-116.105 -27.192 1.00 14.20 N ANISOU73634 N PHE N 47 1708 1716 1971 292 371 419 N ATOM 73635 CA PHE N 47 36.832-116.129 -26.973 1.00 14.18 C ANISOU73635 CA PHE N 47 1707 1711 1968 291 371 416 C ATOM 73636 C PHE N 47 37.161-116.728 -25.598 1.00 14.15 C ANISOU73636 C PHE N 47 1707 1706 1965 289 370 413 C ATOM 73637 O PHE N 47 37.800-117.830 -25.462 1.00 14.14 O ANISOU73637 O PHE N 47 1707 1703 1964 288 371 412 O ATOM 73638 CB PHE N 47 37.323-114.681 -27.048 1.00 14.18 C ANISOU73638 CB PHE N 47 1708 1711 1967 291 370 416 C ATOM 73639 CG PHE N 47 38.814-114.525 -27.093 1.00 14.16 C ANISOU73639 CG PHE N 47 1707 1708 1964 289 370 414 C ATOM 73640 CD1 PHE N 47 39.589-115.296 -27.943 1.00 14.16 C ANISOU73640 CD1 PHE N 47 1707 1708 1964 289 371 414 C ATOM 73641 CD2 PHE N 47 39.436-113.563 -26.313 1.00 14.15 C ANISOU73641 CD2 PHE N 47 1708 1705 1962 288 369 413 C ATOM 73642 CE1 PHE N 47 40.963-115.130 -27.989 1.00 14.14 C ANISOU73642 CE1 PHE N 47 1707 1705 1962 288 371 413 C ATOM 73643 CE2 PHE N 47 40.806-113.393 -26.355 1.00 14.13 C ANISOU73643 CE2 PHE N 47 1707 1702 1960 287 369 411 C ATOM 73644 CZ PHE N 47 41.570-114.174 -27.195 1.00 14.13 C ANISOU73644 CZ PHE N 47 1707 1702 1960 287 370 411 C ATOM 73645 N ARG N 48 36.690-116.030 -24.566 1.00 31.05 N ANISOU73645 N ARG N 48 3848 3845 4105 288 369 413 N ATOM 73646 CA ARG N 48 37.085-116.453 -23.231 1.00 31.03 C ANISOU73646 CA ARG N 48 3848 3840 4102 287 368 410 C ATOM 73647 C ARG N 48 36.588-117.868 -22.939 1.00 31.03 C ANISOU73647 C ARG N 48 3847 3840 4102 287 369 409 C ATOM 73648 O ARG N 48 37.286-118.658 -22.309 1.00 31.01 O ANISOU73648 O ARG N 48 3847 3836 4100 285 369 407 O ATOM 73649 CB ARG N 48 36.624-115.456 -22.161 1.00 31.02 C ANISOU73649 CB ARG N 48 3848 3839 4101 286 367 409 C ATOM 73650 CG ARG N 48 35.135-115.458 -21.876 1.00 31.04 C ANISOU73650 CG ARG N 48 3848 3841 4103 287 366 410 C ATOM 73651 CD ARG N 48 34.833-116.085 -20.525 1.00 31.02 C ANISOU73651 CD ARG N 48 3848 3838 4101 286 366 408 C ATOM 73652 NE ARG N 48 33.403-116.320 -20.361 1.00 31.03 N ANISOU73652 NE ARG N 48 3848 3840 4103 287 366 410 N ATOM 73653 CZ ARG N 48 32.542-115.408 -19.923 1.00 31.04 C ANISOU73653 CZ ARG N 48 3848 3842 4104 287 365 410 C ATOM 73654 NH1 ARG N 48 31.256-115.712 -19.814 1.00 31.05 N ANISOU73654 NH1 ARG N 48 3849 3844 4106 288 365 412 N ATOM 73655 NH2 ARG N 48 32.967-114.193 -19.595 1.00 31.04 N ANISOU73655 NH2 ARG N 48 3849 3841 4103 287 364 410 N ATOM 73656 N ASP N 49 35.413-118.208 -23.453 1.00 36.00 N ANISOU73656 N ASP N 49 4475 4471 4732 288 369 412 N ATOM 73657 CA ASP N 49 34.860-119.535 -23.219 1.00 36.00 C ANISOU73657 CA ASP N 49 4475 4470 4733 288 370 412 C ATOM 73658 C ASP N 49 35.594-120.647 -23.960 1.00 36.00 C ANISOU73658 C ASP N 49 4475 4470 4734 288 372 412 C ATOM 73659 O ASP N 49 35.562-121.792 -23.514 1.00 36.00 O ANISOU73659 O ASP N 49 4475 4468 4734 288 372 411 O ATOM 73660 CB ASP N 49 33.350-119.592 -23.485 1.00 36.02 C ANISOU73660 CB ASP N 49 4475 4475 4736 289 370 414 C ATOM 73661 CG ASP N 49 32.528-118.903 -22.389 1.00 36.01 C ANISOU73661 CG ASP N 49 4475 4474 4735 289 369 414 C ATOM 73662 OD1 ASP N 