>>4WFH:HELIX    6 AA6 THR A  139  TRP A  186  1                                  48    
TDAGRLFCIFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKW
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 6 AA6 THR A 139 TRP A 186 1 48 ATOM 795 N THR A 139 56.525 -14.707 18.615 1.00110.64 N ANISOU 795 N THR A 139 11743 16288 14006 1096 1961 1301 N ATOM 796 CA THR A 139 57.774 -14.908 19.344 1.00112.37 C ANISOU 796 CA THR A 139 11614 17303 13780 1302 2002 1402 C ATOM 797 C THR A 139 58.970 -14.345 18.590 1.00116.87 C ANISOU 797 C THR A 139 11964 18370 14067 1117 1933 1272 C ATOM 798 O THR A 139 59.002 -14.352 17.355 1.00116.38 O ANISOU 798 O THR A 139 12047 18024 14145 1055 1893 1218 O ATOM 799 CB THR A 139 58.041 -16.403 19.604 1.00111.61 C ANISOU 799 CB THR A 139 11526 17266 13615 1920 2162 1708 C ATOM 800 OG1 THR A 139 58.277 -17.083 18.364 1.00104.03 O ANISOU 800 OG1 THR A 139 10713 16049 12764 2098 2193 1746 O ATOM 801 CG2 THR A 139 56.856 -17.035 20.305 1.00114.61 C ANISOU 801 CG2 THR A 139 12143 17106 14297 2106 2278 1842 C ATOM 802 N ASP A 140 59.964 -13.885 19.347 1.00122.95 N ANISOU 802 N ASP A 140 12363 19930 14420 1034 1928 1214 N ATOM 803 CA ASP A 140 61.211 -13.380 18.770 1.00124.23 C ANISOU 803 CA ASP A 140 12257 20680 14262 852 1888 1080 C ATOM 804 C ASP A 140 61.951 -14.476 18.014 1.00115.44 C ANISOU 804 C ASP A 140 11112 19725 13024 1321 1925 1289 C ATOM 805 O ASP A 140 62.568 -14.220 16.982 1.00116.58 O ANISOU 805 O ASP A 140 11225 19958 13111 1189 1881 1199 O ATOM 806 CB ASP A 140 62.125 -12.807 19.859 1.00133.92 C ANISOU 806 CB ASP A 140 13036 22820 15024 697 1897 955 C ATOM 807 CG ASP A 140 61.680 -11.434 20.346 1.00141.14 C ANISOU 807 CG ASP A 140 13953 23651 16022 83 1883 641 C ATOM 808 OD1 ASP A 140 60.743 -10.842 19.761 1.00147.05 O ANISOU 808 OD1 ASP A 140 15048 23655 17168 -212 1870 542 O ATOM 809 OD2 ASP A 140 62.284 -10.943 21.322 1.00142.81 O ANISOU 809 OD2 ASP A 140 13804 24578 15878 -92 1905 487 O ATOM 810 N ALA A 141 61.911 -15.691 18.542 1.00110.69 N ANISOU 810 N ALA A 141 10526 19158 12372 1884 2035 1579 N ATOM 811 CA ALA A 141 62.509 -16.827 17.854 1.00111.18 C ANISOU 811 CA ALA A 141 10619 19269 12355 2379 2124 1801 C ATOM 812 C ALA A 141 61.821 -17.033 16.512 1.00109.99 C ANISOU 812 C ALA A 141 10845 18317 12627 2286 2100 1733 C ATOM 813 O ALA A 141 62.472 -17.251 15.494 1.00109.59 O ANISOU 813 O ALA A 141 10779 18357 12503 2362 2084 1727 O ATOM 814 CB ALA A 141 62.397 -18.082 18.707 1.00112.40 C ANISOU 814 CB ALA A 141 10805 19454 12448 3006 2319 2142 C ATOM 815 N GLY A 142 60.496 -16.960 16.514 1.00112.92 N ANISOU 815 N GLY A 142 11531 17950 13420 2125 2094 1670 N ATOM 816 CA GLY A 142 59.731 -17.094 15.284 1.00111.37 C ANISOU 816 CA GLY A 142 11655 17055 13604 2012 2062 1568 C ATOM 817 C GLY A 142 60.216 -16.110 14.242 1.00108.62 C ANISOU 817 C GLY A 142 11237 16847 13185 1634 1921 1364 C ATOM 818 O GLY A 142 60.452 -16.479 13.093 1.00105.60 O ANISOU 818 O GLY A 142 10941 16325 12854 1728 1912 1352 O ATOM 819 N ARG A 143 60.365 -14.854 14.659 1.00107.06 N ANISOU 819 N ARG A 143 10889 16918 12870 1203 1841 1200 N ATOM 820 CA ARG A 143 60.802 -13.782 13.770 1.00106.88 C ANISOU 820 CA ARG A 143 10818 17001 12791 803 1764 1007 C ATOM 821 C ARG A 143 62.218 -14.026 13.278 1.00108.87 C ANISOU 821 C ARG A 143 10806 17872 12686 946 1768 1045 C ATOM 822 O ARG A 143 62.511 -13.926 12.086 1.00109.93 O ANISOU 822 O ARG A 143 11001 17913 12850 896 1734 997 O ATOM 823 CB ARG A 143 60.757 -12.440 14.499 1.00108.02 C ANISOU 823 CB ARG A 143 10850 17327 12863 317 1754 817 C ATOM 824 CG ARG A 143 59.367 -11.855 14.640 1.00109.83 C ANISOU 824 CG ARG A 143 11370 16901 13457 78 1743 740 C ATOM 825 CD ARG A 143 59.203 -11.083 15.938 1.00112.29 C ANISOU 825 CD ARG A 143 11565 17413 13687 -194 1778 636 C ATOM 826 NE ARG A 143 57.834 -10.585 16.066 1.00113.49 N ANISOU 826 NE ARG A 143 12007 16924 14189 -373 1777 588 N ATOM 827 CZ ARG A 143 57.240 -10.304 17.220 1.00116.95 C ANISOU 827 CZ ARG A 143 12446 17315 14672 -470 1802 561 C ATOM 828 NH1 ARG A 143 57.904 -10.445 18.365 1.00120.88 N ANISOU 828 NH1 ARG A 143 12655 18400 14874 -414 1829 566 N ATOM 829 NH2 ARG A 143 55.980 -9.883 17.228 1.00113.39 N ANISOU 829 NH2 ARG A 143 12266 16276 14540 -603 1802 531 N ATOM 830 N LEU A 144 63.107 -14.318 14.216 1.00109.52 N ANISOU 830 N LEU A 144 10570 18641 12401 1135 1811 1132 N ATOM 831 CA LEU A 144 64.502 -14.538 13.889 1.00107.02 C ANISOU 831 CA LEU A 144 9944 19031 11685 1290 1819 1172 C ATOM 832 C LEU A 144 64.620 -15.655 12.857 1.00104.16 C ANISOU 832 C LEU A 144 9755 18403 11418 1725 1852 1344 C ATOM 833 O LEU A 144 65.257 -15.496 11.819 1.00102.36 O ANISOU 833 O LEU A 144 9482 18303 11106 1659 1815 1286 O ATOM 834 CB LEU A 144 65.274 -14.895 15.157 1.00108.45 C ANISOU 834 CB LEU A 144 9755 20008 11443 1552 1875 1287 C ATOM 835 CG LEU A 144 66.755 -15.190 14.964 1.00111.38 C ANISOU 835 CG LEU A 144 9744 21242 11331 1776 1891 1349 C ATOM 836 CD1 LEU A 144 67.435 -14.038 14.240 1.00110.59 C ANISOU 836 CD1 LEU A 144 9482 21422 11113 1232 1825 1064 C ATOM 837 CD2 LEU A 144 67.399 -15.465 16.314 1.00114.92 C ANISOU 837 CD2 LEU A 144 9793 22541 11329 2043 1945 1457 C ATOM 838 N PHE A 145 63.991 -16.788 13.150 1.00104.08 N ANISOU 838 N PHE A 145 9950 18004 11591 2158 1951 