>>5D4E:HELIX   82 AJ1 GLU D  907  SER D  945  1                                  39    
EKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTS
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 82 AJ1 GLU D 907 SER D 945 1 39 ATOM 19499 N GLU D 907 23.048 2.496 100.722 1.00 17.67 N ATOM 19500 CA GLU D 907 23.904 1.693 99.858 1.00 14.92 C ATOM 19501 C GLU D 907 24.155 2.428 98.544 1.00 15.06 C ATOM 19502 O GLU D 907 23.792 3.594 98.409 1.00 21.01 O ATOM 19503 CB GLU D 907 23.293 0.312 99.621 1.00 15.02 C ATOM 19504 CG GLU D 907 21.779 0.310 99.512 1.00 21.19 C ATOM 19505 CD GLU D 907 21.289 0.778 98.158 1.00 34.36 C ATOM 19506 OE1 GLU D 907 22.077 0.724 97.189 1.00 32.34 O ATOM 19507 OE2 GLU D 907 20.115 1.196 98.063 1.00 43.66 O ATOM 19508 N LYS D 908 24.789 1.752 97.591 1.00 11.25 N ATOM 19509 CA LYS D 908 25.171 2.376 96.327 1.00 14.21 C ATOM 19510 C LYS D 908 24.000 3.025 95.584 1.00 21.15 C ATOM 19511 O LYS D 908 24.074 4.193 95.194 1.00 23.12 O ATOM 19512 CB LYS D 908 25.876 1.364 95.420 1.00 15.67 C ATOM 19513 CG LYS D 908 26.574 1.992 94.223 1.00 15.57 C ATOM 19514 CD LYS D 908 27.367 0.964 93.439 1.00 19.07 C ATOM 19515 CE LYS D 908 26.450 -0.026 92.743 1.00 42.81 C ATOM 19516 NZ LYS D 908 25.588 0.645 91.728 1.00 63.75 N ATOM 19517 N ASN D 909 22.922 2.270 95.397 1.00 21.55 N ATOM 19518 CA ASN D 909 21.763 2.762 94.653 1.00 26.39 C ATOM 19519 C ASN D 909 21.024 3.909 95.340 1.00 24.02 C ATOM 19520 O ASN D 909 20.630 4.876 94.689 1.00 29.95 O ATOM 19521 CB ASN D 909 20.793 1.620 94.343 1.00 33.36 C ATOM 19522 CG ASN D 909 21.332 0.667 93.297 1.00 44.74 C ATOM 19523 OD1 ASN D 909 22.013 1.079 92.357 1.00 40.11 O ATOM 19524 ND2 ASN D 909 21.032 -0.618 93.455 1.00 55.24 N ATOM 19525 N SER D 910 20.834 3.795 96.650 1.00 20.26 N ATOM 19526 CA SER D 910 20.153 4.837 97.408 1.00 20.83 C ATOM 19527 C SER D 910 20.939 6.139 97.348 1.00 20.40 C ATOM 19528 O SER D 910 20.366 7.213 97.164 1.00 23.10 O ATOM 19529 CB SER D 910 19.961 4.411 98.863 1.00 21.67 C ATOM 19530 OG SER D 910 21.206 4.284 99.524 1.00 21.23 O ATOM 19531 N LEU D 911 22.255 6.035 97.498 1.00 16.95 N ATOM 19532 CA LEU D 911 23.125 7.202 97.443 1.00 13.82 C ATOM 19533 C LEU D 911 23.151 7.804 96.046 1.00 16.94 C ATOM 19534 O LEU D 911 23.189 9.024 95.892 1.00 21.75 O ATOM 19535 CB LEU D 911 24.540 6.842 97.893 1.00 11.82 C ATOM 19536 CG LEU D 911 24.713 6.618 99.394 1.00 11.62 C ATOM 19537 CD1 LEU D 911 26.089 6.050 99.693 1.00 13.77 C ATOM 19538 CD2 LEU D 911 24.494 7.918 100.148 1.00 9.59 C ATOM 19539 N LYS D 912 23.129 6.946 95.031 1.00 18.74 N ATOM 19540 CA LYS D 912 23.104 7.413 93.649 1.00 18.92 C ATOM 19541 C LYS D 912 21.824 8.204 93.390 