49 32.816-119.107 -21.188 1.00 36.00 O ANISOU73662 OD1 ASP N 49 4475 4469 4733 288 368 411 O ATOM 73663 OD2 ASP N 49 31.589-118.151 -22.728 1.00 36.03 O ANISOU73663 OD2 ASP N 49 4475 4478 4737 290 368 416 O ATOM 73664 N ARG N 50 36.252-120.340 -25.078 1.00 11.14 N ANISOU73664 N ARG N 50 1325 1323 1585 289 372 413 N ATOM 73665 CA ARG N 50 37.101-121.371 -25.686 1.00 11.14 C ANISOU73665 CA ARG N 50 1326 1322 1586 289 374 412 C ATOM 73666 C ARG N 50 38.258-121.681 -24.741 1.00 11.12 C ANISOU73666 C ARG N 50 1325 1316 1582 287 374 409 C ATOM 73667 O ARG N 50 38.557-122.871 -24.429 1.00 11.11 O ANISOU73667 O ARG N 50 1326 1314 1583 286 375 408 O ATOM 73668 CB ARG N 50 37.609-120.956 -27.069 1.00 11.15 C ANISOU73668 CB ARG N 50 1326 1325 1587 290 375 414 C ATOM 73669 CG ARG N 50 36.502-120.885 -28.117 1.00 11.18 C ANISOU73669 CG ARG N 50 1326 1331 1591 292 376 418 C ATOM 73670 CD ARG N 50 37.031-120.651 -29.520 1.00 11.20 C ANISOU73670 CD ARG N 50 1326 1335 1593 293 377 419 C ATOM 73671 NE ARG N 50 36.251-119.637 -30.223 1.00 11.22 N ANISOU73671 NE ARG N 50 1327 1340 1595 294 376 422 N ATOM 73672 CZ ARG N 50 36.694-118.413 -30.491 1.00 11.21 C ANISOU73672 CZ ARG N 50 1327 1340 1594 294 375 422 C ATOM 73673 NH1 ARG N 50 37.916-118.054 -30.124 1.00 11.19 N ANISOU73673 NH1 ARG N 50 1326 1336 1590 293 375 420 N ATOM 73674 NH2 ARG N 50 35.921-117.548 -31.135 1.00 11.24 N ANISOU73674 NH2 ARG N 50 1327 1346 1596 296 375 425 N ATOM 73675 N ARG N 51 38.863-120.618 -24.211 1.00 21.96 N ANISOU73675 N ARG N 51 2699 2689 2954 286 372 408 N ATOM 73676 CA ARG N 51 39.929-120.869 -23.230 1.00 21.94 C ANISOU73676 CA ARG N 51 2699 2684 2951 284 372 405 C ATOM 73677 C ARG N 51 39.437-121.698 -22.019 1.00 21.93 C ANISOU73677 C ARG N 51 2699 2682 2951 284 371 404 C ATOM 73678 O ARG N 51 40.018-122.755 -21.636 1.00 21.92 O ANISOU73678 O ARG N 51 2700 2680 2950 283 372 403 O ATOM 73679 CB ARG N 51 40.537-119.551 -22.755 1.00 21.92 C ANISOU73679 CB ARG N 51 2699 2683 2949 284 370 404 C ATOM 73680 CG ARG N 51 41.599-118.990 -23.682 1.00 21.92 C ANISOU73680 CG ARG N 51 2699 2683 2948 284 370 404 C ATOM 73681 CD ARG N 51 41.020-118.400 -24.959 1.00 21.94 C ANISOU73681 CD ARG N 51 2699 2688 2951 285 371 407 C ATOM 73682 NE ARG N 51 42.084-117.964 -25.858 1.00 21.94 N ANISOU73682 NE ARG N 51 2699 2688 2951 285 371 407 N ATOM 73683 CZ ARG N 51 42.757-116.825 -25.723 1.00 21.94 C ANISOU73683 CZ ARG N 51 2699 2687 2949 285 370 406 C ATOM 73684 NH1 ARG N 51 42.466-115.999 -24.730 1.00 21.93 N ANISOU73684 NH1 ARG N 51 2699 2685 2948 284 369 406 N ATOM 73685 NH2 ARG N 51 43.715-116.502 -26.581 1.00 21.94 N ANISOU73685 NH2 ARG N 51 2699 2687 2949 285 371 407 N ATOM 73686 N GLN N 52 38.326-121.252 -21.448 1.00 12.74 N ANISOU73686 N GLN N 52 1535 1519 1787 284 370 404 N ATOM 73687 CA GLN N 52 37.807-121.910 -20.268 1.00 12.73 C ANISOU73687 CA GLN N 52 1535 1517 1786 283 370 403 C ATOM 73688 C GLN N 52 37.472-123.348 -20.575 1.00 12.74 C ANISOU73688 C GLN N 52 1536 1517 1789 284 372 404 C ATOM 73689 O GLN N 52 37.669-124.215 -19.739 1.00 12.74 O ANISOU73689 O GLN N 52 1536 1515 1788 283 372 402 O ATOM 73690 CB