1545 N ATOM 839 CA PHE A 145 64.063 -17.947 12.272 1.00103.73 C ANISOU 839 CA PHE A 145 10091 17670 11651 2581 2040 1690 C ATOM 840 C PHE A 145 63.505 -17.586 10.907 1.00101.96 C ANISOU 840 C PHE A 145 10110 16898 11730 2303 1947 1506 C ATOM 841 O PHE A 145 64.032 -17.999 9.870 1.00 99.75 O ANISOU 841 O PHE A 145 9849 16652 11400 2458 1953 1518 O ATOM 842 CB PHE A 145 63.282 -19.128 12.864 1.00101.71 C ANISOU 842 CB PHE A 145 10074 16953 11618 3005 2220 1891 C ATOM 843 CG PHE A 145 63.193 -20.302 11.943 1.00100.89 C ANISOU 843 CG PHE A 145 10218 16423 11692 3373 2363 1982 C ATOM 844 CD1 PHE A 145 64.294 -21.112 11.723 1.00101.43 C ANISOU 844 CD1 PHE A 145 10158 16916 11464 3834 2491 2178 C ATOM 845 CD2 PHE A 145 62.027 -20.562 11.253 1.00100.00 C ANISOU 845 CD2 PHE A 145 10450 15520 12023 3242 2379 1843 C ATOM 846 CE1 PHE A 145 64.222 -22.176 10.855 1.00101.19 C ANISOU 846 CE1 PHE A 145 10374 16466 11605 4153 2655 2235 C ATOM 847 CE2 PHE A 145 61.950 -21.618 10.369 1.00100.53 C ANISOU 847 CE2 PHE A 145 10733 15210 12251 3526 2529 1863 C ATOM 848 CZ PHE A 145 63.050 -22.426 10.172 1.00101.97 C ANISOU 848 CZ PHE A 145 10820 15761 12162 3977 2677 2058 C ATOM 849 N CYS A 146 62.429 -16.808 10.931 1.00102.31 N ANISOU 849 N CYS A 146 10330 16472 12068 1918 1868 1345 N ATOM 850 CA CYS A 146 61.712 -16.447 9.728 1.00101.98 C ANISOU 850 CA CYS A 146 10519 15916 12310 1691 1790 1189 C ATOM 851 C CYS A 146 62.614 -15.689 8.768 1.00106.03 C ANISOU 851 C CYS A 146 10885 16777 12622 1478 1712 1095 C ATOM 852 O CYS A 146 62.526 -15.864 7.559 1.00111.01 O ANISOU 852 O CYS A 146 11638 17186 13353 1516 1681 1046 O ATOM 853 CB CYS A 146 60.505 -15.598 10.082 1.00 98.10 C ANISOU 853 CB CYS A 146 10189 14992 12091 1333 1734 1063 C ATOM 854 SG CYS A 146 59.650 -14.995 8.629 1.00101.98 S ANISOU 854 SG CYS A 146 10910 14983 12853 1084 1643 894 S ATOM 855 N ILE A 147 63.494 -14.858 9.312 1.00112.35 N ANISOU 855 N ILE A 147 11409 18150 13125 1245 1697 1053 N ATOM 856 CA ILE A 147 64.471 -14.123 8.501 1.00113.91 C ANISOU 856 CA ILE A 147 11439 18736 13105 1019 1664 959 C ATOM 857 C ILE A 147 65.325 -15.059 7.641 1.00112.90 C ANISOU 857 C ILE A 147 11239 18846 12809 1400 1676 1071 C ATOM 858 O ILE A 147 65.374 -14.925 6.414 1.00103.36 O ANISOU 858 O ILE A 147 10129 17470 11671 1353 1639 1017 O ATOM 859 CB ILE A 147 65.401 -13.280 9.397 1.00115.63 C ANISOU 859 CB ILE A 147 11313 19636 12983 730 1689 871 C ATOM 860 CG1 ILE A 147 64.660 -12.042 9.908 1.00117.09 C ANISOU 860 CG1 ILE A 147 11594 19550 13343 232 1703 695 C ATOM 861 CG2 ILE A 147 66.653 -12.875 8.638 1.00114.63 C ANISOU 861 CG2 ILE A 147 10950 20039 12563 603 1693 805 C ATOM 862 CD1 ILE A 147 65.266 -11.436 11.157 1.00120.34 C ANISOU 862 CD1 ILE A 147 11692 20560 13470 -20 1751 582 C ATOM 863 N PHE A 148 65.996 -16.005 8.292 1.00113.98 N ANISOU 863 N PHE A 148 11205 19391 12708 1808 1744 1241 N ATOM 864 CA PHE A 148 66.894 -16.912 7.588 1.00113.48 C ANISOU 864 CA PHE A 148 11062 19606 12447 2212 1789 1370 C ATOM 865 C PHE A 148 66.102 -17.852 6.704 1.00105.51 C ANISOU 865 C PHE A 148 10396 17925 11768 2476 1830 1400 C ATOM 866 O PHE A 148 66.574 -18.256 5.642 1.00107.48 O ANISOU 866 O PHE A 148 10667 18204 11965 2637 1833 1405 O ATOM 867 CB PHE A 148 67.744 -17.717 8.572 1.00120.00 C ANISOU 867 CB PHE A 148 11634 21037 12923 2651 1893 1584 C ATOM 868 CG PHE A 148 68.576 -16.866 9.486 1.00131.73 C ANISOU 868 CG PHE A 148 12714 23311 14024 2401 1856 1517 C ATOM 869 CD1 PHE A 148 69.547 -16.013 8.968 1.00134.30 C ANISOU 869 CD1 PHE A 148 12772 24169 14086 2075 1794 1363 C ATOM 870 CD2 PHE A 148 68.395 -16.916 10.866 1.00138.01 C ANISOU 870 CD2 PHE A 148 13380 24346 14711 2475 1900 1585 C ATOM 871 CE1 PHE A 148 70.316 -15.223 9.806 1.00135.63 C ANISOU 871 CE1 PHE A 148 12543 25095 13895 1786 1785 1238 C ATOM 872 CE2 PHE A 148 69.163 -16.132 11.711 1.00140.87 C ANISOU 872 CE2 PHE A 148 13332 25499 14691 2218 1871 1471 C ATOM 873 CZ PHE A 148 70.122 -15.281 11.179 1.00141.42 C ANISOU 873 CZ PHE A 148 13129 26096 14506 1852 1818 1277 C ATOM 874 N TYR A 149 64.910 -18.225 7.159 1.00126.12 N ANISOU 874 N TYR A 149 15922 19097 12898 773 1739 872 N ATOM 875 CA TYR A 149 64.078 -19.148 6.408 1.00120.54 C ANISOU 875 CA TYR A 149 15572 17769 12458 1286 1787 640 C ATOM 876 C TYR A 149 63.745 -18.534 5.060 1.00117.65 C ANISOU 876 C TYR A 149 15251 17324 12125 1024 1697 599 C ATOM 877 O TYR A 149 63.703 -19.222 4.045 1.00116.94 O ANISOU 877 O TYR A 149 15223 17246 11962 1459 1740 506 O ATOM 878 CB TYR A 149 62.799 -19.490 7.185 1.00116.04 C ANISOU 878 CB TYR A 149 15474 16199 12414 1296 1791 433 C ATOM 879 CG TYR A 149 61.981 -20.579 6.539 1.00114.23 C ANISOU 879 CG TYR A 149 15638 15381 12380 1771 1846 200 C ATOM 880 CD1 TYR A 149 62.280 -21.911 6.755 1.00115.47 C ANISOU 880 CD1 TYR A 149 15960 15546 12367 2438 1976 144 C ATOM 881 CD2 TYR A 149 60.926 -20.270 5.683 1.00112.18 C ANISOU 881 CD2 TYR A 149 15628 14581 12413 1548 1767 44 C ATOM 882 CE1 TYR A 149 61.553 -22.911 6.139 1.00116.22 C ANISOU 882 CE1 TYR A 149 16517 15072 12567 2799 2019 -66 C ATOM 883 CE2 TYR A 149 60.189 -21.261 5.066 1.00112.19 C ANISOU 883 CE2 TYR A 149 15992 14095 12537 1894 1808 -161 C ATOM 884 CZ TYR A 149 60.508 -22.578 5.294 1.00114.49 C ANISOU 884 CZ TYR A 149 16500 14355 12645 2483 