>>5CP6:HELIX    3 AA3 GLN A   85  ALA A  114  1                                  30    
QSSAVMALQEASEAYLVALFEDTNLCAIHA
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 3 AA3 GLN A 85 ALA A 114 1 30 ATOM 6353 N GLN A 85 -43.142 -9.790 36.498 1.00 60.30 N ATOM 6354 CA GLN A 85 -44.037 -10.897 36.198 1.00 62.75 C ATOM 6355 C GLN A 85 -44.460 -11.553 37.483 1.00 69.31 C ATOM 6356 O GLN A 85 -43.706 -11.564 38.475 1.00 67.97 O ATOM 6357 CB GLN A 85 -43.410 -11.928 35.313 1.00 64.18 C ATOM 6358 CG GLN A 85 -43.219 -11.417 33.923 1.00 63.74 C ATOM 6359 CD GLN A 85 -42.510 -12.406 33.067 1.00 61.26 C ATOM 6360 OE1 GLN A 85 -42.216 -13.530 33.493 1.00 64.49 O ATOM 6361 NE2 GLN A 85 -42.234 -12.009 31.843 1.00 55.13 N ATOM 6362 N SER A 86 -45.676 -12.086 37.450 1.00 65.03 N ATOM 6363 CA SER A 86 -46.242 -12.815 38.560 1.00 67.28 C ATOM 6364 C SER A 86 -45.389 -14.037 38.919 1.00 72.14 C ATOM 6365 O SER A 86 -45.333 -14.416 40.081 1.00 81.26 O ATOM 6366 CB SER A 86 -47.651 -13.265 38.201 1.00 70.73 C ATOM 6367 OG SER A 86 -48.047 -14.343 39.010 1.00 78.84 O ATOM 6368 N SER A 87 -44.754 -14.658 37.921 1.00 68.04 N ATOM 6369 CA SER A 87 -43.818 -15.767 38.153 1.00 63.73 C ATOM 6370 C SER A 87 -42.467 -15.271 38.709 1.00 67.10 C ATOM 6371 O SER A 87 -41.827 -15.966 39.516 1.00 62.69 O ATOM 6372 CB SER A 87 -43.552 -16.513 36.854 1.00 56.46 C ATOM 6373 OG SER A 87 -42.947 -15.618 35.943 1.00 57.55 O ATOM 6374 N ALA A 88 -42.021 -14.085 38.287 1.00 63.34 N ATOM 6375 CA ALA A 88 -40.774 -13.518 38.842 1.00 61.96 C ATOM 6376 C ALA A 88 -40.837 -13.400 40.351 1.00 61.22 C ATOM 6377 O ALA A 88 -39.873 -13.738 41.052 1.00 73.15 O ATOM 6378 CB ALA A 88 -40.455 -12.164 38.239 1.00 61.80 C ATOM 6379 N VAL A 89 -41.969 -12.945 40.860 1.00 55.52 N ATOM 6380 CA VAL A 89 -42.127 -12.822 42.295 1.00 55.86 C ATOM 6381 C VAL A 89 -42.181 -14.201 42.916 1.00 57.77 C ATOM 6382 O VAL A 89 -41.755 -14.405 44.057 1.00 61.47 O ATOM 6383 CB VAL A 89 -43.408 -12.058 42.689 1.00 56.48 C ATOM 6384 CG1 VAL A 89 -43.456 -11.892 44.196 1.00 57.64 C ATOM 6385 CG2 VAL A 89 -43.466 -10.699 42.014 1.00 55.83 C ATOM 6386 N MET A 90 -42.720 -15.154 42.183 1.00 56.89 N ATOM 6387 CA MET A 90 -42.813 -16.487 42.739 1.00 73.36 C ATOM 6388 C MET A 90 -41.423 -17.096 42.898 1.00 66.17 C ATOM 6389 O MET A 90 -41.060 -17.544 43.987 1.00 57.64 O ATOM 6390 CB MET A 90 -43.755 -17.380 41.913 1.00 89.12 C ATOM 6391 CG MET A 90 -45.238 -17.058 42.110 1.00 96.16 C ATOM 6392 SD MET A 90 -45.723 -16.967 43.854 1.00112.41 S ATOM 6393 CE MET A 90 -45.568 -18.702 44.300 1.00116.00 C ATOM 6394 N ALA A 91 -40.642 -17.078 41.826 1.00 63.29 N ATOM 