GLN N 52 36.568-121.199 -19.749 1.00 12.74 C ANISOU73690 CB GLN N 52 1535 1518 1787 284 369 404 C ATOM 73691 CG GLN N 52 36.876-119.953 -18.962 1.00 12.73 C ANISOU73691 CG GLN N 52 1535 1516 1784 283 367 403 C ATOM 73692 CD GLN N 52 35.632-119.147 -18.668 1.00 12.73 C ANISOU73692 CD GLN N 52 1535 1518 1785 283 366 404 C ATOM 73693 OE1 GLN N 52 34.527-119.516 -19.081 1.00 12.75 O ANISOU73693 OE1 GLN N 52 1535 1521 1788 284 367 406 O ATOM 73694 NE2 GLN N 52 35.800-118.036 -17.953 1.00 12.73 N ANISOU73694 NE2 GLN N 52 1535 1517 1784 283 365 403 N ATOM 73695 N ARG N 53 37.005-123.611 -21.788 1.00 7.01 N ANISOU73695 N ARG N 53 807 792 1063 285 373 406 N ATOM 73696 CA ARG N 53 36.648-124.970 -22.141 1.00 7.02 C ANISOU73696 CA ARG N 53 808 793 1066 286 375 407 C ATOM 73697 C ARG N 53 37.867-125.861 -22.086 1.00 7.01 C ANISOU73697 C ARG N 53 809 790 1065 285 376 405 C ATOM 73698 O ARG N 53 37.779-127.035 -21.656 1.00 7.01 O ANISOU73698 O ARG N 53 810 789 1066 284 377 404 O ATOM 73699 CB ARG N 53 36.049-125.027 -23.532 1.00 7.04 C ANISOU73699 CB ARG N 53 809 798 1069 287 376 409 C ATOM 73700 CG ARG N 53 35.959-126.428 -24.070 1.00 7.06 C ANISOU73700 CG ARG N 53 810 799 1073 288 379 410 C ATOM 73701 CD ARG N 53 35.364-126.410 -25.442 1.00 7.08 C ANISOU73701 CD ARG N 53 810 804 1077 290 381 413 C ATOM 73702 NE ARG N 53 35.936-125.345 -26.255 1.00 7.08 N ANISOU73702 NE ARG N 53 810 806 1076 290 380 414 N ATOM 73703 CZ ARG N 53 35.727-125.225 -27.559 1.00 7.10 C ANISOU73703 CZ ARG N 53 810 810 1079 292 381 417 C ATOM 73704 NH1 ARG N 53 34.964-126.115 -28.184 1.00 7.13 N ANISOU73704 NH1 ARG N 53 811 814 1083 293 383 419 N ATOM 73705 NH2 ARG N 53 36.284-124.227 -28.235 1.00 7.10 N ANISOU73705 NH2 ARG N 53 810 812 1077 292 380 417 N ATOM 73706 N LYS N 54 39.014-125.298 -22.474 1.00 10.00 N ANISOU73706 N LYS N 54 1189 1169 1443 284 376 404 N ATOM 73707 CA LYS N 54 40.253-126.056 -22.286 1.00 10.00 C ANISOU73707 CA LYS N 54 1189 1166 1442 283 377 403 C ATOM 73708 C LYS N 54 40.373-126.451 -20.818 1.00 9.98 C ANISOU73708 C LYS N 54 1189 1163 1440 282 376 401 C ATOM 73709 O LYS N 54 40.549-127.658 -20.472 1.00 9.98 O ANISOU73709 O LYS N 54 1190 1162 1442 282 377 400 O ATOM 73710 CB LYS N 54 41.485-125.241 -22.687 1.00 9.99 C ANISOU73710 CB LYS N 54 1188 1165 1440 283 376 402 C ATOM 73711 CG LYS N 54 41.913-125.388 -24.139 1.00 10.00 C ANISOU73711 CG LYS N 54 1189 1168 1442 284 377 404 C ATOM 73712 CD LYS N 54 41.305-124.317 -25.014 1.00 10.01 C ANISOU73712 CD LYS N 54 1188 1171 1443 285 377 406 C ATOM 73713 CE LYS N 54 41.956-124.311 -26.374 1.00 10.02 C ANISOU73713 CE LYS N 54 1188 1173 1444 286 378 407 C ATOM 73714 NZ LYS N 54 41.251-123.375 -27.282 1.00 10.03 N ANISOU73714 NZ LYS N 54 1188 1177 1446 287 378 409 N ATOM 73715 N ARG N 55 40.209-125.453 -19.946 1.00 6.32 N ANISOU73715 N ARG N 55 726 699 975 282 374 400 N ATOM 73716 CA ARG N 55 40.382-125.743 -18.513 1.00 6.30 C ANISOU73716 CA ARG N 55 726 696 973 281 373 398 C ATOM 73717 C ARG N 55 39.388-126.795 -17.991 1.00 6.31 C ANISOU73717 C ARG N 55 726 696 975 281 374 399 C ATOM 73718 O ARG N 55 39.737-127.683 -17.193 1.00 6.31 O