1931 -218 C ATOM 885 OH TYR A 149 59.775 -23.559 4.670 1.00115.65 O ANISOU 885 OH TYR A 149 17112 13976 12854 2750 1963 -423 O ATOM 886 N ALA A 150 63.541 -17.225 5.053 1.00115.93 N ANISOU 886 N ALA A 150 15050 17022 11974 323 1573 675 N ATOM 887 CA ALA A 150 63.137 -16.531 3.842 1.00116.22 C ANISOU 887 CA ALA A 150 15199 16906 12051 44 1480 638 C ATOM 888 C ALA A 150 64.332 -16.293 2.928 1.00120.13 C ANISOU 888 C ALA A 150 15267 18355 12020 -21 1474 828 C ATOM 889 O ALA A 150 64.269 -16.589 1.731 1.00121.10 O ANISOU 889 O ALA A 150 15382 18543 12089 230 1480 762 O ATOM 890 CB ALA A 150 62.462 -15.212 4.188 1.00114.66 C ANISOU 890 CB ALA A 150 15293 16219 12052 -621 1354 652 C ATOM 891 N LEU A 151 65.418 -15.759 3.490 1.00121.96 N ANISOU 891 N LEU A 151 15131 19376 11832 -388 1459 1070 N ATOM 892 CA LEU A 151 66.632 -15.472 2.713 1.00124.04 C ANISOU 892 CA LEU A 151 14906 20720 11503 -541 1448 1287 C ATOM 893 C LEU A 151 67.046 -16.689 1.896 1.00124.63 C ANISOU 893 C LEU A 151 14747 21225 11379 301 1566 1237 C ATOM 894 O LEU A 151 67.378 -16.571 0.722 1.00124.90 O ANISOU 894 O LEU A 151 14615 21671 11170 325 1546 1279 O ATOM 895 CB LEU A 151 67.778 -15.049 3.637 1.00127.22 C ANISOU 895 CB LEU A 151 14875 22037 11424 -943 1445 1552 C ATOM 896 CG LEU A 151 67.629 -13.656 4.250 1.00126.77 C ANISOU 896 CG LEU A 151 15069 21731 11367 -1920 1309 1656 C ATOM 897 CD1 LEU A 151 68.731 -13.359 5.257 1.00130.01 C ANISOU 897 CD1 LEU A 151 15063 23046 11289 -2330 1309 1906 C ATOM 898 CD2 LEU A 151 67.600 -12.607 3.148 1.00127.49 C ANISOU 898 CD2 LEU A 151 15316 21839 11284 -2529 1187 1718 C ATOM 899 N VAL A 152 66.992 -17.860 2.523 1.00123.81 N ANISOU 899 N VAL A 152 14707 20969 11363 1009 1689 1141 N ATOM 900 CA VAL A 152 67.321 -19.117 1.859 1.00124.99 C ANISOU 900 CA VAL A 152 14807 21389 11293 1910 1813 1075 C ATOM 901 C VAL A 152 66.140 -19.666 1.042 1.00121.93 C ANISOU 901 C VAL A 152 14968 20009 11348 2200 1812 793 C ATOM 902 O VAL A 152 66.338 -20.269 -0.010 1.00123.37 O ANISOU 902 O VAL A 152 15154 20392 11327 2687 1858 746 O ATOM 903 CB VAL A 152 67.753 -20.176 2.894 1.00126.10 C ANISOU 903 CB VAL A 152 14913 21724 11273 2580 1950 1090 C ATOM 904 CG1 VAL A 152 67.981 -21.521 2.223 1.00128.34 C ANISOU 904 CG1 VAL A 152 15347 22112 11304 3585 2082 997 C ATOM 905 CG2 VAL A 152 68.999 -19.718 3.638 1.00129.48 C ANISOU 905 CG2 VAL A 152 14717 23301 11177 2349 1959 1382 C ATOM 906 N GLY A 153 64.917 -19.452 1.525 1.00117.69 N ANISOU 906 N GLY A 153 14880 18461 11373 1896 1757 615 N ATOM 907 CA GLY A 153 63.733 -20.078 0.940 1.00114.93 C ANISOU 907 CA GLY A 153 15037 17216 11414 2143 1760 348 C ATOM 908 C GLY A 153 63.269 -19.445 -0.356 1.00113.72 C ANISOU 908 C GLY A 153 14935 16918 11354 1850 1665 291 C ATOM 909 O GLY A 153 62.847 -20.138 -1.280 1.00113.36 O ANISOU 909 O GLY A 153 15123 16595 11353 2217 1691 135 O ATOM 910 N ILE A 154 63.312 -18.119 -0.414 1.00113.31 N ANISOU 910 N ILE A 154 14732 17006 11312 1172 1551 414 N ATOM 911 CA ILE A 154 62.747 -17.383 -1.546 1.00112.52 C ANISOU 911 CA ILE A 154 14755 16669 11326 851 1450 359 C ATOM 912 C ILE A 154 63.511 -17.649 -2.831 1.00115.17 C ANISOU 912 C ILE A 154 14828 17650 11280 1122 1474 423 C ATOM 913 O ILE A 154 62.900 -17.955 -3.854 1.00114.31 O ANISOU 913 O ILE A 154 14923 17199 11307 1319 1463 268 O ATOM 914 CB ILE A 154 62.701 -15.859 -1.288 1.00111.88 C ANISOU 914 CB ILE A 154 14686 16576 11246 73 1324 496 C ATOM 915 CG1 ILE A 154 61.743 -15.549 -0.132 1.00108.85 C ANISOU 915 CG1 ILE A 154 14639 15452 11264 -140 1293 404 C ATOM 916 CG2 ILE A 154 62.260 -15.122 -2.547 1.00111.06 C ANISOU 916 CG2 ILE A 154 14722 16312 11164 -184 1230 461 C ATOM 917 CD1 ILE A 154 61.872 -14.149 0.424 1.00108.62 C ANISOU 917 CD1 ILE A 154 14704 15424 11140 -835 1189 561 C ATOM 918 N PRO A 155 64.848 -17.512 -2.792 1.00118.72 N ANISOU 918 N PRO A 155 14797 19097 11214 1117 1505 660 N ATOM 919 CA PRO A 155 65.608 -17.789 -4.003 1.00121.61 C ANISOU 919 CA PRO A 155 14868 20173 11164 1424 1535 734 C ATOM 920 C PRO A 155 65.476 -19.251 -4.415 1.00122.22 C ANISOU 920 C PRO A 155 15144 20069 11224 2320 1657 564 C ATOM 921 O PRO A 155 65.344 -19.549 -5.600 1.00122.28 O ANISOU 921 O PRO A 155 15232 20058 11169 2580 1658 479 O ATOM 922 CB PRO A 155 67.045 -17.451 -3.606 1.00125.72 C ANISOU 922 CB PRO A 155 14792 21885 11091 1264 1556 1033 C ATOM 923 CG PRO A 155 67.082 -17.593 -2.127 1.00125.03 C ANISOU 923 CG PRO A 155 14724 21672 11108 1230 1594 1064 C ATOM 924 CD PRO A 155 65.721 -17.194 -1.648 1.00120.34 C ANISOU 924 CD PRO A 155 14678 19897 11150 877 1522 869 C ATOM 925 N LEU A 156 65.490 -20.151 -3.436 1.00122.56 N ANISOU 925 N LEU A 156 15335 19930 11301 2776 1755 510 N ATOM 926 CA LEU A 156 65.283 -21.565 -3.707 1.00123.98 C ANISOU 926 CA LEU A 156 15891 19778 11435 3599 1870 335 C ATOM 927 C LEU A 156 63.966 -21.757 -4.443 1.00122.31 C ANISOU 927 C LEU A 156 16206 18599 11667 3501 1815 72 C ATOM 928 O LEU A 156 63.886 -22.530 -5.397 1.00124.21 O ANISOU 928 O LEU A 156 16685 18740 11767 3977 1859 -43 O ATOM 929 CB LEU A 156 65.273 -22.370 -2.407 1.00123.61 C ANISOU 929 CB LEU A 156 16062 19473 11430 3963 1966 299 C ATOM 930 CG LEU A 156 64.712 -23.789 -2.525 1.00123.74 C ANISOU 930 CG LEU A 156 16729 18795 11490 4653 2064 70 C ATOM 931 CD1 LEU A 156 65.555 -24.621 -3.476 1.00128.13 C ANISOU 931 CD1 LEU A 156 17278 19922 11482 5461 2162 107 C ATOM 932 CD2 LEU A 156 64.619 -24.453 -1.160 1.00123.45 C ANISOU 932 CD2 LEU A 156 16956 18427 11522 4893 2145 40 C ATOM 933 N PHE A 157 62.932 -21.052 -3.997 1.00120.18 N ANISOU 933 N PHE A 157 16117 17658 11887 2895 1720 -16 N ATOM 934 CA PHE A 157 61.615 -21.167 -4.615 1.00119.21 C ANISOU 934 CA PHE A 157 16422 16715 12156 2755 1661 -252 C ATOM 935 C PHE A 157 61.605 -20.537 -6.001 1.00120.49 C ANISOU 935 C PHE A 157 16442 17094 12245 2567 1584 -238 C ATOM 936 O PHE A 157 61.015 -21.087 -6.934 1.00121.20 O ANISOU 936 O PHE A 157 16814 16838 12398 2777 1583 -409 O ATOM 937 CB PHE A 157 60.539 -20.508 -3.748 1.00116.04 C ANISOU 937 CB PHE A 157 16187 15676 12224 2215 1583 -325 C ATOM 938 CG PHE A 157 59.141 -20.663 -4.298 1.00114.21 C ANISOU 938 CG PHE A 157 16331 14722 12340 2083 1526 -557 C ATOM 939 CD1 PHE A 157 58.442 -21.852 -4.142 1.00113.94 C ANISOU 939 CD1 PHE A 157 16728 14152 12408 2367 1585 -758 C ATOM 940 CD2 PHE A 157 58.537 -19.630 -4.998 1.00112.91 C ANISOU 940 CD2 PHE A 157 16111 14454 12336 1667 1413 -566 C ATOM 941 CE1 PHE A 157 57.165 -22.004 -4.666 1.00111.87 C ANISOU 941 CE1 PHE A 157 16760 13346 12396 2176 1526 -957 C ATOM 942 CE2 PHE A 157 57.262 -19.777 -5.522 1.00110.98 C ANISOU 942 CE2 PHE A 157 16145 13671 12352 1574 1363 -766 C ATOM 943 CZ PHE A 157 56.578 -20.967 -5.361 1.00110.21 C ANISOU 943 CZ PHE A 157 16400 13127 12345 1800 1417 -959 C ATOM 944 N GLY A 158 62.249 -19.380 -6.125 1.00121.88 N ANISOU 944 N GLY A 158 16217 17831 12259 2129 1515 -32 N ATOM 945 CA GLY A 158 62.366 -18.695 -7.407 1.00123.63 C ANISOU 945 CA GLY A 158 16292 18327 12354 1911 1440 14 C ATOM 946 C GLY A 158 62.911 -19.617 -8.478 1.00128.08 C ANISOU 946 C GLY A 158 16804 19272 12586 2521 1517 -18 C ATOM 947 O GLY A 158 62.403 -19.642 -9.598 1.00126.94 O ANISOU 947 O GLY A 158 16813 18899 12517 2550 1477 -135 O ATOM 948 N ILE A 159 63.933 -20.394 -8.117 1.00134.06 N ANISOU 948 N ILE A 159 17369 20621 12945 3057 1630 85 N ATOM 949 CA ILE A 159 64.517 -21.403 -9.016 1.00138.99 C ANISOU 949 CA ILE A 159 18013 21626 13169 3800 1724 58 C ATOM 950 C ILE A 159 63.471 -22.417 -9.485 1.00138.05 C ANISOU 950 C ILE A 159 18544 20610 13300 4153 1751 -231 C ATOM 951 O ILE A 159 63.322 -22.659 -10.680 1.00135.94 O ANISOU 951 O ILE A 159 18401 20309 12939 4343 1739 -318 O ATOM 952 CB ILE A 159 65.670 -22.183 -8.335 1.00142.42 C ANISOU 952 CB ILE A 159 18231 22771 13111 4449 1858 204 C ATOM 953 CG1 ILE A 159 66.824 -21.246 -7.958 1.00144.83 C ANISOU 953 CG1 ILE A 159 17819 24164 13043 4081 1833 514 C ATOM 954 CG2 ILE A 159 66.175 -23.294 -9.242 1.00145.08 C ANISOU 954 CG2 ILE A 159 18721 23403 12997 5338 1965 157 C ATOM 955 CD1 ILE A 159 67.330 -20.390 -9.098 1.00147.01 C ANISOU 955 CD1 ILE A 159 17677 25125 13053 3722 1757 659 C ATOM 956 N LEU A 160 62.752 -23.010 -8.536 1.00138.25 N ANISOU 956 N LEU A 160 18992 19928 13607 4196 1782 -376 N ATOM 957 CA LEU A 160 61.715 -23.982 -8.865 1.00138.03 C ANISOU 957 CA LEU A 160 19627 19049 13769 4397 1798 -645 C ATOM 958 C LEU A 160 60.651 -23.347 -9.740 1.00136.02 C ANISOU 958 C LEU A 160 19445 18372 13865 3876 1677 -776 C ATOM 959 O LEU A 160 60.061 -24.012 -10.587 1.00132.26 O ANISOU 959 O LEU A 160 19370 17498 13385 4044 1676 -958 O ATOM 960 CB LEU A 160 61.053 -24.524 -7.597 1.00136.62 C ANISOU 960 CB LEU A 160 19838 18220 13848 4341 1832 -755 C ATOM 961 CG LEU A 160 59.955 -25.556 -7.903 1.00135.72 C ANISOU 961 CG LEU A 160 20451 17251 13864 4430 1841 -1028 C ATOM 962 CD1 LEU A 160 59.963 -26.697 -6.899 1.00137.51 C ANISOU 962 CD1 LEU A 160 21198 17082 13966 4817 1947 -1099 C ATOM 963 CD2 LEU A 160 58.586 -24.906 -7.948 1.00131.52 C ANISOU 963 CD2 LEU A 160 19962 16181 13827 3723 1718 -1160 C ATOM 964 N LEU A 161 60.385 -22.067 -9.490 1.00138.08 N ANISOU 964 N LEU A 161 19368 18701 14392 3252 1575 -681 N ATOM 965 CA LEU A 161 59.322 -21.348 -10.175 1.00139.35 C ANISOU 965 CA LEU A 161 19597 18476 14872 2783 1459 -788 C ATOM 966 C LEU A 161 59.705 -21.097 -11.628 1.00140.79 C ANISOU 966 C LEU A 161 19615 19049 14828 2873 1429 -755 C ATOM 967 O LEU A 161 58.928 -21.371 -12.537 1.00136.77 O ANISOU 967 O LEU A 161 19358 18187 14421 2881 1392 -924 O ATOM 968 CB LEU A 161 59.038 -20.020 -9.474 1.00140.54 C ANISOU 968 CB LEU A 161 19520 18603 15274 2186 1368 -675 C ATOM 969 CG LEU A 161 57.691 -19.374 -9.809 1.00139.27 C ANISOU 969 CG LEU A 161 19531 17919 15465 1786 1262 -807 C ATOM 970 CD1 LEU A 161 56.523 -20.237 -9.349 1.00135.95 C ANISOU 970 CD1 LEU A 161 19488 16862 15302 1836 1279 -1029 C ATOM 971 CD2 LEU A 161 57.613 -17.984 -9.194 1.00136.97 C ANISOU 971 CD2 LEU A 161 19083 17661 15295 1294 1179 -663 C ATOM 972 N ALA A 162 60.908 -20.575 -11.839 1.00144.86 N ANISOU 972 N ALA A 162 19690 20344 15006 2909 1441 -530 N ATOM 973 CA ALA A 162 61.480 -20.489 -13.179 1.00151.83 C ANISOU 973 CA ALA A 162 20381 21725 15580 3085 1434 -474 C ATOM 974 C ALA A 162 61.353 -21.839 -13.891 1.00153.99 C ANISOU 974 C ALA A 162 21040 21776 15691 3726 1514 -655 C ATOM 975 O ALA A 162 60.923 -21.914 -15.042 1.00149.19 O ANISOU 975 O ALA A 162 20573 21016 15096 3751 1475 -767 O ATOM 976 CB ALA A 162 62.943 -20.073 -13.102 1.00156.35 C ANISOU 976 CB ALA A 162 20414 23304 