1.00 22.49 C ATOM 19542 O LYS D 912 21.858 9.298 92.812 1.00 25.21 O ATOM 19543 CB LYS D 912 23.222 6.237 92.678 1.00 19.91 C ATOM 19544 CG LYS D 912 23.292 6.642 91.214 1.00 27.86 C ATOM 19545 CD LYS D 912 23.685 5.469 90.324 1.00 29.25 C ATOM 19546 CE LYS D 912 22.711 4.310 90.462 1.00 35.08 C ATOM 19547 NZ LYS D 912 21.334 4.688 90.045 1.00 45.16 N ATOM 19548 N ASP D 913 20.700 7.650 93.839 1.00 22.44 N ATOM 19549 CA ASP D 913 19.410 8.321 93.726 1.00 21.51 C ATOM 19550 C ASP D 913 19.425 9.647 94.471 1.00 20.00 C ATOM 19551 O ASP D 913 18.884 10.643 93.990 1.00 21.52 O ATOM 19552 CB ASP D 913 18.289 7.435 94.271 1.00 24.11 C ATOM 19553 CG ASP D 913 18.037 6.215 93.409 1.00 44.28 C ATOM 19554 OD1 ASP D 913 18.167 6.320 92.169 1.00 45.80 O ATOM 19555 OD2 ASP D 913 17.710 5.148 93.972 1.00 51.28 O ATOM 19556 N LEU D 914 20.048 9.653 95.645 1.00 14.47 N ATOM 19557 CA LEU D 914 20.159 10.867 96.442 1.00 13.10 C ATOM 19558 C LEU D 914 20.913 11.943 95.675 1.00 13.40 C ATOM 19559 O LEU D 914 20.503 13.101 95.651 1.00 14.99 O ATOM 19560 CB LEU D 914 20.861 10.583 97.770 1.00 10.31 C ATOM 19561 CG LEU D 914 21.102 11.817 98.642 1.00 11.37 C ATOM 19562 CD1 LEU D 914 19.783 12.476 99.015 1.00 15.84 C ATOM 19563 CD2 LEU D 914 21.899 11.458 99.885 1.00 14.00 C ATOM 19564 N VAL D 915 22.013 11.549 95.044 1.00 15.35 N ATOM 19565 CA VAL D 915 22.812 12.476 94.252 1.00 16.51 C ATOM 19566 C VAL D 915 22.011 13.032 93.077 1.00 15.35 C ATOM 19567 O VAL D 915 22.020 14.239 92.830 1.00 17.39 O ATOM 19568 CB VAL D 915 24.108 11.816 93.737 1.00 14.31 C ATOM 19569 CG1 VAL D 915 24.808 12.719 92.734 1.00 12.15 C ATOM 19570 CG2 VAL D 915 25.031 11.495 94.899 1.00 15.09 C ATOM 19571 N TYR D 916 21.312 12.153 92.365 1.00 14.11 N ATOM 19572 CA TYR D 916 20.514 12.574 91.215 1.00 14.51 C ATOM 19573 C TYR D 916 19.405 13.554 91.610 1.00 15.86 C ATOM 19574 O TYR D 916 19.228 14.606 90.980 1.00 13.88 O ATOM 19575 CB TYR D 916 19.921 11.357 90.502 1.00 12.32 C ATOM 19576 CG TYR D 916 19.068 11.703 89.304 1.00 11.20 C ATOM 19577 CD1 TYR D 916 19.642 12.179 88.134 1.00 10.73 C ATOM 19578 CD2 TYR D 916 17.690 11.545 89.341 1.00 12.25 C ATOM 19579 CE1 TYR D 916 18.865 12.494 87.036 1.00 13.24 C ATOM 19580 CE2 TYR D 916 16.906 11.853 88.247 1.00 10.62 C ATOM 19581 CZ TYR D 916 17.497 12.330 87.098 1.00 13.05 C ATOM 19582 OH TYR D 916 16.717 12.641 86.006 1.00 14.71 O ATOM 19583 N GLN D 917 18.668 13.205 92.659 1.00 18.65 N ATOM 19584 CA GLN D 917 17.590 14.051 93.158 1.00 18.71 C ATOM 19585 C GLN D 917 18.124 15.393 93.642 1.00 19.17 C ATOM 19586 O GLN D 917 17.514 16.435 93.405 1.00 22.39 O ATOM 19587 CB GLN D 917 16.827 13.347 94.282 1.00 