ANISOU73718 O ARG N 55 727 694 975 280 374 398 O ATOM 73719 CB ARG N 55 40.229-124.471 -17.685 1.00 6.29 C ANISOU73719 CB ARG N 55 725 695 970 280 371 398 C ATOM 73720 CG ARG N 55 41.094-123.319 -18.127 1.00 6.29 C ANISOU73720 CG ARG N 55 724 695 969 280 370 398 C ATOM 73721 CD ARG N 55 40.623-122.031 -17.481 1.00 6.28 C ANISOU73721 CD ARG N 55 724 695 967 280 369 398 C ATOM 73722 NE ARG N 55 41.343-120.868 -17.984 1.00 6.28 N ANISOU73722 NE ARG N 55 723 696 966 280 368 398 N ATOM 73723 CZ ARG N 55 41.110-119.619 -17.594 1.00 6.27 C ANISOU73723 CZ ARG N 55 723 696 965 280 367 398 C ATOM 73724 NH1 ARG N 55 40.170-119.364 -16.692 1.00 6.27 N ANISOU73724 NH1 ARG N 55 723 695 965 280 366 397 N ATOM 73725 NH2 ARG N 55 41.820-118.621 -18.103 1.00 6.27 N ANISOU73725 NH2 ARG N 55 723 696 965 280 367 398 N ATOM 73726 N ASP N 56 38.163-126.719 -18.496 1.00 35.84 N ANISOU73726 N ASP N 56 4465 4437 4715 282 374 400 N ATOM 73727 CA ASP N 56 37.074-127.538 -17.999 1.00 35.85 C ANISOU73727 CA ASP N 56 4465 4438 4717 282 374 401 C ATOM 73728 C ASP N 56 37.303-128.991 -18.321 1.00 35.86 C ANISOU73728 C ASP N 56 4467 4438 4720 282 377 401 C ATOM 73729 O ASP N 56 37.193-129.857 -17.444 1.00 35.86 O ANISOU73729 O ASP N 56 4468 4436 4721 282 377 400 O ATOM 73730 CB ASP N 56 35.757-127.091 -18.623 1.00 35.86 C ANISOU73730 CB ASP N 56 4465 4441 4720 283 374 403 C ATOM 73731 CG ASP N 56 35.429-125.649 -18.310 1.00 35.85 C ANISOU73731 CG ASP N 56 4464 4442 4717 283 372 403 C ATOM 73732 OD1 ASP N 56 35.841-125.173 -17.230 1.00 35.84 O ANISOU73732 OD1 ASP N 56 4463 4439 4714 282 371 401 O ATOM 73733 OD2 ASP N 56 34.763-124.993 -19.142 1.00 35.87 O ANISOU73733 OD2 ASP N 56 4464 4445 4719 284 372 404 O ATOM 73734 N PHE N 57 37.629-129.277 -19.575 1.00 10.47 N ANISOU73734 N PHE N 57 1250 1222 1505 283 379 402 N ATOM 73735 CA PHE N 57 37.867-130.679 -19.891 1.00 10.48 C ANISOU73735 CA PHE N 57 1252 1222 1508 283 381 402 C ATOM 73736 C PHE N 57 39.093-131.235 -19.154 1.00 10.47 C ANISOU73736 C PHE N 57 1252 1219 1507 282 381 400 C ATOM 73737 O PHE N 57 39.095-132.413 -18.720 1.00 10.47 O ANISOU73737 O PHE N 57 1254 1218 1509 282 383 400 O ATOM 73738 CB PHE N 57 37.901-130.920 -21.399 1.00 10.50 C ANISOU73738 CB PHE N 57 1252 1225 1512 284 383 404 C ATOM 73739 CG PHE N 57 36.535-130.980 -22.016 1.00 10.52 C ANISOU73739 CG PHE N 57 1252 1229 1515 286 384 406 C ATOM 73740 CD1 PHE N 57 35.900-129.825 -22.439 1.00 10.52 C ANISOU73740 CD1 PHE N 57 1251 1231 1514 287 383 407 C ATOM 73741 CD2 PHE N 57 35.870-132.191 -22.142 1.00 10.54 C ANISOU73741 CD2 PHE N 57 1254 1230 1519 287 387 407 C ATOM 73742 CE1 PHE N 57 34.632-129.877 -22.996 1.00 10.54 C ANISOU73742 CE1 PHE N 57 1251 1235 1518 288 384 410 C ATOM 73743 CE2 PHE N 57 34.599-132.252 -22.698 1.00 10.56 C ANISOU73743 CE2 PHE N 57 1255 1233 1523 288 388 409 C ATOM 73744 CZ PHE N 57 33.978-131.092 -23.121 1.00 10.56 C ANISOU73744 CZ PHE N 57 1253 1236 1522 289 386 411 C ATOM 73745 N ARG N 58 40.098-130.379 -18.939 1.00 7.15 N ANISOU73745 N ARG N 58 832 798 1084 281 380 399 N ATOM 73746 CA ARG N 58 41.238-130.839 -18.143 1.00 7.14 C ANISOU73746 CA ARG N 