>>5AV6:HELIX   16 AB7 SER D   55  ASN D   84  1                                  30    
SSKAMGIMNSFVNDIFERIAGEASRLAHYN
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 AB7 SER D 55 ASN D 84 1 30 ATOM 2512 N SER D 55 -8.053 117.649 43.326 1.00 35.30 N ATOM 2513 CA SER D 55 -8.765 118.904 43.126 1.00 41.90 C ATOM 2514 C SER D 55 -8.109 119.719 42.016 1.00 42.40 C ATOM 2515 O SER D 55 -6.970 119.454 41.627 1.00 42.03 O ATOM 2516 CB SER D 55 -8.812 119.712 44.423 1.00 39.94 C ATOM 2517 OG SER D 55 -7.565 120.331 44.686 1.00 40.61 O ATOM 2518 N SER D 56 -8.832 120.709 41.505 1.00 38.60 N ATOM 2519 CA SER D 56 -8.326 121.531 40.411 1.00 48.97 C ATOM 2520 C SER D 56 -7.179 122.430 40.869 1.00 43.02 C ATOM 2521 O SER D 56 -6.305 122.787 40.077 1.00 47.83 O ATOM 2522 CB SER D 56 -9.454 122.371 39.812 1.00 42.58 C ATOM 2523 OG SER D 56 -10.160 123.056 40.829 1.00 62.86 O ATOM 2524 N LYS D 57 -7.181 122.793 42.147 1.00 37.76 N ATOM 2525 CA LYS D 57 -6.088 123.581 42.707 1.00 40.28 C ATOM 2526 C LYS D 57 -4.822 122.745 42.845 1.00 43.04 C ATOM 2527 O LYS D 57 -3.718 123.224 42.580 1.00 34.88 O ATOM 2528 CB LYS D 57 -6.478 124.166 44.066 1.00 45.09 C ATOM 2529 CG LYS D 57 -7.323 125.423 43.974 1.00 53.08 C ATOM 2530 CD LYS D 57 -7.366 126.158 45.302 1.00 64.21 C ATOM 2531 CE LYS D 57 -8.314 127.344 45.240 1.00 62.09 C ATOM 2532 NZ LYS D 57 -7.929 128.305 44.168 1.00 64.48 N ATOM 2533 N ALA D 58 -4.989 121.494 43.266 1.00 32.36 N ATOM 2534 CA ALA D 58 -3.871 120.567 43.393 1.00 30.38 C ATOM 2535 C ALA D 58 -3.300 120.227 42.021 1.00 27.56 C ATOM 2536 O ALA D 58 -2.088 120.081 41.862 1.00 39.51 O ATOM 2537 CB ALA D 58 -4.308 119.302 44.121 1.00 29.35 C ATOM 2538 N MET D 59 -4.182 120.107 41.032 1.00 33.13 N ATOM 2539 CA MET D 59 -3.765 119.856 39.658 1.00 36.90 C ATOM 2540 C MET D 59 -2.995 121.056 39.119 1.00 33.84 C ATOM 2541 O MET D 59 -2.092 120.912 38.294 1.00 38.88 O ATOM 2542 CB MET D 59 -4.972 119.555 38.765 1.00 34.31 C ATOM 2543 CG MET D 59 -4.618 119.286 37.307 1.00 37.14 C ATOM 2544 SD MET D 59 -3.587 117.818 37.107 1.00 46.76 S ATOM 2545 CE MET D 59 -4.819 116.520 37.125 1.00 41.24 C ATOM 2546 N GLY D 60 -3.352 122.244 39.596 1.00 39.50 N ATOM 2547 CA GLY D 60 -2.640 123.452 39.224 1.00 39.28 C ATOM 2548 C GLY D 60 -1.227 123.436 39.776 1.00 33.89 C ATOM 2549 O GLY D 60 -0.290 123.897 39.124 1.00 36.77 O ATOM 2550 N ILE D 61 -1.072 122.904 40.984 1.00 40.23 N ATOM 2551 CA ILE D 61 0.248 122.740 41.588 1.00 32.86 C ATOM 2552 C ILE D 61 1.103 121.774 40.776 1.00 37.64 C ATOM 2553 O ILE D 61 2.273 122.047 40.489 1.00 34.65 O ATOM 2554 CB ILE D 61 0.147 122.217 43.032 1.00 35.65 C ATOM 2555 CG1 ILE D 61 -0.674 123.176 