15688 3141 1468 -195 C ATOM 977 N GLY A 163 61.741 -22.901 -13.192 1.00156.84 N ANISOU 977 N GLY A 163 21627 22103 15861 4253 1627 -680 N ATOM 978 CA GLY A 163 61.657 -24.252 -13.730 1.00159.38 C ANISOU 978 CA GLY A 163 22479 22128 15947 4897 1712 -850 C ATOM 979 C GLY A 163 60.250 -24.611 -14.159 1.00156.74 C ANISOU 979 C GLY A 163 22686 20911 15956 4625 1649 -1118 C ATOM 980 O GLY A 163 60.032 -25.052 -15.284 1.00160.08 O ANISOU 980 O GLY A 163 23366 21212 16243 4819 1642 -1236 O ATOM 981 N VAL A 164 59.290 -24.418 -13.262 1.00152.86 N ANISOU 981 N VAL A 164 22345 19860 15874 4161 1602 -1206 N ATOM 982 CA VAL A 164 57.898 -24.741 -13.559 1.00150.09 C ANISOU 982 CA VAL A 164 22437 18785 15805 3834 1537 -1445 C ATOM 983 C VAL A 164 57.341 -23.788 -14.614 1.00149.54 C ANISOU 983 C VAL A 164 22095 18804 15917 3427 1422 -1461 C ATOM 984 O VAL A 164 56.507 -24.175 -15.429 1.00145.65 O ANISOU 984 O VAL A 164 21911 17964 15465 3335 1379 -1641 O ATOM 985 CB VAL A 164 57.016 -24.671 -12.299 1.00146.28 C ANISOU 985 CB VAL A 164 22083 17816 15678 3427 1513 -1509 C ATOM 986 CG1 VAL A 164 55.564 -24.965 -12.651 1.00142.96 C ANISOU 986 CG1 VAL A 164 22029 16809 15477 3038 1440 -1736 C ATOM 987 CG2 VAL A 164 57.526 -25.637 -11.236 1.00147.90 C ANISOU 987 CG2 VAL A 164 22608 17886 15699 3826 1628 -1498 C ATOM 988 N GLY A 165 57.809 -22.542 -14.592 1.00152.80 N ANISOU 988 N GLY A 165 21971 19685 16398 3166 1369 -1269 N ATOM 989 CA GLY A 165 57.430 -21.555 -15.600 1.00155.39 C ANISOU 989 CA GLY A 165 22069 20138 16832 2832 1265 -1252 C ATOM 990 C GLY A 165 57.819 -21.984 -17.003 1.00160.90 C ANISOU 990 C GLY A 165 22815 21078 17242 3165 1280 -1292 C ATOM 991 O GLY A 165 57.017 -21.889 -17.929 1.00159.00 O ANISOU 991 O GLY A 165 22696 20610 17105 3004 1212 -1423 O ATOM 992 N ASP A 166 59.050 -22.462 -17.160 1.00167.39 N ANISOU 992 N ASP A 166 23524 22409 17665 3663 1371 -1174 N ATOM 993 CA ASP A 166 59.528 -22.956 -18.451 1.00170.57 C ANISOU 993 CA ASP A 166 23986 23094 17727 4085 1401 -1201 C ATOM 994 C ASP A 166 58.784 -24.232 -18.864 1.00169.90 C ANISOU 994 C ASP A 166 24578 22377 17598 4361 1433 -1461 C ATOM 995 O ASP A 166 58.409 -24.385 -20.022 1.00166.19 O ANISOU 995 O ASP A 166 24264 21809 17072 4380 1394 -1574 O ATOM 996 CB ASP A 166 61.039 -23.219 -18.406 1.00177.53 C ANISOU 996 CB ASP A 166 24571 24766 18114 4634 1504 -998 C ATOM 997 CG ASP A 166 61.862 -21.938 -18.309 1.00177.96 C ANISOU 997 CG ASP A 166 23946 25583 18087 4271 1458 -727 C ATOM 998 OD1 ASP A 166 61.315 -20.846 -18.576 1.00174.94 O ANISOU 998 OD1 ASP A 166 23405 25081 17982 3665 1346 -705 O ATOM 999 OD2 ASP A 166 63.064 -22.027 -17.976 1.00180.66 O ANISOU 999 OD2 ASP A 166 23940 26672 18028 4590 1533 -529 O ATOM 1000 N ARG A 167 58.563 -25.133 -17.910 1.00172.14 N ANISOU 1000 N ARG A 167 25302 22222 17880 4529 1500 -1555 N ATOM 1001 CA ARG A 167 57.890 -26.412 -18.175 1.00174.86 C ANISOU 1001 CA ARG A 167 26421 21915 18103 4722 1531 -1796 C ATOM 1002 C ARG A 167 56.403 -26.216 -18.473 1.00171.91 C ANISOU 1002 C ARG A 167 26224 21008 18086 4079 1417 -1986 C ATOM 1003 O ARG A 167 55.841 -26.898 -19.326 1.00168.01 O ANISOU 1003 O ARG A 167 26195 20183 17457 4087 1397 -2165 O ATOM 1004 CB ARG A 167 58.061 -27.350 -16.974 1.00176.45 C ANISOU 1004 CB ARG A 167 27076 21785 18180 5013 1630 -1825 C ATOM 1005 CG ARG A 167 57.545 -28.770 -17.161 1.00177.96 C ANISOU 1005 CG ARG A 167 28219 21283 18114 5247 1677 -2053 C ATOM 1006 CD ARG A 167 58.516 -29.652 -17.936 1.00181.09 C ANISOU 1006 CD ARG A 167 29009 21876 17921 6094 1780 -2045 C ATOM 1007 NE ARG A 167 58.424 -31.053 -17.510 1.00186.52 N ANISOU 1007 NE ARG A 167 30691 21927 18251 6498 1872 -2189 N ATOM 1008 CZ ARG A 167 58.055 -32.071 -18.289 1.00190.94 C ANISOU 1008 CZ ARG A 167 32128 21950 18468 6685 1885 -2383 C ATOM 1009 NH1 ARG A 167 57.754 -31.875 -19.568 1.00190.62 N ANISOU 1009 NH1 ARG A 167 32039 21973 18412 6537 1814 -2460 N ATOM 1010 NH2 ARG A 167 58.007 -33.301 -17.791 1.00194.06 N ANISOU 1010 NH2 ARG A 167 33517 21723 18493 7025 1968 -2498 N ATOM 1011 N LEU A 168 55.769 -25.283 -17.769 1.00173.67 N ANISOU 1011 N LEU A 168 26081 21192 18712 3537 1343 -1940 N ATOM 1012 CA LEU A 168 54.355 -24.981 -17.992 1.00172.31 C ANISOU 1012 CA LEU A 168 25962 20671 18834 2968 1235 -2090 C ATOM 1013 C LEU A 168 54.158 -24.263 -19.321 1.00172.09 C ANISOU 1013 C LEU A 168 25652 20910 18822 2846 1153 -2088 C ATOM 1014 O LEU A 168 53.243 -24.581 -20.076 1.00167.27 O ANISOU 1014 O LEU A 168 25279 20063 18211 2638 1095 -2257 O ATOM 1015 CB LEU A 168 53.802 -24.105 -16.868 1.00170.56 C ANISOU 1015 CB LEU A 168 25417 20407 18981 2537 1186 -2018 C ATOM 1016 CG LEU A 168 52.369 -23.611 -17.096 1.00169.67 C ANISOU 1016 CG LEU A 168 25234 20111 19121 2019 1075 -2135 C ATOM 1017 CD1 LEU A 168 51.389 -24.774 -17.097 1.00170.04 C ANISOU 1017 CD1 LEU A 168 25818 19704 19082 1829 1072 -2359 C ATOM 1018 CD2 LEU A 168 51.976 -22.572 -16.059 1.00170.34 C ANISOU 1018 CD2 LEU A 168 24969 20243 19509 1715 1032 -2028 C ATOM 1019 N GLY A 169 55.012 -23.275 -19.583 1.00175.08 N ANISOU 1019 N GLY A 169 25529 21806 19185 2930 1144 -1888 N ATOM 1020 CA GLY A 169 55.012 -22.553 -20.849 1.00176.88 C ANISOU 1020 CA GLY A 169 25495 22329 19381 2856 1075 -1855 C ATOM 1021 C GLY A 169 55.281 -23.478 -22.021 1.00181.89 