16.47 C ATOM 19588 CG GLN D 917 16.011 12.152 93.819 1.00 19.54 C ATOM 19589 CD GLN D 917 14.892 12.543 92.872 1.00 26.42 C ATOM 19590 OE1 GLN D 917 14.333 13.637 92.967 1.00 31.27 O ATOM 19591 NE2 GLN D 917 14.563 11.648 91.947 1.00 27.49 N ATOM 19592 N ALA D 918 19.269 15.362 94.314 1.00 15.86 N ATOM 19593 CA ALA D 918 19.910 16.585 94.775 1.00 14.68 C ATOM 19594 C ALA D 918 20.334 17.445 93.591 1.00 15.96 C ATOM 19595 O ALA D 918 20.330 18.670 93.674 1.00 19.98 O ATOM 19596 CB ALA D 918 21.105 16.260 95.648 1.00 17.47 C ATOM 19597 N PHE D 919 20.703 16.799 92.491 1.00 14.44 N ATOM 19598 CA PHE D 919 21.080 17.518 91.283 1.00 14.13 C ATOM 19599 C PHE D 919 19.865 18.232 90.710 1.00 16.05 C ATOM 19600 O PHE D 919 19.920 19.429 90.413 1.00 15.46 O ATOM 19601 CB PHE D 919 21.672 16.564 90.245 1.00 13.30 C ATOM 19602 CG PHE D 919 22.292 17.258 89.066 1.00 9.97 C ATOM 19603 CD1 PHE D 919 21.535 17.569 87.950 1.00 12.25 C ATOM 19604 CD2 PHE D 919 23.634 17.596 89.074 1.00 9.86 C ATOM 19605 CE1 PHE D 919 22.103 18.207 86.865 1.00 12.30 C ATOM 19606 CE2 PHE D 919 24.208 18.232 87.992 1.00 10.80 C ATOM 19607 CZ PHE D 919 23.442 18.538 86.887 1.00 12.12 C ATOM 19608 N LEU D 920 18.768 17.490 90.569 1.00 17.10 N ATOM 19609 CA LEU D 920 17.525 18.050 90.043 1.00 14.98 C ATOM 19610 C LEU D 920 17.013 19.214 90.885 1.00 19.74 C ATOM 19611 O LEU D 920 16.806 20.315 90.377 1.00 22.87 O ATOM 19612 CB LEU D 920 16.438 16.975 89.967 1.00 15.96 C ATOM 19613 CG LEU D 920 16.626 15.825 88.978 1.00 15.52 C ATOM 19614 CD1 LEU D 920 15.408 14.916 89.000 1.00 10.81 C ATOM 19615 CD2 LEU D 920 16.877 16.358 87.577 1.00 19.32 C ATOM 19616 N ARG D 921 16.804 18.960 92.172 1.00 21.81 N ATOM 19617 CA ARG D 921 16.228 19.957 93.065 1.00 19.85 C ATOM 19618 C ARG D 921 17.182 21.108 93.371 1.00 21.55 C ATOM 19619 O ARG D 921 16.853 22.272 93.153 1.00 34.42 O ATOM 19620 CB ARG D 921 15.795 19.298 94.377 1.00 20.09 C ATOM 19621 CG ARG D 921 14.770 18.188 94.215 1.00 25.60 C ATOM 19622 CD ARG D 921 13.381 18.748 93.963 1.00 47.52 C ATOM 19623 NE ARG D 921 12.896 19.535 95.095 1.00 55.46 N ATOM 19624 CZ ARG D 921 12.223 19.028 96.124 1.00 52.91 C ATOM 19625 NH1 ARG D 921 11.952 17.731 96.170 1.00 42.76 N ATOM 19626 NH2 ARG D 921 11.821 19.820 97.110 1.00 51.33 N ATOM 19627 N LEU D 922 18.364 20.773 93.877 1.00 17.75 N ATOM 19628 CA LEU D 922 19.284 21.777 94.405 1.00 17.17 C ATOM 19629 C LEU D 922 20.407 22.224 93.467 1.00 18.31 C ATOM 19630 O LEU D 922 21.179 23.118 93.814 1.00 21.25 O ATOM 19631 CB LEU D 922 19.865 21.288 95.730 1.00 18.66 C ATOM 19632 CG LEU D 922 18.782 20.921 96.743 1.00 23.58 C ATOM 19633 CD1 LEU D 922 19.323 19.983 97.804 1.00 