6395 CA ALA A 91 -39.256 -17.512 41.897 1.00 61.12 C ATOM 6396 C ALA A 91 -38.633 -16.971 43.182 1.00 63.09 C ATOM 6397 O ALA A 91 -38.198 -17.740 44.053 1.00 68.77 O ATOM 6398 CB ALA A 91 -38.476 -17.035 40.680 1.00 56.24 C ATOM 6399 N LEU A 92 -38.640 -15.649 43.318 1.00 61.56 N ATOM 6400 CA LEU A 92 -38.077 -14.987 44.489 1.00 55.75 C ATOM 6401 C LEU A 92 -38.596 -15.531 45.801 1.00 53.36 C ATOM 6402 O LEU A 92 -37.849 -15.615 46.753 1.00 58.32 O ATOM 6403 CB LEU A 92 -38.373 -13.491 44.454 1.00 60.22 C ATOM 6404 CG LEU A 92 -37.522 -12.624 43.520 1.00 66.32 C ATOM 6405 CD1 LEU A 92 -38.090 -11.217 43.441 1.00 68.55 C ATOM 6406 CD2 LEU A 92 -36.075 -12.528 43.969 1.00 62.58 C ATOM 6407 N GLN A 93 -39.872 -15.872 45.887 1.00 56.72 N ATOM 6408 CA GLN A 93 -40.385 -16.401 47.152 1.00 59.41 C ATOM 6409 C GLN A 93 -39.921 -17.847 47.390 1.00 55.64 C ATOM 6410 O GLN A 93 -39.573 -18.221 48.506 1.00 48.42 O ATOM 6411 CB GLN A 93 -41.907 -16.290 47.246 1.00 59.14 C ATOM 6412 CG GLN A 93 -42.367 -16.239 48.687 1.00 61.00 C ATOM 6413 CD GLN A 93 -43.868 -16.297 48.844 1.00 65.12 C ATOM 6414 OE1 GLN A 93 -44.627 -15.849 47.965 1.00 68.59 O ATOM 6415 NE2 GLN A 93 -44.317 -16.839 49.985 1.00 60.46 N ATOM 6416 N GLU A 94 -39.906 -18.660 46.346 1.00 54.09 N ATOM 6417 CA GLU A 94 -39.399 -20.011 46.487 1.00 54.20 C ATOM 6418 C GLU A 94 -37.965 -19.977 46.971 1.00 55.25 C ATOM 6419 O GLU A 94 -37.564 -20.773 47.822 1.00 56.64 O ATOM 6420 CB GLU A 94 -39.420 -20.709 45.156 1.00 57.50 C ATOM 6421 CG GLU A 94 -40.811 -21.047 44.664 1.00 64.18 C ATOM 6422 CD GLU A 94 -41.446 -22.169 45.443 1.00 66.21 C ATOM 6423 OE1 GLU A 94 -42.684 -22.130 45.600 1.00 73.70 O ATOM 6424 OE2 GLU A 94 -40.712 -23.070 45.890 1.00 58.59 O ATOM 6425 N ALA A 95 -37.187 -19.054 46.424 1.00 52.48 N ATOM 6426 CA ALA A 95 -35.763 -19.015 46.719 1.00 51.19 C ATOM 6427 C ALA A 95 -35.538 -18.545 48.115 1.00 52.08 C ATOM 6428 O ALA A 95 -34.750 -19.133 48.863 1.00 60.98 O ATOM 6429 CB ALA A 95 -35.029 -18.115 45.747 1.00 49.06 C ATOM 6430 N SER A 96 -36.233 -17.480 48.477 1.00 51.43 N ATOM 6431 CA SER A 96 -36.050 -16.915 49.803 1.00 54.89 C ATOM 6432 C SER A 96 -36.429 -17.936 50.870 1.00 55.14 C ATOM 6433 O SER A 96 -35.708 -18.133 51.847 1.00 55.84 O ATOM 6434 CB SER A 96 -36.860 -15.636 49.941 1.00 56.61 C ATOM 6435 OG SER A 96 -36.542 -14.733 48.874 1.00 55.82 O ATOM 6436 N GLU A 97 -37.532 -18.637 50.669 1.00 53.55 N ATOM 6437 CA GLU A 97 -37.957 -19.618 51.660 1.00 53.33 C ATOM 6438 C GLU A 97 -36.986 -20.826 51.735 1.00 50.15 C ATOM 6439 O GLU A 97 -36.719 -21.376 52.818 1.00 42.13 O ATOM 6440 CB GLU A 97 -39.396 -20.054 