C ANISOU 1021 C GLY A 169 26441 22971 19695 3235 1111 -1966 C ATOM 1022 O GLY A 169 54.654 -23.354 -23.071 1.00189.00 O ANISOU 1022 O GLY A 169 27380 23819 20612 3084 1043 -2069 O ATOM 1023 N SER A 170 56.222 -24.403 -21.843 1.00179.91 N ANISOU 1023 N SER A 170 26435 22804 19116 3769 1221 -1941 N ATOM 1024 CA SER A 170 56.484 -25.447 -22.831 1.00177.18 C ANISOU 1024 CA SER A 170 26543 22380 18396 4226 1271 -2060 C ATOM 1025 C SER A 170 55.213 -26.228 -23.157 1.00174.64 C ANISOU 1025 C SER A 170 26821 21407 18124 3938 1222 -2324 C ATOM 1026 O SER A 170 54.843 -26.347 -24.318 1.00173.58 O ANISOU 1026 O SER A 170 26816 21240 17893 3894 1174 -2431 O ATOM 1027 CB SER A 170 57.564 -26.405 -22.321 1.00179.69 C ANISOU 1027 CB SER A 170 27152 22806 18315 4909 1409 -2001 C ATOM 1028 OG SER A 170 57.461 -27.666 -22.956 1.00182.02 O ANISOU 1028 OG SER A 170 28193 22714 18251 5311 1459 -2181 O ATOM 1029 N SER A 171 54.551 -26.752 -22.128 1.00175.58 N ANISOU 1029 N SER A 171 27295 21050 18366 3696 1231 -2423 N ATOM 1030 CA SER A 171 53.303 -27.503 -22.305 1.00176.22 C ANISOU 1030 CA SER A 171 27940 20570 18443 3291 1178 -2661 C ATOM 1031 C SER A 171 52.242 -26.678 -23.029 1.00175.28 C ANISOU 1031 C SER A 171 27449 20569 18581 2744 1049 -2718 C ATOM 1032 O SER A 171 51.568 -27.171 -23.932 1.00172.13 O ANISOU 1032 O SER A 171 27382 19987 18032 2560 998 -2884 O ATOM 1033 CB SER A 171 52.739 -27.939 -20.945 1.00174.03 C ANISOU 1033 CB SER A 171 27943 19881 18296 3004 1196 -2715 C ATOM 1034 OG SER A 171 53.628 -28.802 -20.265 1.00176.39 O ANISOU 1034 OG SER A 171 28684 20015 18318 3531 1318 -2679 O ATOM 1035 N LEU A 172 52.075 -25.432 -22.597 1.00177.56 N ANISOU 1035 N LEU A 172 27094 21157 19213 2491 995 -2580 N ATOM 1036 CA LEU A 172 51.094 -24.532 -23.199 1.00175.09 C ANISOU 1036 CA LEU A 172 26413 21003 19110 2070 880 -2608 C ATOM 1037 C LEU A 172 51.459 -24.227 -24.647 1.00174.77 C ANISOU 1037 C LEU A 172 26231 21252 18922 2263 851 -2593 C ATOM 1038 O LEU A 172 50.642 -24.415 -25.543 1.00174.36 O ANISOU 1038 O LEU A 172 26301 21140 18806 2046 784 -2735 O ATOM 1039 CB LEU A 172 50.993 -23.224 -22.404 1.00172.07 C ANISOU 1039 CB LEU A 172 25483 20846 19049 1875 842 -2442 C ATOM 1040 CG LEU A 172 50.204 -23.240 -21.091 1.00171.41 C ANISOU 1040 CG LEU A 172 25424 20530 19174 1555 832 -2471 C ATOM 1041 CD1 LEU A 172 50.141 -21.837 -20.501 1.00169.51 C ANISOU 1041 CD1 LEU A 172 24695 20518 19193 1428 789 -2302 C ATOM 1042 CD2 LEU A 172 48.802 -23.796 -21.298 1.00172.27 C ANISOU 1042 CD2 LEU A 172 25755 20446 19250 1139 767 -2671 C ATOM 1043 N ARG A 173 52.689 -23.765 -24.865 1.00175.62 N ANISOU 1043 N ARG A 173 26061 21722 18943 2644 901 -2415 N ATOM 1044 CA ARG A 173 53.157 -23.398 -26.200 1.00176.87 C ANISOU 1044 CA ARG A 173 26033 22223 18945 2836 879 -2371 C ATOM 1045 C ARG A 173 53.101 -24.605 -27.144 1.00183.47 C ANISOU 1045 C ARG A 173 27409 22840 19458 3076 905 -2552 C ATOM 1046 O ARG A 173 52.780 -24.455 -28.321 1.00187.49 O ANISOU 1046 O ARG A 173 27885 23452 19899 3019 847 -2618 O ATOM 1047 CB ARG A 173 54.572 -22.799 -26.145 1.00178.72 C ANISOU 1047 CB ARG A 173 25878 22966 19060 3167 935 -2130 C ATOM 1048 CG ARG A 173 54.602 -21.311 -25.800 1.00181.07 C ANISOU 1048 CG ARG A 173 25657 23544 19597 2836 872 -1943 C ATOM 1049 CD ARG A 173 55.855 -20.900 -25.035 1.00192.71 C ANISOU 1049 CD ARG A 173 26835 25414 20970 2986 935 -1710 C ATOM 1050 NE ARG A 173 55.739 -19.554 -24.462 1.00201.24 N ANISOU 1050 NE ARG A 173 27591 26604 22264 2576 870 -1553 N ATOM 1051 CZ ARG A 173 56.460 -19.096 -23.438 1.00198.87 C ANISOU 1051 CZ ARG A 173 27089 26511 21959 2503 901 -1374 C ATOM 1052 NH1 ARG A 173 57.369 -19.868 -22.852 1.00205.32 N ANISOU 1052 NH1 ARG A 173 27916 27518 22575 2846 1001 -1318 N ATOM 1053 NH2 ARG A 173 56.274 -17.857 -22.994 1.00185.84 N ANISOU 1053 NH2 ARG A 173 25266 24881 20461 2102 832 -1246 N ATOM 1054 N HIS A 174 53.366 -25.800 -26.614 1.00186.73 N ANISOU 1054 N HIS A 174 28386 22913 19648 3337 989 -2639 N ATOM 1055 CA HIS A 174 53.292 -27.039 -27.396 1.00190.32 C ANISOU 1055 CA HIS A 174 29546 23041 19725 3568 1018 -2823 C ATOM 1056 C HIS A 174 51.857 -27.338 -27.839 1.00191.39 C ANISOU 1056 C HIS A 174 29973 22829 19915 2975 917 -3038 C ATOM 1057 O HIS A 174 51.617 -27.687 -28.993 1.00193.30 O ANISOU 1057 O HIS A 174 30462 23034 19947 2979 880 -3154 O ATOM 1058 CB HIS A 174 53.843 -28.222 -26.586 1.00192.86 C ANISOU 1058 CB HIS A 174 30519 23004 19753 3980 1133 -2860 C ATOM 1059 CG HIS A 174 53.665 -29.552 -27.252 1.00197.77 C ANISOU 1059 CG HIS A 174 32065 23148 19932 4178 1161 -3064 C ATOM 1060 ND1 HIS A 174 52.463 -30.227 -27.260 1.00197.84 N ANISOU 1060 ND1 HIS A 174 32660 22610 19899 3612 1095 -3281 N ATOM 1061 CD2 HIS A 174 54.543 -30.339 -27.917 1.00200.89 C ANISOU 1061 CD2 HIS A 174 32948 23536 19845 4875 1247 -3078 C ATOM 1062 CE1 HIS A 174 52.605 -31.368 -27.911 1.00200.72 C ANISOU 1062 CE1 HIS A 174 33901 22583 19778 3900 1135 -3427 C ATOM 1063 NE2 HIS A 174 53.858 -31.461 -28.318 1.00202.78 N ANISOU 1063 NE2 HIS A 174 34137 23142 19768 4718 1231 -3311 N ATOM 1064 N GLY A 175 50.910 -27.213 -26.913 1.00189.84 N ANISOU 1064 N GLY A 175 29730 22435 19963 2458 870 -3085 N ATOM 1065 CA GLY A 175 49.497 -27.399 -27.234 1.00186.47 C ANISOU 1065 CA GLY A 175 29444 21847 