58 833 796 1083 281 380 397 C ATOM 73747 C ARG N 58 40.782-131.310 -16.763 1.00 7.13 C ANISOU73747 C ARG N 58 834 794 1082 280 379 397 C ATOM 73748 O ARG N 58 41.104-132.432 -16.326 1.00 7.14 O ANISOU73748 O ARG N 58 835 793 1083 280 381 396 O ATOM 73749 CB ARG N 58 42.266-129.726 -17.982 1.00 7.12 C ANISOU73749 CB ARG N 58 832 794 1079 280 378 397 C ATOM 73750 CG ARG N 58 43.230-129.936 -16.829 1.00 7.11 C ANISOU73750 CG ARG N 58 832 792 1076 279 377 395 C ATOM 73751 CD ARG N 58 44.391-130.842 -17.197 1.00 7.11 C ANISOU73751 CD ARG N 58 834 791 1078 279 379 395 C ATOM 73752 NE ARG N 58 45.567-130.495 -16.405 1.00 7.10 N ANISOU73752 NE ARG N 58 833 790 1075 278 378 394 N ATOM 73753 CZ ARG N 58 46.787-130.977 -16.613 1.00 7.10 C ANISOU73753 CZ ARG N 58 834 789 1075 278 379 393 C ATOM 73754 NH1 ARG N 58 47.004-131.842 -17.594 1.00 7.12 N ANISOU73754 NH1 ARG N 58 836 790 1078 279 381 394 N ATOM 73755 NH2 ARG N 58 47.793-130.591 -15.837 1.00 7.09 N ANISOU73755 NH2 ARG N 58 834 788 1072 278 378 392 N ATOM 73756 N LYS N 59 39.992-130.467 -16.097 1.00 29.15 N ANISOU73756 N LYS N 59 3622 3584 3870 280 377 396 N ATOM 73757 CA LYS N 59 39.524-130.795 -14.752 1.00 29.15 C ANISOU73757 CA LYS N 59 3623 3583 3869 279 376 396 C ATOM 73758 C LYS N 59 38.656-132.048 -14.726 1.00 29.16 C ANISOU73758 C LYS N 59 3624 3583 3872 280 378 396 C ATOM 73759 O LYS N 59 38.771-132.875 -13.817 1.00 29.16 O ANISOU73759 O LYS N 59 3625 3582 3873 279 378 395 O ATOM 73760 CB LYS N 59 38.735-129.630 -14.161 1.00 29.13 C ANISOU73760 CB LYS N 59 3621 3583 3866 279 374 395 C ATOM 73761 CG LYS N 59 39.584-128.472 -13.676 1.00 29.12 C ANISOU73761 CG LYS N 59 3620 3581 3863 278 372 395 C ATOM 73762 CD LYS N 59 38.713-127.259 -13.387 1.00 29.11 C ANISOU73762 CD LYS N 59 3619 3582 3861 278 370 395 C ATOM 73763 CE LYS N 59 37.558-127.617 -12.458 1.00 29.11 C ANISOU73763 CE LYS N 59 3619 3582 3862 278 370 395 C ATOM 73764 NZ LYS N 59 36.407-126.674 -12.587 1.00 29.11 N ANISOU73764 NZ LYS N 59 3618 3583 3862 279 368 395 N ATOM 73765 N LEU N 60 37.815-132.215 -15.740 1.00 6.04 N ANISOU73765 N LEU N 60 695 656 946 281 379 398 N ATOM 73766 CA LEU N 60 36.927-133.368 -15.760 1.00 6.06 C ANISOU73766 CA LEU N 60 696 657 950 281 381 398 C ATOM 73767 C LEU N 60 37.721-134.662 -15.830 1.00 6.07 C ANISOU73767 C LEU N 60 699 656 953 281 384 398 C ATOM 73768 O LEU N 60 37.443-135.620 -15.086 1.00 6.08 O ANISOU73768 O LEU N 60 700 655 954 281 385 398 O ATOM 73769 CB LEU N 60 35.973-133.283 -16.946 1.00 6.08 C ANISOU73769 CB LEU N 60 696 660 953 282 382 400 C ATOM 73770 CG LEU N 60 35.002-134.450 -17.093 1.00 6.10 C ANISOU73770 CG LEU N 60 698 661 958 283 385 401 C ATOM 73771 CD1 LEU N 60 34.191-134.650 -15.821 1.00 6.09 C ANISOU73771 CD1 LEU N 60 698 660 957 283 384 401 C ATOM 73772 CD2 LEU N 60 34.092-134.210 -18.280 1.00 6.12 C ANISOU73772 CD2 LEU N 60 698 665 961 284 386 403 C ATOM 73773 N TRP N 61 38.733-134.685 -16.696 1.00 12.15 N ANISOU73773 N TRP N 61 1468 1425 1722 281 385 398 N ATOM 73774 CA TRP N 61 39.554-135.893 -16.773 1.00 12.16 C ANISOU73774 CA TRP N 61 1470 1424 1725 281 387 398 C ATOM 73775 C TRP N 61 