26.18 C ATOM 19634 CD2 LEU D 922 18.204 22.177 97.377 1.00 29.59 C ATOM 19635 N GLY D 923 20.506 21.616 92.289 1.00 20.10 N ATOM 19636 CA GLY D 923 21.515 22.033 91.328 1.00 22.91 C ATOM 19637 C GLY D 923 22.926 21.536 91.598 1.00 22.55 C ATOM 19638 O GLY D 923 23.223 20.974 92.659 1.00 27.14 O ATOM 19639 N MET D 924 23.809 21.777 90.632 1.00 17.80 N ATOM 19640 CA MET D 924 25.136 21.166 90.620 1.00 21.46 C ATOM 19641 C MET D 924 26.112 21.677 91.682 1.00 22.95 C ATOM 19642 O MET D 924 26.986 20.935 92.122 1.00 22.52 O ATOM 19643 CB MET D 924 25.764 21.274 89.226 1.00 18.47 C ATOM 19644 CG MET D 924 25.891 22.690 88.703 1.00 24.13 C ATOM 19645 SD MET D 924 26.538 22.740 87.020 1.00 31.30 S ATOM 19646 CE MET D 924 25.239 21.888 86.128 1.00 24.71 C ATOM 19647 N GLU D 925 25.976 22.936 92.086 1.00 26.79 N ATOM 19648 CA GLU D 925 26.868 23.496 93.100 1.00 28.05 C ATOM 19649 C GLU D 925 26.635 22.826 94.453 1.00 21.56 C ATOM 19650 O GLU D 925 27.559 22.268 95.069 1.00 23.74 O ATOM 19651 CB GLU D 925 26.668 25.011 93.211 1.00 32.53 C ATOM 19652 CG GLU D 925 27.693 25.715 94.091 1.00 40.83 C ATOM 19653 CD GLU D 925 27.616 27.230 93.986 1.00 38.53 C ATOM 19654 OE1 GLU D 925 26.708 27.735 93.291 1.00 31.56 O ATOM 19655 OE2 GLU D 925 28.467 27.914 94.595 1.00 37.68 O ATOM 19656 N LYS D 926 25.386 22.870 94.901 1.00 19.88 N ATOM 19657 CA LYS D 926 25.013 22.246 96.160 1.00 22.85 C ATOM 19658 C LYS D 926 25.182 20.735 96.086 1.00 23.40 C ATOM 19659 O LYS D 926 25.516 20.099 97.085 1.00 21.26 O ATOM 19660 CB LYS D 926 23.581 22.616 96.552 1.00 19.29 C ATOM 19661 CG LYS D 926 23.415 24.077 96.933 1.00 24.83 C ATOM 19662 CD LYS D 926 22.028 24.360 97.476 1.00 29.79 C ATOM 19663 CE LYS D 926 21.895 25.813 97.904 1.00 32.09 C ATOM 19664 NZ LYS D 926 20.567 26.092 98.516 1.00 44.43 N ATOM 19665 N THR D 927 24.963 20.162 94.904 1.00 22.29 N ATOM 19666 CA THR D 927 25.175 18.728 94.728 1.00 22.32 C ATOM 19667 C THR D 927 26.655 18.384 94.891 1.00 18.51 C ATOM 19668 O THR D 927 27.002 17.343 95.450 1.00 19.34 O ATOM 19669 CB THR D 927 24.667 18.232 93.363 1.00 19.58 C ATOM 19670 OG1 THR D 927 23.338 18.719 93.145 1.00 19.34 O ATOM 19671 CG2 THR D 927 24.652 16.712 93.320 1.00 15.40 C ATOM 19672 N ALA D 928 27.522 19.270 94.412 1.00 14.42 N ATOM 19673 CA ALA D 928 28.960 19.090 94.558 1.00 14.37 C ATOM 19674 C ALA D 928 29.352 19.152 96.031 1.00 20.10 C ATOM 19675 O ALA D 928 30.126 18.313 96.517 1.00 21.79 O ATOM 19676 CB ALA D 928 29.713 20.139 93.760 1.00 11.38 C ATOM 19677 N ARG D 929 28.811 20.140 96.742 1.00 19.98 N ATOM 19678 CA ARG D 929 29.067 20.243 98.179 1.00 19.90 C ATOM 19679 C ARG D 929 28.592 18.996 98.922 1.00 15.86 