>>5EPG:HELIX   40 AE4 SER A  985  ASN A 1000  1                                  16    
SYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKGTWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAIDIGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGELGVFLGCSVFFAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNV
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 40 AE4 SER A 985 ASN A 1000 1 16 ATOM 7292 N SER A 985 -46.235 8.270 -29.563 1.00 96.24 N ATOM 7293 CA SER A 985 -46.877 9.033 -28.491 1.00104.83 C ATOM 7294 C SER A 985 -46.807 8.232 -27.194 1.00111.04 C ATOM 7295 O SER A 985 -47.810 7.958 -26.536 1.00107.71 O ATOM 7296 CB SER A 985 -48.298 9.442 -28.852 1.00107.72 C ATOM 7297 OG SER A 985 -48.237 10.664 -29.550 1.00117.95 O ATOM 7298 N TYR A 986 -45.577 7.864 -26.851 1.00117.06 N ATOM 7299 CA TYR A 986 -45.275 6.991 -25.718 1.00117.72 C ATOM 7300 C TYR A 986 -45.766 7.550 -24.381 1.00124.04 C ATOM 7301 O TYR A 986 -46.448 6.855 -23.623 1.00120.99 O ATOM 7302 CB TYR A 986 -43.760 6.794 -25.652 1.00114.55 C ATOM 7303 CG TYR A 986 -43.354 5.863 -24.552 1.00116.44 C ATOM 7304 CD1 TYR A 986 -43.322 4.494 -24.767 1.00115.30 C ATOM 7305 CD2 TYR A 986 -43.039 6.340 -23.276 1.00121.78 C ATOM 7306 CE1 TYR A 986 -42.965 3.617 -23.757 1.00113.74 C ATOM 7307 CE2 TYR A 986 -42.678 5.471 -22.260 1.00118.40 C ATOM 7308 CZ TYR A 986 -42.642 4.109 -22.515 1.00111.59 C ATOM 7309 OH TYR A 986 -42.294 3.219 -21.540 1.00108.45 O ATOM 7310 N SER A 987 -45.416 8.803 -24.104 1.00131.32 N ATOM 7311 CA SER A 987 -45.716 9.444 -22.817 1.00121.42 C ATOM 7312 C SER A 987 -47.215 9.527 -22.535 1.00123.18 C ATOM 7313 O SER A 987 -47.642 9.245 -21.420 1.00100.37 O ATOM 7314 CB SER A 987 -45.111 10.845 -22.785 1.00117.23 C ATOM 7315 OG SER A 987 -44.234 11.013 -23.878 1.00111.93 O ATOM 7316 N LEU A 988 -48.005 9.903 -23.543 1.00124.16 N ATOM 7317 CA LEU A 988 -49.467 9.972 -23.409 1.00118.66 C ATOM 7318 C LEU A 988 -50.096 8.586 -23.207 1.00121.59 C ATOM 7319 O LEU A 988 -50.960 8.402 -22.349 1.00131.47 O ATOM 7320 CB LEU A 988 -50.072 10.593 -24.677 1.00114.06 C ATOM 7321 CG LEU A 988 -49.830 12.084 -24.956 1.00112.59 C ATOM 7322 CD1 LEU A 988 -49.176 12.344 -26.309 1.00107.59 C ATOM 7323 CD2 LEU A 988 -51.135 12.857 -24.840 1.00107.37 C ATOM 7324 N ARG A 989 -49.655 7.618 -24.000 1.00120.69 N ATOM 7325 CA ARG A 989 -50.125 6.245 -23.859 1.00113.53 C ATOM 7326 C ARG A 989 -49.659 5.564 -22.576 1.00110.69 C ATOM 7327 O ARG A 989 -50.294 4.614 -22.124 1.00101.96 O ATOM 7328 CB ARG A 989 -49.708 5.414 -25.043 1.00113.62 C ATOM 7329 CG ARG A 989 -50.341 5.859 -26.335 1.00106.88 C ATOM 7330 CD ARG A 989 -49.616 5.169 -27.464 1.00109.91 C ATOM 7331 NE ARG A 989 -49.599 3.718 -27.288 1.00109.02 N ATOM 7332 CZ ARG A 989 -48.793 2.890 -27.950 1.00123.34 C ATOM 7333 NH1 ARG A 989 -47.922 3.340 -28.853 1.00131.20 N ATOM 7334 NH2 ARG A 989 -48.862 1.595 -27.710 1.00127.51 N ATOM 7335 N LYS A 990 -48.552 6.024 -21.996 1.00106.00 N ATOM 7336 CA LYS A 990 -48.082 5.476 -20.717 1.00109.21 C ATOM 7337 C LYS A 990 -49.104 5.736 -19.604 1.00115.70 C ATOM 7338 O LYS A 990 -49.459 4.816 -18.867 1.00117.45 O ATOM 7339 CB LYS A 990 -46.695 5.998 -20.307 1.00113.12 C ATOM 7340 CG LYS A 990 -46.158 5.431 -18.983 1.00107.60 C ATOM 7341 CD LYS A 990 -45.673 3.990 -19.142 1.00116.80 C ATOM 7342 CE LYS A 990 -45.799 3.148 -17.868 1.00118.15 C ATOM 7343 NZ LYS A 990 -45.817 1.677 -18.156 1.00111.05 N ATOM 7344 N VAL A 991 -49.590 6.967 -19.493 1.00120.43 N ATOM 7345 CA VAL A 991 -50.615 7.307 -18.494 1.00120.77 C ATOM 7346 C VAL A 991 -51.969 6.665 -18.808 1.00121.50 C ATOM 7347 O VAL A 991 -52.723 6.353 -17.895 1.00132.81 O ATOM 7348 CB VAL A 991 -50.745 8.830 -18.276 1.00118.50 C ATOM 7349 CG1 VAL A 991 -49.429 9.391 -17.750 1.00125.08 C ATOM 7350 CG2 VAL A 991 -51.159 9.539 -19.554 1.00120.28 C ATOM 7351 N ALA A 992 -52.264 6.461 -20.089 1.00116.68 N ATOM 7352 CA ALA A 992 -53.458 5.725 -20.508 1.00113.01 C ATOM 7353 C ALA A 992 -53.453 4.278 -19.982 1.00111.99 C ATOM 7354 O ALA A 992 -54.490 3.772 -19.542 1.00104.95 O ATOM 7355 CB ALA A 992 -53.582 5.752 -22.019 1.00116.58 C ATOM 7356 N VAL A 993 -52.284 3.635 -20.016 1.00109.71 N ATOM 7357 CA VAL A 993 -52.110 2.269 -19.510 1.00112.02 C ATOM 7358 C VAL A 993 -52.132 2.207 -17.976 1.00105.30 C ATOM 7359 O VAL A 993 -52.696 1.280 -17.400 1.00 90.21 O ATOM 7360 CB VAL A 993 -50.783 1.670 -20.044 1.00109.71 C ATOM 7361 CG1 VAL A 993 -50.379 0.392 -19.310 1.00105.97 C ATOM 7362 CG2 VAL A 993 -50.927 1.398 -21.527 1.00109.62 C ATOM 7363 N GLU A 994 -51.507 3.178 -17.321 1.00107.85 N ATOM 7364 CA GLU A 994 -51.564 3.295 -15.852 1.00119.56 C ATOM 7365 C GLU A 994 -52.993 3.556 -15.376 1.00109.93 C ATOM 7366 O GLU A 994 -53.422 3.010 -14.366 1.00 91.01 O ATOM 7367 CB GLU A 994 -50.643 4.410 -15.336 1.00135.25 C ATOM 7368 CG GLU A 994 -49.150 4.076 -15.350 1.00143.00 C ATOM 7369 CD GLU A 994 -48.260 5.316 -15.274 1.00139.83 C ATOM 7370 OE1 GLU A 994 -48.649 6.300 -14.602 1.00115.32 O ATOM 7371 OE2 GLU A 994 -47.171 5.310 -15.895 1.00143.64 O ATOM 7372 N LYS A 995 -53.706 