19556 1828 767 -3261 C ATOM 1066 C GLY A 175 49.006 -26.346 -28.208 1.00181.59 C ANISOU 1066 C GLY A 175 28234 21659 19101 1642 670 -3227 C ATOM 1067 O GLY A 175 48.299 -26.649 -29.169 1.00176.45 O ANISOU 1067 O GLY A 175 27754 21000 18286 1388 602 -3369 O ATOM 1068 N ILE A 176 49.390 -25.099 -27.950 1.00179.12 N ANISOU 1068 N ILE A 176 27267 21715 19075 1760 662 -3035 N ATOM 1069 CA ILE A 176 49.048 -23.987 -28.814 1.00174.63 C ANISOU 1069 CA ILE A 176 26180 21534 18635 1663 580 -2973 C ATOM 1070 C ILE A 176 49.683 -24.193 -30.186 1.00177.32 C ANISOU 1070 C ILE A 176 26623 22011 18737 1985 589 -2992 C ATOM 1071 O ILE A 176 49.119 -23.784 -31.192 1.00179.36 O ANISOU 1071 O ILE A 176 26702 22464 18979 1836 512 -3038 O ATOM 1072 CB ILE A 176 49.522 -22.648 -28.205 1.00172.26 C ANISOU 1072 CB ILE A 176 25326 21518 18606 1750 581 -2748 C ATOM 1073 CG1 ILE A 176 48.728 -22.323 -26.939 1.00168.26 C ANISOU 1073 CG1 ILE A 176 24694 20904 18331 1431 558 -2736 C ATOM 1074 CG2 ILE A 176 49.370 -21.505 -29.198 1.00174.12 C ANISOU 1074 CG2 ILE A 176 25154 22109 18895 1736 507 -2667 C ATOM 1075 CD1 ILE A 176 49.385 -21.304 -26.035 1.00163.51 C ANISOU 1075 CD1 ILE A 176 23757 20433 17935 1540 584 -2523 C ATOM 1076 N GLY A 177 50.849 -24.836 -30.222 1.00182.91 N ANISOU 1076 N GLY A 177 27614 22656 19225 2464 686 -2951 N ATOM 1077 CA GLY A 177 51.511 -25.188 -31.478 1.00188.34 C ANISOU 1077 CA GLY A 177 28461 23477 19619 2847 710 -2973 C ATOM 1078 C GLY A 177 50.642 -26.039 -32.392 1.00193.59 C ANISOU 1078 C GLY A 177 29626 23868 20059 2620 655 -3206 C ATOM 1079 O GLY A 177 50.709 -25.908 -33.614 1.00189.65 O ANISOU 1079 O GLY A 177 29068 23560 19428 2726 621 -3234 O ATOM 1080 N HIS A 178 49.832 -26.918 -31.803 1.00198.03 N ANISOU 1080 N HIS A 178 30701 23998 20544 2264 643 -3370 N ATOM 1081 CA HIS A 178 48.903 -27.751 -32.573 1.00198.17 C ANISOU 1081 CA HIS A 178 31242 23757 20294 1889 578 -3595 C ATOM 1082 C HIS A 178 47.835 -26.887 -33.236 1.00191.82 C ANISOU 1082 C HIS A 178 29890 23323 19667 1422 455 -3618 C ATOM 1083 O HIS A 178 47.473 -27.115 -34.389 1.00183.18 O ANISOU 1083 O HIS A 178 28939 22291 18370 1316 400 -3729 O ATOM 1084 CB HIS A 178 48.244 -28.814 -31.684 1.00204.16 C ANISOU 1084 CB HIS A 178 32667 24009 20893 1490 584 -3744 C ATOM 1085 CG HIS A 178 49.154 -29.948 -31.319 1.00214.06 C ANISOU 1085 CG HIS A 178 34730 24793 21809 1973 700 -3778 C ATOM 1086 ND1 HIS A 178 49.680 -30.810 -32.258 1.00219.99 N ANISOU 1086 ND1 HIS A 178 36160 25307 22117 2371 741 -3875 N ATOM 1087 CD2 HIS A 178 49.609 -30.377 -30.118 1.00215.75 C ANISOU 1087 CD2 HIS A 178 35228 24727 22017 2170 787 -3729 C ATOM 1088 CE1 HIS A 178 50.432 -31.712 -31.652 1.00224.83 C ANISOU 1088 CE1 HIS A 178 37462 25522 22441 2842 852 -3879 C ATOM 1089 NE2 HIS A 178 50.407 -31.470 -30.353 1.00224.46 N ANISOU 1089 NE2 HIS A 178 37176 25448 22659 2722 881 -3790 N ATOM 1090 N ILE A 179 47.345 -25.889 -32.501 1.00193.86 N ANISOU 1090 N ILE A 179 29545 23841 20269 1192 416 -3508 N ATOM 1091 CA ILE A 179 46.378 -24.927 -33.042 1.00190.96 C ANISOU 1091 CA ILE A 179 28620 23892 20044 882 310 -3496 C ATOM 1092 C ILE A 179 47.049 -23.958 -34.024 1.00186.28 C ANISOU 1092 C ILE A 179 27609 23642 19525 1264 304 -3363 C ATOM 1093 O ILE A 179 46.421 -23.514 -34.984 1.00180.79 O ANISOU 1093 O ILE A 179 26676 23225 18788 1125 225 -3401 O ATOM 1094 CB ILE A 179 45.686 -24.109 -31.924 1.00188.15 C ANISOU 1094 CB ILE A 179 27804 23709 19975 628 280 -3405 C ATOM 1095 CG1 ILE A 179 44.946 -25.034 -30.948 1.00186.51 C ANISOU 1095 CG1 ILE A 179 27961 23227 19676 183 279 -3529 C ATOM 1096 CG2 ILE A 179 44.717 -23.100 -32.527 1.00185.22 C ANISOU 1096 CG2 ILE A 179 26894 23810 19669 443 180 -3381 C ATOM 1097 CD1 ILE A 179 44.538 -24.364 -29.651 1.00178.19 C ANISOU 1097 CD1 ILE A 179 26526 22283 18893 52 278 -3423 C ATOM 1098 N GLU A 180 48.321 -23.636 -33.775 1.00182.36 N ANISOU 1098 N GLU A 180 27016 23171 19100 1719 385 -3200 N ATOM 1099 CA GLU A 180 49.120 -22.817 -34.694 1.00176.44 C ANISOU 1099 CA GLU A 180 25930 22761 18349 2051 387 -3060 C ATOM 1100 C GLU A 180 49.216 -23.466 -36.078 1.00178.71 C ANISOU 1100 C GLU A 180 26500 23057 18344 2192 375 -3185 C ATOM 1101 O GLU A 180 49.214 -22.773 -37.096 1.00172.87 O ANISOU 1101 O GLU A 180 25462 22620 17598 2247 327 -3139 O ATOM 1102 CB GLU A 180 50.535 -22.586 -34.140 1.00173.87 C ANISOU 1102 CB GLU A 180 25494 22530 18038 2461 482 -2866 C ATOM 1103 CG GLU A 180 50.634 -21.538 -33.038 1.00167.81 C ANISOU 1103 CG GLU A 180 24334 21873 17553 2339 481 -2686 C ATOM 1104 CD GLU A 180 51.903 -21.678 -32.203 1.00163.78 C ANISOU 1104 CD GLU A 180 23816 21411 17000 2649 581 -2534 C ATOM 1105 OE1 GLU A 180 53.011 -21.530 -32.753 1.00161.71 O ANISOU 1105 OE1 GLU A 180 23418 21467 16556 2980 626 -2409 O ATOM 1106 OE2 GLU A 180 51.800 -21.932 -30.988 1.00158.80 O ANISOU 1106 OE2 GLU A 180 23285 20561 16490 2561 615 -2532 O ATOM 1107 N ALA A 181 49.309 -24.794 -36.107 1.00185.31 N ANISOU 1107 N ALA A 181 27973 23528 18906 2260 419 -3343 N ATOM 1108 CA ALA A 181 49.335 -25.541 -37.365 1.00189.90 C ANISOU 1108 CA ALA A 181 28964 24034 19156 2379 407 -3486 C ATOM 1109 C ALA A 181 48.133 -25.180 -38.235 1.00191.63 C ANISOU 1109 C ALA A 181 28977 24441 19392 1923 287 -3594 C ATOM 1110 O ALA A 181 48.257 -25.042 -39.453 1.00189.16 O ANISOU 1110 O ALA A 181 28606 24320 18946 2062 258 -3615 O ATOM 1111 CB ALA A 181 49.357 -27.038 -37.094 1.00192.60 C ANISOU 1111 CB ALA A 181 30176 23843 19159 2409 459 -3661 C ATOM 1112 N ILE A 182 46.974 -25.019 -37.599 1.00191.93 N ANISOU 1112 N ILE A 182 28872 24485 19565 1401 220 -3651 N ATOM 1113 CA ILE A 182 45.741 -24.680 -38.304 1.00190.04 C ANISOU 1113 CA ILE A 182 28374 24541 19290 966 106 -3742 C ATOM 1114 C ILE A 182 45.810 -23.279 -38.911 1.00186.06 C ANISOU 1114 C ILE A 182 27206 24499 18987 1171 67 -3583 C ATOM 1115 O ILE A 182 45.408 -23.083 -40.056 1.00182.47 O ANISOU 1115 O ILE A 182 26631 24290 18407 1121 3 -3638 O ATOM 1116 CB ILE A 182 44.511 -24.767 -37.372 1.00192.67 C ANISOU 1116 CB ILE A 182 28618 24913 19675 401 50 -3807 C ATOM 1117 CG1 ILE A 182 44.289 -26.209 -36.905 1.00198.01 C ANISOU 1117 CG1 ILE A 182 30048 25116 20071 64 70 -3983 C ATOM 1118 CG2 ILE A 182 43.266 -24.258 -38.083 1.00192.92 C ANISOU 1118 CG2 ILE A 182 28236 25432 19632 31 -64 -3861 C ATOM 1119 CD1 ILE A 182 43.322 -26.340 -35.746 1.00198.20 C ANISOU 1119 CD1 ILE A 182 30000 25159 20145 -463 38 -4013 C ATOM 1120 N PHE A 183 46.306 -22.311 -38.140 1.00185.75 N ANISOU 1120 N PHE A 183 26793 24558 19224 1378 102 -3388 N ATOM 1121 CA PHE A 183 46.421 -20.927 -38.611 1.00185.54 C ANISOU 1121 CA PHE A 183 26262 24892 19342 1551 67 -3222 C ATOM 1122 C PHE A 183 47.352 -20.816 -39.822 1.00185.32 C ANISOU 1122 C PHE A 183 26243 24987 19180 1892 87 -3172 C ATOM 1123 O PHE A 183 47.067 -20.075 -40.761 1.00182.30 O ANISOU 1123 O PHE A 183 25602 24890 18774 1917 28 -3138 O ATOM 1124 CB PHE A 183 46.949 -19.997 -37.506 1.00186.20 C ANISOU 1124 CB PHE A 183 26094 24976 19677 1678 107 -3017 C ATOM 1125 CG PHE A 183 46.014 -19.815 -36.336 1.00184.65 C ANISOU 1125 CG PHE A 183 25794 24737 19628 1402 83 -3029 C ATOM 1126 CD1 PHE A 183 44.645 -19.688 -36.515 1.00181.55 C ANISOU 1126 CD1 PHE A 183 25232 24576 19170 1119 0 -3127 C ATOM 1127 CD2 PHE A 183 46.527 -19.703 -35.051 1.00186.64 C ANISOU 1127 CD2 PHE A 183 26065 24796 20054 1448 143 -2925 C ATOM 1128 CE1 PHE A 183 43.803 -19.499 -35.432 1.00180.28 C ANISOU 1128 CE1 PHE A 183 24929 24467 19101 905 -17 -3122 C ATOM 1129 CE2 PHE A 183 45.692 -19.511 -33.965 1.00186.07 C ANISOU 1129 CE2 PHE A 183 25889 24700 20108 1222 124 -2929 C ATOM 1130 CZ PHE A 183 44.327 -19.412 -34.156 1.00183.06 C ANISOU 1130 CZ PHE A 183 25338 24566 19647 961 44 -3026 C ATOM 1131 N LEU A 184 48.478 -21.524 -39.778 1.00189.57 N ANISOU 1131 N LEU A 184 27071 25351 19603 2193 174 -3156 N ATOM 1132 CA LEU A 184 49.478 -21.451 -40.844 1.00193.35 C ANISOU 1132 CA LEU A 184 27527 26022 19912 2567 206 -3087 C ATOM 1133 C LEU A 184 48.940 -22.022 -42.149 1.00191.06 C ANISOU 1133 C LEU A 184 27454 25746 19393 2510 152 -3266 C ATOM 1134 O LEU A 184 49.283 -21.545 -43.230 1.00186.59 O ANISOU 1134 O LEU A 184 26699 25450 18744 2690 133 -3209 O ATOM 1135 CB LEU A 184 50.752 -22.197 -40.445 1.00206.64 C ANISOU 1135 CB LEU A 184 29478 27594 21440 2972 319 -3033 C ATOM 1136 CG LEU A 184 51.607 -21.496 -39.389 1.00216.68 C ANISOU 1136 CG LEU A 184 30443 29009 22874 3090 376 -2808 C ATOM 1137 CD1 LEU A 184 52.640 -22.449 -38.807 1.00223.02 C ANISOU 1137 CD1 LEU A 184 31551 29706 23480 3484 490 -2789 C ATOM 1138 CD2 LEU A 184 52.268 -20.258 -39.979 1.00217.82 C ANISOU 1138 CD2 LEU A 184 30120 29603 23038 3171 356 -2593 C ATOM 1139 N LYS A 185 48.104 -23.050 -42.042 1.00193.50 N ANISOU 1139 N LYS A 185 28186 25769 19566 2215 126 -3478 N ATOM 1140 CA LYS A 185 47.434 -23.619 -43.207 1.00195.43 C ANISOU 1140 CA LYS A 185 28673 26022 19557 2035 60 -3663 C ATOM 1141 C LYS A 185 46.393 -22.651 -43.768 1.00190.58 C ANISOU 1141 C LYS A 185 27555 25805 19049 1752 -44 -3651 C ATOM 1142 O LYS A 185 46.214 -22.570 -44.983 1.00190.86 O ANISOU 1142 O LYS A 185 27544 26039 18935 1780 -92 -3704 O ATOM 1143 CB LYS A 185 46.801 -24.969 -42.858 1.00198.66 C ANISOU 1143 CB LYS A 185 29738 26017 19727 1684 52 -3883 C ATOM 1144 CG LYS A 185 47.839 -26.054 -42.610 1.00204.35 C ANISOU 1144 CG LYS A 185 31122 26309 20210 2082 159 -3920 C ATOM 1145 CD LYS A 185 47.228 -27.422 -42.358 1.00206.72 C ANISOU 1145 CD LYS A 185 32245 26110 20188 1714 148 -4145 C ATOM 1146 CE LYS A 185 48.276 -28.517 -42.515 1.00204.83 C ANISOU 1146 CE LYS A 185 32797 25447 19582 2252 251 -4198 C ATOM 1147 NZ LYS A 185 47.729 -29.876 -42.256 1.00206.59 N ANISOU 1147 NZ LYS A 185 33998 25079 19418 1889 243 -4416 N ATOM 1148 N TRP A 186 45.741 -21.896 -42.884 1.00184.16 N ATOM 1149 CA TRP A 186 44.819 -20.826 -43.290 1.00177.79 C ATOM 1150 C TRP A 186 45.552 -19.608 -43.861 1.00175.53 C ATOM 1151 O TRP A 186 44.949 -18.552 -44.060 1.00169.70 O ATOM 1152 CB TRP A 186 43.939 -20.385 -42.112 1.00172.32 C ATOM 1153 CG TRP A 186 42.865 -21.354 -41.756 1.00173.04 C ATOM 1154 CD1 TRP A 186 42.391 -22.374 -42.527 1.00177.06 C ATOM 1155 CD2 TRP A 186 42.095 -21.374 -40.547 1.00173.27 C ATOM 1156 NE1 TRP A 186 41.389 -23.042 -41.866 1.00179.47 N ATOM 1157 CE2 TRP A 186 41.185 -22.446 -40.649 1.00178.49 C ATOM 1158 CE3 TRP A 186 42.095 -20.599 -39.383 1.00170.32 C ATOM 1159 CZ2 TRP A 186 40.281 -22.762 -39.630 1.00179.43 C ATOM 1160 CZ3 TRP A 186 41.193 -20.914 -38.371 1.00169.41 C ATOM 1161 CH2 TRP A 186 40.302 -21.985 -38.502 1.00173.51 C