51.374 1.00 58.78 C ATOM 6441 CG GLU A 97 -40.448 -18.915 51.428 1.00 64.18 C ATOM 6442 CD GLU A 97 -41.831 -19.366 51.941 1.00 67.78 C ATOM 6443 OE1 GLU A 97 -41.992 -20.562 52.309 1.00 73.01 O ATOM 6444 OE2 GLU A 97 -42.763 -18.528 52.013 1.00 62.43 O ATOM 6445 N ALA A 98 -36.434 -21.220 50.593 1.00 45.75 N ATOM 6446 CA ALA A 98 -35.530 -22.367 50.557 1.00 44.13 C ATOM 6447 C ALA A 98 -34.260 -21.987 51.317 1.00 44.43 C ATOM 6448 O ALA A 98 -33.751 -22.745 52.137 1.00 44.28 O ATOM 6449 CB ALA A 98 -35.207 -22.734 49.115 1.00 45.36 C ATOM 6450 N TYR A 99 -33.798 -20.775 51.050 1.00 42.14 N ATOM 6451 CA TYR A 99 -32.685 -20.200 51.737 1.00 41.79 C ATOM 6452 C TYR A 99 -32.896 -20.095 53.215 1.00 46.17 C ATOM 6453 O TYR A 99 -31.998 -20.439 53.989 1.00 58.55 O ATOM 6454 CB TYR A 99 -32.442 -18.812 51.212 1.00 42.92 C ATOM 6455 CG TYR A 99 -31.415 -18.037 51.985 1.00 47.48 C ATOM 6456 CD1 TYR A 99 -30.030 -18.230 51.780 1.00 49.92 C ATOM 6457 CD2 TYR A 99 -31.799 -17.100 52.906 1.00 52.52 C ATOM 6458 CE1 TYR A 99 -29.074 -17.503 52.485 1.00 46.43 C ATOM 6459 CE2 TYR A 99 -30.846 -16.365 53.624 1.00 56.71 C ATOM 6460 CZ TYR A 99 -29.494 -16.570 53.413 1.00 51.33 C ATOM 6461 OH TYR A 99 -28.608 -15.818 54.164 1.00 55.27 O ATOM 6462 N LEU A 100 -34.053 -19.612 53.642 1.00 48.76 N ATOM 6463 CA LEU A 100 -34.210 -19.333 55.067 1.00 47.51 C ATOM 6464 C LEU A 100 -34.408 -20.609 55.812 1.00 47.86 C ATOM 6465 O LEU A 100 -33.922 -20.764 56.935 1.00 45.80 O ATOM 6466 CB LEU A 100 -35.377 -18.426 55.331 1.00 50.39 C ATOM 6467 CG LEU A 100 -35.254 -16.953 54.939 1.00 54.17 C ATOM 6468 CD1 LEU A 100 -36.582 -16.314 55.287 1.00 55.23 C ATOM 6469 CD2 LEU A 100 -34.126 -16.196 55.633 1.00 52.72 C ATOM 6470 N VAL A 101 -35.115 -21.547 55.183 1.00 49.01 N ATOM 6471 CA VAL A 101 -35.329 -22.836 55.822 1.00 44.27 C ATOM 6472 C VAL A 101 -33.993 -23.498 56.049 1.00 45.35 C ATOM 6473 O VAL A 101 -33.731 -23.968 57.146 1.00 45.05 O ATOM 6474 CB VAL A 101 -36.150 -23.778 54.974 1.00 45.59 C ATOM 6475 CG1 VAL A 101 -35.983 -25.198 55.492 1.00 45.46 C ATOM 6476 CG2 VAL A 101 -37.611 -23.342 54.957 1.00 47.38 C ATOM 6477 N ALA A 102 -33.140 -23.529 55.014 1.00 43.44 N ATOM 6478 CA ALA A 102 -31.832 -24.169 55.158 1.00 39.13 C ATOM 6479 C ALA A 102 -30.987 -23.423 56.167 1.00 40.20 C ATOM 6480 O ALA A 102 -30.302 -24.056 56.949 1.00 41.68 O ATOM 6481 CB ALA A 102 -31.124 -24.262 53.843 1.00 36.22 C ATOM 6482 N LEU A 103 -31.065 -22.087 56.185 1.00 39.30 N ATOM 6483 CA LEU A 103 -30.339 -21.327 57.209 1.00 41.58 C ATOM 6484 C LEU A 103 -30.789 -21.679 58.598 1.00 44.88 C ATOM 6485 O LEU A 103 -30.000 -21.659 