40.310-136.122 -15.469 1.00 12.15 C ANISOU73775 C TRP N 61 1471 1422 1722 280 386 396 C ATOM 73776 O TRP N 61 40.494-137.267 -15.037 1.00 12.16 O ANISOU73776 O TRP N 61 1473 1422 1725 280 388 396 O ATOM 73777 CB TRP N 61 40.542-135.832 -17.935 1.00 12.16 C ANISOU73777 CB TRP N 61 1471 1425 1726 282 389 398 C ATOM 73778 CG TRP N 61 39.921-135.498 -19.228 1.00 12.17 C ANISOU73778 CG TRP N 61 1470 1428 1728 283 389 400 C ATOM 73779 CD1 TRP N 61 38.720-135.940 -19.708 1.00 12.19 C ANISOU73779 CD1 TRP N 61 1471 1430 1732 283 391 401 C ATOM 73780 CD2 TRP N 61 40.455-134.622 -20.219 1.00 12.17 C ANISOU73780 CD2 TRP N 61 1469 1429 1727 283 389 400 C ATOM 73781 NE1 TRP N 61 38.480-135.397 -20.951 1.00 12.20 N ANISOU73781 NE1 TRP N 61 1470 1433 1733 284 392 403 N ATOM 73782 CE2 TRP N 61 39.529-134.580 -21.284 1.00 12.19 C ANISOU73782 CE2 TRP N 61 1469 1432 1730 284 390 402 C ATOM 73783 CE3 TRP N 61 41.634-133.876 -20.316 1.00 12.16 C ANISOU73783 CE3 TRP N 61 1468 1428 1723 282 387 399 C ATOM 73784 CZ2 TRP N 61 39.747-133.823 -22.427 1.00 12.19 C ANISOU73784 CZ2 TRP N 61 1468 1434 1730 285 390 403 C ATOM 73785 CZ3 TRP N 61 41.846-133.127 -21.448 1.00 12.16 C ANISOU73785 CZ3 TRP N 61 1467 1429 1723 283 387 400 C ATOM 73786 CH2 TRP N 61 40.910-133.104 -22.490 1.00 12.17 C ANISOU73786 CH2 TRP N 61 1467 1432 1726 284 388 402 C ATOM 73787 N ILE N 62 40.730-135.037 -14.822 1.00 6.05 N ANISOU73787 N ILE N 62 700 652 949 280 384 395 N ATOM 73788 CA ILE N 62 41.436-135.212 -13.563 1.00 6.04 C ANISOU73788 CA ILE N 62 700 650 946 279 383 394 C ATOM 73789 C ILE N 62 40.530-135.869 -12.521 1.00 6.05 C ANISOU73789 C ILE N 62 701 650 947 279 383 394 C ATOM 73790 O ILE N 62 40.971-136.756 -11.783 1.00 6.05 O ANISOU73790 O ILE N 62 703 649 948 279 384 394 O ATOM 73791 CB ILE N 62 41.970-133.880 -13.020 1.00 6.02 C ANISOU73791 CB ILE N 62 698 649 941 278 380 394 C ATOM 73792 CG1 ILE N 62 43.050-133.328 -13.946 1.00 6.02 C ANISOU73792 CG1 ILE N 62 697 650 940 278 380 394 C ATOM 73793 CG2 ILE N 62 42.540-134.056 -11.630 1.00 6.02 C ANISOU73793 CG2 ILE N 62 699 648 939 278 379 393 C ATOM 73794 CD1 ILE N 62 43.601-131.998 -13.494 1.00 6.00 C ANISOU73794 CD1 ILE N 62 696 649 936 278 378 393 C ATOM 73795 N THR N 63 39.251-135.487 -12.493 1.00 14.36 N ANISOU73795 N THR N 63 1753 1703 2000 279 382 395 N ATOM 73796 CA THR N 63 38.347-136.106 -11.521 1.00 14.36 C ANISOU73796 CA THR N 63 1753 1703 2001 279 382 394 C ATOM 73797 C THR N 63 38.087-137.568 -11.852 1.00 14.38 C ANISOU73797 C THR N 63 1756 1703 2006 279 385 395 C ATOM 73798 O THR N 63 38.099-138.412 -10.957 1.00 14.39 O ANISOU73798 O THR N 63 1758 1703 2007 279 386 395 O ATOM 73799 CB THR N 63 36.975-135.409 -11.405 1.00 14.36 C ANISOU73799 CB THR N 63 1752 1703 2000 279 380 395 C ATOM 73800 OG1 THR N 63 36.124-135.840 -12.472 1.00 14.37 O ANISOU73800 OG1 THR N 63 1752 1705 2004 280 382 396 O ATOM 73801 CG2 THR N 63 37.119-133.918 -11.449 1.00 14.34 C ANISOU73801 CG2 THR N 63 1749 1703 1996 279 378 395 C ATOM 73802 N ARG N 64 37.855-137.872 -13.128 1.00 9.41 N ANISOU73802 N ARG N 64 1124 1072 1377 280 387 396 N ATOM 73803 CA ARG N 64 37.577-139.264 -13.489 1.00 9.43 C ANISOU73803 CA ARG N 64 1127 1073 1383 281 390 397 C ATOM 73804 C ARG N 64 38.769-140.172 -13.196 1.00 9.44 C ANISOU73804 C ARG N 64 1130 1072 1384 280 392 396 C ATOM 73805 O ARG N 64 38.603-141.339 -12.813 1.00 9.45 O ANISOU73805 O ARG N 64 1132 1072 1388 281 394 396 O ATOM 73806 CB ARG N 64 37.180-139.384 -14.957 1.00 9.45 C ANISOU73806 CB ARG N 64 1128 1075 1386 282 393 398 C ATOM 73807 CG ARG N 64 35.829-138.796 -15.293 1.00 9.45 C ANISOU73807 CG ARG N 64 1126 1077 1387 282 392 399 C ATOM 73808 CD ARG N 64 35.934-137.950 -16.540 1.00 9.45 C ANISOU73808 CD ARG N 64 1125 1079 1386 283 391 400 C ATOM 73809 NE ARG N 64 34.636-137.664 -17.142 1.00 9.46 N ANISOU73809 NE ARG N 64 1124 1081 1388 284 392 402 N ATOM 73810 CZ ARG N 64 34.156-138.297 -18.206 1.00 9.48 C ANISOU73810 CZ ARG N 64 1126 1084 1393 285 395 403 C ATOM 73811 NH1 ARG N 64 34.869-139.253 -18.780 1.00 9.50 N ANISOU73811 NH1 ARG N 64 1128 1084 1397 285 398 403 N ATOM 73812 NH2 ARG N 64 32.967-137.973 -18.698 1.00 9.49 N ANISOU73812 NH2 ARG N 64 1125 1087 1395 286 395 405 N ATOM 73813 N ILE N 65 39.973-139.636 -13.374 1.00 23.60 N ANISOU73813 N ILE N 65 2924 2867 3177 280 391 396 N ATOM 73814 CA ILE N 65 41.177-140.381 -13.027 1.00 23.61 C ANISOU73814 CA ILE N 65 2926 2866 3178 280 393 395 C ATOM 73815 C ILE N 65 41.303-140.545 -11.524 1.00 23.60 C ANISOU73815 C ILE N 65 2927 2865 3176 279 391 395 C ATOM 73816 O ILE N 65 41.715-141.597 -11.037 1.00 23.61 O ANISOU73816 O ILE N 65 2929 2865 3178 280 393 395 O ATOM 73817 CB ILE N 65 42.427-139.702 -13.590 1.00 23.60 C ANISOU73817 CB ILE N 65 2925 2866 3175 280 392 395 C ATOM 73818 CG1 ILE N 65 42.432-139.845 -15.111 1.00 23.61 C ANISOU73818 CG1 ILE N 65 2926 2867 3178 280 394 396 C ATOM 73819 CG2 ILE N 65 43.689-140.308 -12.996 1.00 23.60 C ANISOU73819 CG2 ILE N 65 2927 2865 3175 280 393 394 C ATOM 73820 CD1 ILE N 65 43.405-138.935 -15.795 1.00 23.60 C ANISOU73820 CD1 ILE N 65 2924 2867 3175 280 393 395 C ATOM 73821 N ASN N 66 40.918-139.508 -10.790 1.00 36.01 N ANISOU73821 N ASN N 66 4498 4438 4745 279 388 394 N ATOM 73822 CA ASN N 66 40.981-139.564 -9.339 1.00 36.00 C ANISOU73822 CA ASN N 66 4498 4437 4743 278 387 394 C ATOM 73823 C ASN N 66 40.047-140.651 -8.835 1.00 36.01 C ANISOU73823 C ASN N 66 4500 4438 4746 279 388 394 C ATOM 73824 O ASN N 66 40.348-141.361 -7.879 1.00 36.02 O ANISOU73824 O ASN N 66 4502 4438 4747 279 389 394 O ATOM 73825 CB ASN N 66 40.588-138.208 -8.754 1.00 35.98 C ANISOU73825 CB ASN N 66 4495 4437 4738 278 383 393 C ATOM 73826 CG ASN N 66 40.870-138.103 -7.269 1.00 35.97 C ANISOU73826 CG ASN N 66 4495 4436 4735 278 382 393 C ATOM 73827 OD1 ASN N 66 41.630-138.892 -6.706 1.00 35.98 O ANISOU73827 OD1 ASN N 66 4497 4436 4736 278 383 393 O ATOM 73828 ND2 ASN N 66 40.257-137.117 -6.626 1.00 35.95 N ANISOU73828 ND2 ASN N 66 4493 4436 4732 277 379 392 N ATOM 73829 N ALA N 67 38.930-140.804 -9.533 1.00 11.05 N ANISOU73829 N ALA N 67 1338 1276 1587 279 389 394 N ATOM 73830 CA ALA N 67 37.946-141.815 -9.196 1.00 11.07 C ANISOU73830 CA ALA N 67 1340 1276 1590 279 391 395 C ATOM 73831 C ALA N 67 38.508-143.192 -9.484 1.00 