C ATOM 19680 O ARG D 929 29.270 18.502 99.830 1.00 15.76 O ATOM 19681 CB ARG D 929 28.428 21.504 98.771 1.00 25.19 C ATOM 19682 CG ARG D 929 29.320 22.737 98.689 1.00 36.09 C ATOM 19683 CD ARG D 929 28.817 23.865 99.581 1.00 39.07 C ATOM 19684 NE ARG D 929 27.605 24.489 99.058 1.00 55.70 N ATOM 19685 CZ ARG D 929 27.599 25.536 98.238 1.00 51.64 C ATOM 19686 NH1 ARG D 929 28.744 26.078 97.842 1.00 45.90 N ATOM 19687 NH2 ARG D 929 26.448 26.041 97.811 1.00 40.54 N ATOM 19688 N LEU D 930 27.432 18.487 98.519 1.00 14.74 N ATOM 19689 CA LEU D 930 26.878 17.268 99.094 1.00 15.20 C ATOM 19690 C LEU D 930 27.816 16.093 98.857 1.00 14.96 C ATOM 19691 O LEU D 930 28.027 15.263 99.742 1.00 12.72 O ATOM 19692 CB LEU D 930 25.507 16.964 98.490 1.00 10.89 C ATOM 19693 CG LEU D 930 24.849 15.666 98.954 1.00 7.04 C ATOM 19694 CD1 LEU D 930 24.586 15.695 100.449 1.00 9.60 C ATOM 19695 CD2 LEU D 930 23.566 15.424 98.193 1.00 10.11 C ATOM 19696 N LEU D 931 28.377 16.033 97.653 1.00 17.29 N ATOM 19697 CA LEU D 931 29.327 14.985 97.303 1.00 15.76 C ATOM 19698 C LEU D 931 30.570 15.036 98.188 1.00 16.45 C ATOM 19699 O LEU D 931 31.014 14.006 98.703 1.00 14.78 O ATOM 19700 CB LEU D 931 29.708 15.078 95.824 1.00 10.28 C ATOM 19701 CG LEU D 931 28.635 14.578 94.858 1.00 10.97 C ATOM 19702 CD1 LEU D 931 28.967 14.955 93.423 1.00 12.62 C ATOM 19703 CD2 LEU D 931 28.474 13.074 94.995 1.00 10.13 C ATOM 19704 N ASP D 932 31.125 16.231 98.372 1.00 14.72 N ATOM 19705 CA ASP D 932 32.295 16.378 99.237 1.00 13.88 C ATOM 19706 C ASP D 932 31.987 16.013 100.693 1.00 14.85 C ATOM 19707 O ASP D 932 32.818 15.411 101.383 1.00 13.61 O ATOM 19708 CB ASP D 932 32.878 17.790 99.140 1.00 18.82 C ATOM 19709 CG ASP D 932 33.819 17.955 97.955 1.00 27.18 C ATOM 19710 OD1 ASP D 932 34.614 17.028 97.686 1.00 19.99 O ATOM 19711 OD2 ASP D 932 33.764 19.014 97.292 1.00 34.37 O ATOM 19712 N ALA D 933 30.788 16.364 101.150 1.00 14.93 N ATOM 19713 CA ALA D 933 30.363 16.031 102.508 1.00 11.71 C ATOM 19714 C ALA D 933 30.248 14.521 102.702 1.00 12.62 C ATOM 19715 O ALA D 933 30.776 13.962 103.672 1.00 15.19 O ATOM 19716 CB ALA D 933 29.042 16.705 102.827 1.00 14.00 C ATOM 19717 N LEU D 934 29.552 13.871 101.772 1.00 12.80 N ATOM 19718 CA LEU D 934 29.385 12.422 101.792 1.00 11.73 C ATOM 19719 C LEU D 934 30.733 11.715 101.754 1.00 12.37 C ATOM 19720 O LEU D 934 30.940 10.721 102.448 1.00 13.16 O ATOM 19721 CB LEU D 934 28.523 11.964 100.615 1.00 10.31 C ATOM 19722 CG LEU D 934 27.036 12.301 100.707 1.00 9.96 C ATOM 19723 CD1 LEU D 934 26.294 11.799 99.480 1.00 9.62 C ATOM 19724 CD2 LEU D 934 26.442 11.711 101.973 1.00 11.83 C ATOM 19725 N LYS D 935 31.642 12.234 