59.529 1.00 46.27 O ATOM 6486 CB LEU A 103 -30.535 -19.831 57.046 1.00 46.73 C ATOM 6487 CG LEU A 103 -29.707 -18.934 57.980 1.00 46.40 C ATOM 6488 CD1 LEU A 103 -28.235 -19.181 57.740 1.00 47.77 C ATOM 6489 CD2 LEU A 103 -30.008 -17.455 57.779 1.00 45.99 C ATOM 6490 N PHE A 104 -32.076 -21.961 58.754 1.00 48.76 N ATOM 6491 CA PHE A 104 -32.565 -22.368 60.049 1.00 48.45 C ATOM 6492 C PHE A 104 -31.970 -23.725 60.419 1.00 47.76 C ATOM 6493 O PHE A 104 -31.714 -23.948 61.574 1.00 56.14 O ATOM 6494 CB PHE A 104 -34.112 -22.357 60.095 1.00 51.10 C ATOM 6495 CG PHE A 104 -34.711 -20.989 60.354 1.00 48.40 C ATOM 6496 CD1 PHE A 104 -35.650 -20.455 59.508 1.00 47.82 C ATOM 6497 CD2 PHE A 104 -34.322 -20.245 61.450 1.00 48.34 C ATOM 6498 CE1 PHE A 104 -36.188 -19.197 59.732 1.00 47.52 C ATOM 6499 CE2 PHE A 104 -34.837 -18.989 61.676 1.00 50.35 C ATOM 6500 CZ PHE A 104 -35.775 -18.456 60.812 1.00 51.04 C ATOM 6501 N GLU A 105 -31.719 -24.619 59.465 1.00 43.86 N ATOM 6502 CA GLU A 105 -31.157 -25.913 59.830 1.00 45.86 C ATOM 6503 C GLU A 105 -29.773 -25.698 60.427 1.00 47.70 C ATOM 6504 O GLU A 105 -29.441 -26.266 61.475 1.00 50.66 O ATOM 6505 CB GLU A 105 -31.068 -26.852 58.635 1.00 46.58 C ATOM 6506 CG GLU A 105 -32.405 -27.135 57.960 1.00 54.10 C ATOM 6507 CD GLU A 105 -32.279 -27.763 56.556 1.00 59.24 C ATOM 6508 OE1 GLU A 105 -31.193 -28.313 56.259 1.00 65.54 O ATOM 6509 OE2 GLU A 105 -33.263 -27.728 55.757 1.00 52.42 O ATOM 6510 N ASP A 106 -28.978 -24.847 59.784 1.00 44.97 N ATOM 6511 CA ASP A 106 -27.598 -24.652 60.196 1.00 45.82 C ATOM 6512 C ASP A 106 -27.606 -23.921 61.509 1.00 45.02 C ATOM 6513 O ASP A 106 -26.752 -24.112 62.378 1.00 44.53 O ATOM 6514 CB ASP A 106 -26.829 -23.810 59.173 1.00 46.85 C ATOM 6515 CG ASP A 106 -26.741 -24.461 57.805 1.00 49.58 C ATOM 6516 OD1 ASP A 106 -27.053 -25.669 57.682 1.00 57.94 O ATOM 6517 OD2 ASP A 106 -26.384 -23.761 56.828 1.00 49.57 O ATOM 6518 N THR A 107 -28.570 -23.035 61.630 1.00 45.80 N ATOM 6519 CA THR A 107 -28.704 -22.227 62.836 1.00 50.63 C ATOM 6520 C THR A 107 -28.961 -23.158 64.002 1.00 53.73 C ATOM 6521 O THR A 107 -28.270 -23.122 65.027 1.00 54.22 O ATOM 6522 CB THR A 107 -29.871 -21.230 62.706 1.00 50.18 C ATOM 6523 OG1 THR A 107 -29.619 -20.328 61.614 1.00 48.78 O ATOM 6524 CG2 THR A 107 -30.004 -20.447 63.945 1.00 50.56 C ATOM 6525 N ASN A 108 -29.947 -24.018 63.806 1.00 52.15 N ATOM 6526 CA ASN A 108 -30.242 -25.059 64.753 1.00 51.12 C ATOM 6527 C ASN A 108 -29.013 -25.881 65.100 1.00 46.80 C ATOM 6528 O ASN A 108 -28.753 -26.147 66.277 1.00 43.17 O ATOM 6529 CB ASN A 108 -31.353 -25.974 64.219 1.00 54.47 C ATOM 6530 CG ASN A 