4.406 -16.117 1.00114.38 N ATOM 7373 CA LYS A 995 -55.124 4.742 -15.884 1.00118.39 C ATOM 7374 C LYS A 995 -56.015 3.513 -15.992 1.00118.73 C ATOM 7375 O LYS A 995 -56.867 3.267 -15.127 1.00110.13 O ATOM 7376 CB LYS A 995 -55.580 5.758 -16.959 1.00108.83 C ATOM 7377 CG LYS A 995 -57.041 6.189 -16.953 1.00110.80 C ATOM 7378 CD LYS A 995 -57.304 7.190 -18.083 1.00118.84 C ATOM 7379 CE LYS A 995 -58.555 8.046 -17.862 1.00120.95 C ATOM 7380 NZ LYS A 995 -59.813 7.257 -17.696 1.00116.34 N ATOM 7381 N PHE A 996 -55.823 2.774 -17.085 1.00118.03 N ATOM 7382 CA PHE A 996 -56.530 1.523 -17.337 1.00109.14 C ATOM 7383 C PHE A 996 -56.318 0.560 -16.167 1.00102.58 C ATOM 7384 O PHE A 996 -57.278 0.096 -15.560 1.00 98.45 O ATOM 7385 CB PHE A 996 -56.070 0.923 -18.684 1.00108.41 C ATOM 7386 CG PHE A 996 -56.735 -0.389 -19.043 1.00100.82 C ATOM 7387 CD1 PHE A 996 -56.218 -1.605 -18.584 1.00101.21 C ATOM 7388 CD2 PHE A 996 -57.856 -0.413 -19.855 1.00 92.82 C ATOM 7389 CE1 PHE A 996 -56.818 -2.807 -18.911 1.00 92.95 C ATOM 7390 CE2 PHE A 996 -58.453 -1.606 -20.193 1.00 89.29 C ATOM 7391 CZ PHE A 996 -57.937 -2.804 -19.713 1.00 94.76 C ATOM 7392 N ASN A 997 -55.059 0.310 -15.826 1.00101.08 N ATOM 7393 CA ASN A 997 -54.711 -0.675 -14.784 1.00 97.39 C ATOM 7394 C ASN A 997 -55.208 -0.328 -13.389 1.00107.75 C ATOM 7395 O ASN A 997 -55.411 -1.221 -12.580 1.00 95.86 O ATOM 7396 CB ASN A 997 -53.208 -0.913 -14.708 1.00 95.41 C ATOM 7397 CG ASN A 997 -52.643 -1.482 -15.986 1.00 93.90 C ATOM 7398 OD1 ASN A 997 -53.314 -2.233 -16.683 1.00 92.79 O ATOM 7399 ND2 ASN A 997 -51.397 -1.119 -16.305 1.00 93.14 N ATOM 7400 N ALA A 998 -55.403 0.957 -13.117 1.00119.55 N ATOM 7401 CA ALA A 998 -56.049 1.413 -11.887 1.00126.40 C ATOM 7402 C ALA A 998 -57.570 1.129 -11.867 1.00133.57 C ATOM 7403 O ALA A 998 -58.174 1.066 -10.790 1.00122.67 O ATOM 7404 CB ALA A 998 -55.796 2.901 -11.711 1.00123.02 C ATOM 7405 N GLU A 999 -58.179 0.970 -13.044 1.00138.15 N ATOM 7406 CA GLU A 999 -59.623 0.769 -13.199 1.00128.27 C ATOM 7407 C GLU A 999 -60.010 -0.688 -13.553 1.00129.99 C ATOM 7408 O GLU A 999 -61.196 -0.995 -13.651 1.00157.94 O ATOM 7409 CB GLU A 999 -60.141 1.650 -14.355 1.00112.30 C ATOM 7410 CG GLU A 999 -59.996 3.158 -14.204 1.00112.83 C ATOM 7411 CD GLU A 999 -60.339 3.930 -15.488 1.00113.66 C ATOM 7412 OE1 GLU A 999 -60.125 3.406 -16.598 1.00131.51 O ATOM 7413 OE2 GLU A 999 -60.805 5.084 -15.411 1.00106.66 O ATOM 7414 N ASN A1000 -59.028 -1.568 -13.741 1.00111.25 N ATOM 7415 CA ASN A1000 -59.284 -2.925 -14.151 1.00103.30 C ATOM 