11.10 C ANISOU73831 C ALA N 67 1343 1277 1596 280 394 395 C ATOM 73832 O ALA N 67 38.466-144.092 -8.638 1.00 11.11 O ANISOU73832 O ALA N 67 1346 1277 1598 280 396 395 O ATOM 73833 CB ALA N 67 36.691-141.592 -10.019 1.00 11.08 C ANISOU73833 CB ALA N 67 1339 1277 1592 280 391 395 C ATOM 73834 N ALA N 68 39.058-143.339 -10.684 1.00 24.23 N ANISOU73834 N ALA N 68 3007 2940 3261 280 396 395 N ATOM 73835 CA ALA N 68 39.559-144.630 -11.123 1.00 24.26 C ANISOU73835 CA ALA N 68 3010 2940 3266 281 400 396 C ATOM 73836 C ALA N 68 40.705-145.108 -10.242 1.00 24.26 C ANISOU73836 C ALA N 68 3012 2940 3266 281 401 396 C ATOM 73837 O ALA N 68 40.861-146.305 -10.005 1.00 24.28 O ANISOU73837 O ALA N 68 3016 2940 3271 281 403 396 O ATOM 73838 CB ALA N 68 39.996-144.553 -12.571 1.00 24.27 C ANISOU73838 CB ALA N 68 3011 2941 3268 281 402 396 C ATOM 73839 N ALA N 69 41.497-144.167 -9.748 1.00 20.29 N ANISOU73839 N ALA N 69 2509 2439 2760 280 398 395 N ATOM 73840 CA ALA N 69 42.581-144.505 -8.842 1.00 20.29 C ANISOU73840 CA ALA N 69 2511 2439 2759 280 398 395 C ATOM 73841 C ALA N 69 42.016-144.838 -7.467 1.00 20.29 C ANISOU73841 C ALA N 69 2511 2439 2759 280 397 395 C ATOM 73842 O ALA N 69 42.484-145.758 -6.796 1.00 20.31 O ANISOU73842 O ALA N 69 2514 2439 2761 280 398 395 O ATOM 73843 CB ALA N 69 43.578-143.361 -8.751 1.00 20.27 C ANISOU73843 CB ALA N 69 2508 2438 2754 280 395 395 C ATOM 73844 N ARG N 70 40.998-144.089 -7.059 1.00 44.58 N ANISOU73844 N ARG N 70 5588 5517 5834 279 394 395 N ATOM 73845 CA ARG N 70 40.414-144.278 -5.743 1.00 44.58 C ANISOU73845 CA ARG N 70 5588 5517 5833 279 393 395 C ATOM 73846 C ARG N 70 39.815-145.664 -5.632 1.00 44.61 C ANISOU73846 C ARG N 70 5591 5517 5839 280 396 395 C ATOM 73847 O ARG N 70 39.817-146.257 -4.557 1.00 44.61 O ANISOU73847 O ARG N 70 5593 5518 5840 280 396 395 O ATOM 73848 CB ARG N 70 39.358-143.212 -5.458 1.00 44.56 C ANISOU73848 CB ARG N 70 5585 5516 5829 279 390 394 C ATOM 73849 CG ARG N 70 39.735-142.276 -4.323 1.00 44.54 C ANISOU73849 CG ARG N 70 5582 5516 5824 278 387 394 C ATOM 73850 CD ARG N 70 41.092-141.630 -4.570 1.00 44.53 C ANISOU73850 CD ARG N 70 5582 5516 5821 278 386 394 C ATOM 73851 NE ARG N 70 41.537-140.830 -3.433 1.00 44.51 N ANISOU73851 NE ARG N 70 5580 5516 5817 278 384 393 N ATOM 73852 CZ ARG N 70 41.111-139.598 -3.179 1.00 44.49 C ANISOU73852 CZ ARG N 70 5577 5515 5813 277 381 393 C ATOM 73853 NH1 ARG N 70 40.222-139.029 -3.981 1.00 44.48 N ANISOU73853 NH1 ARG N 70 5575 5514 5812 277 380 392 N ATOM 73854 NH2 ARG N 70 41.567-138.937 -2.123 1.00 44.48 N ANISOU73854 NH2 ARG N 70 5576 5515 5809 277 379 392 N ATOM 73855 N GLN N 71 39.332-146.191 -6.752 1.00 54.11 N ATOM 73856 CA GLN N 71 38.806-147.552 -6.768 1.00 54.14 C ATOM 73857 C GLN N 71 39.901-148.557 -6.430 1.00 54.16 C ATOM 73858 O GLN N 71 39.626-149.628 -5.894 1.00 54.18 O ATOM 73859 CB GLN N 71 38.194-147.890 -8.127 1.00 54.15 C ATOM 73860 CG GLN N 71 36.789-147.354 -8.343 1.00 54.14 C ATOM 73861 CD GLN N 71 36.284-147.617 -9.752 1.00 54.16 C ATOM 73862 OE1 GLN N 71 37.071-147.864 -10.670 1.00 54.17 O ATOM 73863 NE2 GLN N 71 34.965-147.571 -9.930 1.00 54.16 N