108 -32.255 -26.489 65.318 1.00 58.53 C ATOM 6531 OD1 ASN A 108 -32.313 -25.925 66.411 1.00 65.36 O ATOM 6532 ND2 ASN A 108 -32.964 -27.558 65.036 1.00 67.34 N ATOM 6533 N LEU A 109 -28.238 -26.282 64.101 1.00 45.26 N ATOM 6534 CA LEU A 109 -26.997 -26.996 64.423 1.00 44.00 C ATOM 6535 C LEU A 109 -26.095 -26.124 65.294 1.00 41.79 C ATOM 6536 O LEU A 109 -25.548 -26.594 66.266 1.00 42.19 O ATOM 6537 CB LEU A 109 -26.286 -27.473 63.171 1.00 44.96 C ATOM 6538 CG LEU A 109 -27.018 -28.559 62.347 1.00 46.99 C ATOM 6539 CD1 LEU A 109 -26.273 -28.846 61.055 1.00 47.01 C ATOM 6540 CD2 LEU A 109 -27.186 -29.872 63.099 1.00 45.96 C ATOM 6541 N CYS A 110 -26.006 -24.836 65.018 1.00 43.47 N ATOM 6542 CA CYS A 110 -25.175 -23.996 65.882 1.00 48.76 C ATOM 6543 C CYS A 110 -25.698 -23.900 67.319 1.00 45.94 C ATOM 6544 O CYS A 110 -24.931 -23.928 68.268 1.00 46.30 O ATOM 6545 CB CYS A 110 -24.942 -22.621 65.272 1.00 48.67 C ATOM 6546 SG CYS A 110 -24.217 -22.733 63.609 1.00 46.53 S ATOM 6547 N ALA A 111 -26.999 -23.827 67.500 1.00 49.43 N ATOM 6548 CA ALA A 111 -27.542 -23.864 68.864 1.00 45.51 C ATOM 6549 C ALA A 111 -27.220 -25.198 69.561 1.00 45.53 C ATOM 6550 O ALA A 111 -26.539 -25.244 70.586 1.00 48.60 O ATOM 6551 CB ALA A 111 -29.018 -23.600 68.840 1.00 48.56 C ATOM 6552 N ILE A 112 -27.626 -26.301 68.974 1.00 44.14 N ATOM 6553 CA ILE A 112 -27.252 -27.600 69.532 1.00 44.08 C ATOM 6554 C ILE A 112 -25.758 -27.688 69.883 1.00 50.09 C ATOM 6555 O ILE A 112 -25.368 -28.215 70.949 1.00 51.55 O ATOM 6556 CB ILE A 112 -27.683 -28.718 68.566 1.00 45.33 C ATOM 6557 CG1 ILE A 112 -29.226 -28.739 68.526 1.00 45.33 C ATOM 6558 CG2 ILE A 112 -27.185 -30.091 69.000 1.00 41.70 C ATOM 6559 CD1 ILE A 112 -29.848 -29.512 67.382 1.00 45.84 C ATOM 6560 N HIS A 113 -24.909 -27.137 69.022 1.00 51.85 N ATOM 6561 CA HIS A 113 -23.484 -27.163 69.294 1.00 45.62 C ATOM 6562 C HIS A 113 -23.150 -26.546 70.640 1.00 51.46 C ATOM 6563 O HIS A 113 -22.274 -27.058 71.366 1.00 47.73 O ATOM 6564 CB HIS A 113 -22.736 -26.415 68.217 1.00 48.01 C ATOM 6565 CG HIS A 113 -21.253 -26.579 68.296 1.00 45.86 C ATOM 6566 ND1 HIS A 113 -20.623 -27.775 68.037 1.00 44.65 N ATOM 6567 CD2 HIS A 113 -20.280 -25.700 68.615 1.00 45.06 C ATOM 6568 CE1 HIS A 113 -19.320 -27.617 68.162 1.00 45.74 C ATOM 6569 NE2 HIS A 113 -19.086 -26.373 68.524 1.00 44.62 N ATOM 6570 N ALA A 114 -23.835 -25.440 70.964 1.00 50.36 N ATOM 6571 CA ALA A 114 -23.650 -24.745 72.245 1.00 48.80 C ATOM 6572 C ALA A 114 -24.460 -25.392 73.372 1.00 54.83 C ATOM 6573 O ALA A 114 -24.640 -24.789 74.426 1.00 57.08 O ATOM 6574 CB ALA A 114 -24.053 -23.295 72.099 1.00 46.84 C