100.934 1.00 12.74 N ATOM 19726 CA LYS D 935 33.003 11.718 100.871 1.00 12.93 C ATOM 19727 C LYS D 935 33.665 11.790 102.241 1.00 15.47 C ATOM 19728 O LYS D 935 34.149 10.779 102.767 1.00 16.29 O ATOM 19729 CB LYS D 935 33.826 12.524 99.867 1.00 12.23 C ATOM 19730 CG LYS D 935 35.316 12.244 99.924 1.00 12.32 C ATOM 19731 CD LYS D 935 36.110 13.427 99.400 1.00 15.24 C ATOM 19732 CE LYS D 935 35.875 14.663 100.256 1.00 16.24 C ATOM 19733 NZ LYS D 935 36.599 15.855 99.735 1.00 16.70 N ATOM 19734 N TYR D 936 33.669 12.993 102.814 1.00 14.84 N ATOM 19735 CA TYR D 936 34.322 13.239 104.095 1.00 14.44 C ATOM 19736 C TYR D 936 33.808 12.331 105.208 1.00 16.91 C ATOM 19737 O TYR D 936 34.580 11.593 105.830 1.00 18.37 O ATOM 19738 CB TYR D 936 34.156 14.701 104.509 1.00 13.66 C ATOM 19739 CG TYR D 936 34.724 15.005 105.875 1.00 16.74 C ATOM 19740 CD1 TYR D 936 36.089 15.192 106.053 1.00 19.56 C ATOM 19741 CD2 TYR D 936 33.899 15.103 106.988 1.00 20.05 C ATOM 19742 CE1 TYR D 936 36.616 15.468 107.298 1.00 26.59 C ATOM 19743 CE2 TYR D 936 34.417 15.378 108.238 1.00 26.73 C ATOM 19744 CZ TYR D 936 35.776 15.559 108.388 1.00 32.02 C ATOM 19745 OH TYR D 936 36.299 15.834 109.631 1.00 40.40 O ATOM 19746 N TYR D 937 32.505 12.383 105.457 1.00 16.82 N ATOM 19747 CA TYR D 937 31.936 11.598 106.545 1.00 17.23 C ATOM 19748 C TYR D 937 32.020 10.101 106.268 1.00 15.49 C ATOM 19749 O TYR D 937 32.205 9.303 107.186 1.00 16.71 O ATOM 19750 CB TYR D 937 30.501 12.030 106.837 1.00 19.49 C ATOM 19751 CG TYR D 937 30.418 13.380 107.510 1.00 20.66 C ATOM 19752 CD1 TYR D 937 30.759 13.530 108.847 1.00 16.86 C ATOM 19753 CD2 TYR D 937 30.006 14.504 106.809 1.00 24.04 C ATOM 19754 CE1 TYR D 937 30.691 14.761 109.469 1.00 19.72 C ATOM 19755 CE2 TYR D 937 29.933 15.742 107.423 1.00 25.96 C ATOM 19756 CZ TYR D 937 30.276 15.864 108.753 1.00 22.76 C ATOM 19757 OH TYR D 937 30.205 17.094 109.369 1.00 19.61 O ATOM 19758 N GLY D 938 31.896 9.730 104.999 1.00 15.52 N ATOM 19759 CA GLY D 938 32.025 8.343 104.593 1.00 16.19 C ATOM 19760 C GLY D 938 33.379 7.778 104.973 1.00 17.02 C ATOM 19761 O GLY D 938 33.460 6.734 105.625 1.00 16.69 O ATOM 19762 N PHE D 939 34.443 8.470 104.570 1.00 17.60 N ATOM 19763 CA PHE D 939 35.799 8.070 104.939 1.00 18.20 C ATOM 19764 C PHE D 939 35.972 8.044 106.458 1.00 17.52 C ATOM 19765 O PHE D 939 36.468 7.061 107.027 1.00 17.48 O ATOM 19766 CB PHE D 939 36.828 9.023 104.323 1.00 17.12 C ATOM 19767 CG PHE D 939 37.084 8.787 102.861 1.00 15.88 C ATOM 19768 CD1 PHE D 939 36.847 7.549 102.289 1.00 19.28 C ATOM 19769 CD2 PHE D 939 37.571 9.806 102.059 1.00 17.30 C ATOM 19770 CE1 PHE D 939 37.089 7.333 100.944 1.00 16.30 C ATOM 