43.892 1.00 38.56 C ATOM 2556 CG2 ILE D 61 1.533 122.023 43.627 1.00 31.65 C ATOM 2557 CD1 ILE D 61 -0.016 124.512 44.107 1.00 40.92 C ATOM 2558 N MET D 62 0.498 120.646 40.412 1.00 31.53 N ATOM 2559 CA MET D 62 1.168 119.603 39.641 1.00 37.83 C ATOM 2560 C MET D 62 1.646 120.110 38.279 1.00 34.97 C ATOM 2561 O MET D 62 2.732 119.750 37.821 1.00 31.96 O ATOM 2562 CB MET D 62 0.239 118.396 39.454 1.00 29.98 C ATOM 2563 CG MET D 62 0.002 117.584 40.725 1.00 31.35 C ATOM 2564 SD MET D 62 1.533 117.091 41.544 1.00 37.41 S ATOM 2565 CE MET D 62 2.337 116.153 40.246 1.00 31.38 C ATOM 2566 N ASN D 63 0.839 120.950 37.637 1.00 31.86 N ATOM 2567 CA ASN D 63 1.208 121.505 36.339 1.00 36.10 C ATOM 2568 C ASN D 63 2.374 122.485 36.460 1.00 35.67 C ATOM 2569 O ASN D 63 3.247 122.534 35.591 1.00 39.01 O ATOM 2570 CB ASN D 63 0.005 122.192 35.687 1.00 38.59 C ATOM 2571 CG ASN D 63 -0.271 121.680 34.285 1.00 55.31 C ATOM 2572 OD1 ASN D 63 -0.988 120.696 34.103 1.00 62.29 O ATOM 2573 ND2 ASN D 63 0.294 122.349 33.286 1.00 58.07 N ATOM 2574 N SER D 64 2.384 123.258 37.542 1.00 32.29 N ATOM 2575 CA SER D 64 3.496 124.158 37.824 1.00 39.80 C ATOM 2576 C SER D 64 4.765 123.351 38.055 1.00 42.26 C ATOM 2577 O SER D 64 5.841 123.714 37.576 1.00 37.62 O ATOM 2578 CB SER D 64 3.196 125.037 39.041 1.00 33.20 C ATOM 2579 OG SER D 64 2.199 126.000 38.745 1.00 42.48 O ATOM 2580 N PHE D 65 4.624 122.245 38.780 1.00 34.29 N ATOM 2581 CA PHE D 65 5.753 121.373 39.090 1.00 29.64 C ATOM 2582 C PHE D 65 6.409 120.796 37.841 1.00 31.75 C ATOM 2583 O PHE D 65 7.629 120.827 37.707 1.00 37.66 O ATOM 2584 CB PHE D 65 5.311 120.230 40.007 1.00 38.63 C ATOM 2585 CG PHE D 65 6.333 119.140 40.145 1.00 37.09 C ATOM 2586 CD1 PHE D 65 7.485 119.346 40.886 1.00 37.71 C ATOM 2587 CD2 PHE D 65 6.145 117.910 39.537 1.00 46.47 C ATOM 2588 CE1 PHE D 65 8.429 118.345 41.016 1.00 35.15 C ATOM 2589 CE2 PHE D 65 7.086 116.907 39.665 1.00 41.89 C ATOM 2590 CZ PHE D 65 8.231 117.125 40.403 1.00 37.75 C ATOM 2591 N VAL D 66 5.594 120.264 36.935 1.00 34.37 N ATOM 2592 CA VAL D 66 6.108 119.669 35.705 1.00 37.58 C ATOM 2593 C VAL D 66 6.785 120.720 34.821 1.00 39.29 C ATOM 2594 O VAL D 66 7.873 120.487 34.292 1.00 34.51 O ATOM 2595 CB VAL D 66 4.993 118.969 34.903 1.00 36.65 C ATOM 2596 CG1 VAL D 66 5.543 118.438 33.590 1.00 32.87 C ATOM 2597 CG2 VAL D 66 4.362 117.839 35.722 1.00 32.63 C ATOM 2598 N ASN D 67 6.140 121.874 34.669 1.00 33.29 N ATOM 2599 CA ASN D 67 6.721 122.987 33.922 1.00 40.07 C ATOM 2600 C ASN D 67 8.057 123.431 34.512 1.00 33.74 C ATOM 2601 O ASN D 67 9.022 123.668 33.782 1.00 38.47 O ATOM 2602 CB ASN D 67 5.747 124.171 33.881 1.00 36.06 C ATOM 2603 CG ASN