19771 CE2 PHE D 939 37.813 9.596 100.714 1.00 13.48 C ATOM 19772 CZ PHE D 939 37.572 8.358 100.157 1.00 13.69 C ATOM 19773 N THR D 940 35.553 9.133 107.101 1.00 19.50 N ATOM 19774 CA THR D 940 35.697 9.294 108.546 1.00 21.83 C ATOM 19775 C THR D 940 35.096 8.125 109.318 1.00 21.49 C ATOM 19776 O THR D 940 35.703 7.604 110.254 1.00 21.84 O ATOM 19777 CB THR D 940 35.026 10.590 109.031 1.00 15.68 C ATOM 19778 OG1 THR D 940 35.520 11.701 108.274 1.00 21.96 O ATOM 19779 CG2 THR D 940 35.312 10.818 110.505 1.00 15.40 C ATOM 19780 N PHE D 941 33.902 7.714 108.915 1.00 18.36 N ATOM 19781 CA PHE D 941 33.208 6.631 109.592 1.00 18.17 C ATOM 19782 C PHE D 941 33.752 5.266 109.196 1.00 23.24 C ATOM 19783 O PHE D 941 33.773 4.344 110.010 1.00 27.70 O ATOM 19784 CB PHE D 941 31.706 6.722 109.333 1.00 17.73 C ATOM 19785 CG PHE D 941 31.055 7.887 110.012 1.00 20.32 C ATOM 19786 CD1 PHE D 941 31.458 8.272 111.281 1.00 19.89 C ATOM 19787 CD2 PHE D 941 30.056 8.610 109.382 1.00 19.31 C ATOM 19788 CE1 PHE D 941 30.870 9.347 111.914 1.00 15.54 C ATOM 19789 CE2 PHE D 941 29.463 9.688 110.010 1.00 20.10 C ATOM 19790 CZ PHE D 941 29.872 10.057 111.278 1.00 19.13 C ATOM 19791 N SER D 942 34.199 5.138 107.950 1.00 22.94 N ATOM 19792 CA SER D 942 34.773 3.879 107.490 1.00 23.40 C ATOM 19793 C SER D 942 36.055 3.560 108.253 1.00 20.71 C ATOM 19794 O SER D 942 36.366 2.394 108.493 1.00 20.84 O ATOM 19795 CB SER D 942 35.045 3.909 105.982 1.00 20.84 C ATOM 19796 OG SER D 942 36.140 4.753 105.669 1.00 21.19 O ATOM 19797 N THR D 943 36.793 4.599 108.638 1.00 20.95 N ATOM 19798 CA THR D 943 38.028 4.410 109.399 1.00 18.05 C ATOM 19799 C THR D 943 37.794 3.742 110.755 1.00 19.36 C ATOM 19800 O THR D 943 38.385 2.707 111.059 1.00 17.31 O ATOM 19801 CB THR D 943 38.770 5.742 109.625 1.00 16.54 C ATOM 19802 OG1 THR D 943 39.205 6.269 108.366 1.00 21.52 O ATOM 19803 CG2 THR D 943 39.979 5.533 110.524 1.00 13.08 C ATOM 19804 N THR D 944 36.925 4.339 111.563 1.00 24.30 N ATOM 19805 CA THR D 944 36.698 3.880 112.930 1.00 21.72 C ATOM 19806 C THR D 944 35.634 2.790 113.015 1.00 21.58 C ATOM 19807 O THR D 944 35.314 2.312 114.103 1.00 18.01 O ATOM 19808 CB THR D 944 36.287 5.046 113.843 1.00 21.59 C ATOM 19809 OG1 THR D 944 35.025 5.571 113.412 1.00 21.12 O ATOM 19810 CG2 THR D 944 37.334 6.149 113.796 1.00 17.89 C ATOM 19811 N SER D 945 35.091 2.405 111.865 1.00 28.45 N ATOM 19812 CA SER D 945 34.035 1.398 111.797 1.00 29.68 C ATOM 19813 C SER D 945 34.466 0.047 112.361 1.00 26.67 C ATOM 19814 O SER D 945 33.668 -0.665 112.970 1.00 29.24 O ATOM 19815 CB SER D 945 33.571 1.217 110.351 1.00 32.07 C ATOM 19816 OG SER D 945 34.661 0.880 109.509 1.00 28.83 O