D 67 4.647 123.984 32.852 1.00 41.26 C ATOM 2604 OD1 ASN D 67 4.880 123.439 31.773 1.00 43.06 O ATOM 2605 ND2 ASN D 67 3.443 124.435 33.182 1.00 45.15 N ATOM 2606 N ASP D 68 8.104 123.527 35.838 1.00 37.53 N ATOM 2607 CA ASP D 68 9.306 123.943 36.552 1.00 42.01 C ATOM 2608 C ASP D 68 10.465 122.983 36.292 1.00 32.56 C ATOM 2609 O ASP D 68 11.554 123.403 35.899 1.00 35.84 O ATOM 2610 CB ASP D 68 9.019 124.044 38.055 1.00 29.43 C ATOM 2611 CG ASP D 68 10.220 124.515 38.854 1.00 33.15 C ATOM 2612 OD1 ASP D 68 11.178 125.038 38.246 1.00 44.66 O ATOM 2613 OD2 ASP D 68 10.203 124.366 40.093 1.00 35.99 O ATOM 2614 N ILE D 69 10.218 121.695 36.507 1.00 37.33 N ATOM 2615 CA ILE D 69 11.249 120.681 36.333 1.00 32.10 C ATOM 2616 C ILE D 69 11.649 120.564 34.863 1.00 32.30 C ATOM 2617 O ILE D 69 12.819 120.337 34.553 1.00 32.60 O ATOM 2618 CB ILE D 69 10.783 119.310 36.869 1.00 32.37 C ATOM 2619 CG1 ILE D 69 10.415 119.421 38.349 1.00 31.48 C ATOM 2620 CG2 ILE D 69 11.860 118.251 36.674 1.00 30.94 C ATOM 2621 CD1 ILE D 69 11.545 119.929 39.226 1.00 37.31 C ATOM 2622 N PHE D 70 10.683 120.732 33.963 1.00 32.40 N ATOM 2623 CA PHE D 70 10.977 120.755 32.531 1.00 37.91 C ATOM 2624 C PHE D 70 12.051 121.793 32.228 1.00 36.91 C ATOM 2625 O PHE D 70 13.071 121.485 31.612 1.00 40.56 O ATOM 2626 CB PHE D 70 9.711 121.055 31.713 1.00 38.18 C ATOM 2627 CG PHE D 70 9.944 121.131 30.222 1.00 42.01 C ATOM 2628 CD1 PHE D 70 10.430 122.293 29.636 1.00 53.20 C ATOM 2629 CD2 PHE D 70 9.652 120.050 29.407 1.00 49.40 C ATOM 2630 CE1 PHE D 70 10.641 122.366 28.274 1.00 46.92 C ATOM 2631 CE2 PHE D 70 9.857 120.120 28.041 1.00 52.11 C ATOM 2632 CZ PHE D 70 10.354 121.279 27.475 1.00 48.64 C ATOM 2633 N GLU D 71 11.806 123.022 32.669 1.00 38.69 N ATOM 2634 CA GLU D 71 12.696 124.144 32.395 1.00 39.00 C ATOM 2635 C GLU D 71 14.059 123.968 33.059 1.00 32.68 C ATOM 2636 O GLU D 71 15.090 124.288 32.467 1.00 37.23 O ATOM 2637 CB GLU D 71 12.046 125.452 32.857 1.00 37.48 C ATOM 2638 CG GLU D 71 12.968 126.658 32.810 1.00 60.86 C ATOM 2639 CD GLU D 71 13.501 126.930 31.419 1.00 78.57 C ATOM 2640 OE1 GLU D 71 12.692 126.955 30.467 1.00 75.96 O ATOM 2641 OE2 GLU D 71 14.730 127.105 31.281 1.00 69.56 O ATOM 2642 N ARG D 72 14.059 123.456 34.286 1.00 34.45 N ATOM 2643 CA ARG D 72 15.303 123.233 35.018 1.00 35.31 C ATOM 2644 C ARG D 72 16.214 122.253 34.281 1.00 43.80 C ATOM 2645 O ARG D 72 17.411 122.497 34.127 1.00 36.70 O ATOM 2646 CB ARG D 72 15.025 122.707 36.428 1.00 38.81 C ATOM 2647 CG ARG D 72 14.452 123.727 37.399 1.00 34.14 C ATOM 2648 CD ARG D 72 14.656 123.255 38.834 1.00 42.51 C ATOM 2649 NE ARG D 72 13.530 123.600 39.697 1.00 33.88 N ATOM 2650 CZ ARG D 72 13.444 123.265 40.982 1.00 41.78 C ATOM 2651 NH1 ARG D 72 14.421 122.575 41.563 1.00 34.79 N ATOM 2652 NH2 ARG D 72 12.380 123.618 41.688 1.00 32.42 N ATOM 2653 N ILE D 73 15.633 121.146 33.828 1.00 32.84 N ATOM 2654 CA ILE D 73 16.378 120.112 33.121 1.00 34.45 C ATOM 2655 C ILE D 73 16.802 120.588 31.737 1.00 31.96 C ATOM 2656 O ILE D 73 17.960 120.430 31.343 1.00 38.41 O ATOM 2657 CB ILE D 73 15.548 118.819 32.992 1.00 34.96 C ATOM 2658 CG1 ILE D 73 15.408 118.148 34.360 1.00 34.32 C ATOM 2659 CG2 ILE D 73 16.187 117.862 31.993 1.00 34.04 C ATOM 2660 CD1 ILE D 73 14.508 116.934 34.358 1.00 37.56 C ATOM 2661 N ALA D 74 15.858 121.178 31.008 1.00 36.88 N ATOM 2662 CA ALA D 74 16.129 121.694 29.670 1.00 41.99 C ATOM 2663 C ALA D 74 17.187 122.790 29.715 1.00 38.78 C ATOM 2664 O ALA D 74 18.041 122.877 28.833 1.00 39.81 O ATOM 2665 CB ALA D 74 14.849 122.217 29.031 1.00 35.17 C ATOM 2666 N GLY D 75 17.128 123.618 30.752 1.00 37.55 N ATOM 2667 CA GLY D 75 18.096 124.685 30.930 1.00 34.49 C ATOM 2668 C GLY D 75 19.500 124.166 31.174 1.00 47.78 C ATOM 2669 O GLY D 75 20.462 124.655 30.579 1.00 44.29 O ATOM 2670 N GLU D 76 19.617 123.174 32.052 1.00 37.99 N ATOM 2671 CA GLU D 76 20.911 122.578 32.371 1.00 37.22 C ATOM 2672 C GLU D 76 21.477 121.833 31.167 1.00 41.79 C ATOM 2673 O GLU D 76 22.684 121.845 30.928 1.00 45.33 O ATOM 2674 CB GLU D 76 20.789 121.633 33.568 1.00 31.96 C ATOM 2675 CG GLU D 76 22.101 120.977 33.976 1.00 53.25 C ATOM 2676 CD GLU D 76 23.172 121.992 34.331 1.00 65.56 C ATOM 2677 OE1 GLU D 76 24.193 122.054 33.612 1.00 54.26 O ATOM 2678 OE2 GLU D 76 22.992 122.726 35.328 1.00 58.06 O ATOM 2679 N ALA D 77 20.592 121.184 30.417 1.00 39.95 N ATOM 2680 CA ALA D 77 20.972 120.478 29.198 1.00 48.10 C ATOM 2681 C ALA D 77 21.493 121.459 28.156 1.00 44.20 C ATOM 2682 O ALA D 77 22.436 121.163 27.419 1.00 39.82 O ATOM 2683 CB ALA D 77 19.790 119.695 28.646 1.00 35.97 C ATOM 2684 N SER D 78 20.867 122.631 28.104 1.00 35.88 N ATOM 2685 CA SER D 78 21.252 123.672 27.161 1.00 39.84 C ATOM 2686 C SER D 78 22.665 124.173 27.436 1.00 39.40 C ATOM 2687 O SER D 78 23.499 124.221 26.532 1.00 46.22 O ATOM 2688 CB SER D 78 20.262 124.837 27.216 1.00 41.74 C ATOM 2689 OG SER D 78 20.587 125.822 26.252 1.00 48.41 O ATOM 2690 N ARG D 79 22.924 124.549 28.687 1.00 44.21 N ATOM 2691 CA ARG D 79 24.256 124.975 29.112 1.00 47.47 C ATOM 2692 C ARG D 79 25.305 123.912 28.813 1.00 51.60 C ATOM 2693 O ARG D 79 26.378 124.210 28.288 1.00 51.84 O ATOM 2694 CB ARG D 79 24.264 125.291 30.607 1.00 45.98 C ATOM 2695 CG ARG D 79 23.754 126.673 30.956 1.00 51.73 C ATOM 2696 CD ARG D 79 23.313 126.732 32.402 1.00 54.41 C ATOM 2697 NE ARG D 79 21.904 127.093 32.506 1.00 64.07 N ATOM 2698 CZ ARG D 79 21.071 126.596 33.412 1.00 43.20 C ATOM 2699 NH1 ARG D 79 21.506 125.714 34.303 1.00 49.43 N ATOM 2700 NH2 ARG D 79 19.803 126.982 33.430 1.00 72.06 N ATOM 2701 N LEU D 80 24.974 122.671 29.153 1.00 46.10 N ATOM 2702 CA LEU D 80 25.873 121.538 28.985 1.00 51.41 C ATOM 2703 C LEU D 80 26.289 121.343 27.531 1.00 53.81 C ATOM 2704 O LEU D 80 27.452 121.057 27.235 1.00 49.88 O ATOM 2705 CB LEU D 80 25.198 120.277 29.512 1.00 41.06 C ATOM 2706 CG LEU D 80 26.034 119.010 29.612 1.00 61.18 C ATOM 2707 CD1 LEU D 80 27.090 119.152 30.694 1.00 50.23 C ATOM 2708 CD2 LEU D 80 25.110 117.857 29.905 1.00 67.07 C ATOM 2709 N ALA D 81 25.325 121.490 26.629 1.00 46.96 N ATOM 2710 CA ALA D 81 25.584 121.403 25.200 1.00 55.95 C ATOM 2711 C ALA D 81 26.517 122.525 24.769 1.00 56.43 C ATOM 2712 O ALA D 81 27.471 122.303 24.021 1.00 51.40 O ATOM 2713 CB ALA D 81 24.281 121.464 24.420 1.00 46.78 C ATOM 2714 N HIS D 82 26.232 123.727 25.260 1.00 44.24 N ATOM 2715 CA HIS D 82 27.007 124.910 24.907 1.00 50.42 C ATOM 2716 C HIS D 82 28.437 124.828 25.429 1.00 46.51 C ATOM 2717 O HIS D 82 29.376 125.194 24.725 1.00 52.97 O ATOM 2718 CB HIS D 82 26.328 126.172 25.442 1.00 51.21 C ATOM 2719 CG HIS D 82 26.871 127.440 24.861 1.00 79.01 C ATOM 2720 ND1 HIS D 82 27.791 128.230 25.519 1.00 76.23 N ATOM 2721 CD2 HIS D 82 26.633 128.052 23.677 1.00 75.78 C ATOM 2722 CE1 HIS D 82 28.091 129.273 24.768 1.00 72.11 C ATOM 2723 NE2 HIS D 82 27.401 129.190 23.643 1.00 74.04 N ATOM 2724 N TYR D 83 28.594 124.348 26.661 1.00 43.64 N ATOM 2725 CA TYR D 83 29.914 124.181 27.269 1.00 47.64 C ATOM 2726 C TYR D 83 30.805 123.285 26.415 1.00 53.18 C ATOM 2727 O TYR D 83 32.018 123.484 26.337 1.00 58.19 O ATOM 2728 CB TYR D 83 29.804 123.581 28.675 1.00 50.47 C ATOM 2729 CG TYR D 83 29.074 124.427 29.697 1.00 57.25 C ATOM 2730 CD1 TYR D 83 28.828 125.779 29.478 1.00 55.40 C ATOM 2731 CD2 TYR D 83 28.637 123.869 30.892 1.00 55.24 C ATOM 2732 CE1 TYR D 83 28.160 126.545 30.421 1.00 60.96 C ATOM 2733 CE2 TYR D 83 27.973 124.626 31.838 1.00 60.80 C ATOM 2734 CZ TYR D 83 27.736 125.961 31.600 1.00 61.92 C ATOM 2735 OH TYR D 83 27.073 126.706 32.549 1.00 73.38 O ATOM 2736 N ASN D 84 30.187 122.293 25.781 1.00 50.52 N ATOM 2737 CA ASN D 84 30.910 121.309 24.987 1.00 50.85 C ATOM 2738 C ASN D 84 30.802 121.564 23.485 1.00 54.83 C ATOM 2739 O ASN D 84 31.085 120.677 22.680 1.00 55.78 O ATOM 2740 CB ASN D 84 30.405 119.903 25.314 1.00 48.03 C ATOM 2741 CG ASN D 84 30.744 119.479 26.731 1.00 53.95 C ATOM 2742 OD1 ASN D 84 31.857 119.034 27.007 1.00 53.73 O ATOM 2743 ND2 ASN D 84 29.783 119.612 27.636 1.00 52.73 N