7416 C ASN A1000 -58.439 -3.916 -13.384 1.00102.27 C ATOM 7417 O ASN A1000 -57.225 -3.834 -13.411 1.00101.42 O ATOM 7418 CB ASN A1000 -59.002 -3.050 -15.639 1.00113.60 C ATOM 7419 CG ASN A1000 -60.125 -2.478 -16.494 1.00129.07 C ATOM 7420 OD1 ASN A1000 -61.253 -2.965 -16.441 1.00141.70 O ATOM 7421 ND2 ASN A1000 -59.826 -1.450 -17.287 1.00128.20 N ATOM 7422 N TYR A1001 -59.093 -4.835 -12.691 1.00104.99 N ATOM 7423 CA TYR A1001 -58.441 -5.778 -11.774 1.00101.11 C ATOM 7424 C TYR A1001 -58.083 -7.092 -12.449 1.00104.28 C ATOM 7425 O TYR A1001 -57.021 -7.647 -12.162 1.00107.66 O ATOM 7426 CB TYR A1001 -59.329 -6.099 -10.575 1.00 98.49 C ATOM 7427 CG TYR A1001 -58.618 -6.769 -9.398 1.00 96.65 C ATOM 7428 CD1 TYR A1001 -57.735 -6.051 -8.586 1.00 98.53 C ATOM 7429 CD2 TYR A1001 -58.857 -8.103 -9.075 1.00 92.92 C ATOM 7430 CE1 TYR A1001 -57.095 -6.646 -7.501 1.00 96.73 C ATOM 7431 CE2 TYR A1001 -58.225 -8.709 -7.995 1.00 95.37 C ATOM 7432 CZ TYR A1001 -57.346 -7.980 -7.204 1.00 98.66 C ATOM 7433 OH TYR A1001 -56.718 -8.578 -6.117 1.00 98.82 O ATOM 7434 N TRP A1002 -58.950 -7.583 -13.349 1.00106.25 N ATOM 7435 CA TRP A1002 -58.726 -8.849 -14.053 1.00111.42 C ATOM 7436 C TRP A1002 -58.135 -8.747 -15.485 1.00116.96 C ATOM 7437 O TRP A1002 -57.828 -9.780 -16.090 1.00112.97 O ATOM 7438 CB TRP A1002 -60.042 -9.577 -14.105 1.00112.77 C ATOM 7439 CG TRP A1002 -60.615 -9.886 -12.765 1.00108.58 C ATOM 7440 CD1 TRP A1002 -61.841 -9.517 -12.312 1.00101.47 C ATOM 7441 CD2 TRP A1002 -60.009 -10.663 -11.712 1.00107.90 C ATOM 7442 NE1 TRP A1002 -62.045 -10.011 -11.049 1.00101.76 N ATOM 7443 CE2 TRP A1002 -60.940 -10.717 -10.651 1.00 99.46 C ATOM 7444 CE3 TRP A1002 -58.776 -11.319 -11.565 1.00109.70 C ATOM 7445 CZ2 TRP A1002 -60.683 -11.397 -9.445 1.00 89.13 C ATOM 7446 CZ3 TRP A1002 -58.520 -11.993 -10.365 1.00110.77 C ATOM 7447 CH2 TRP A1002 -59.478 -12.019 -9.317 1.00 96.14 C ATOM 7448 N LYS A1003 -58.020 -7.523 -16.001 1.00117.77 N ATOM 7449 CA LYS A1003 -57.397 -7.248 -17.299 1.00108.75 C ATOM 7450 C LYS A1003 -56.426 -6.079 -17.151 1.00113.46 C ATOM 7451 O LYS A1003 -56.852 -5.031 -16.751 1.00126.96 O ATOM 7452 CB LYS A1003 -58.481 -6.907 -18.321 1.00104.85 C ATOM 7453 CG LYS A1003 -59.435 -8.057 -18.625 1.00 98.06 C ATOM 7454 CD LYS A1003 -59.384 -8.486 -20.081 1.00 89.92 C ATOM 7455 CE LYS A1003 -59.802 -9.933 -20.262 1.00 89.23 C ATOM 7456 NZ LYS A1003 -61.247 -10.083 -20.562 1.00 92.04 N ATOM 7457 N LYS A1004 -55.154 -6.282 -17.507 1.00105.06 N ATOM 7458 CA LYS A1004 -54.149 -5.232 -17.410 1.00105.82 C ATOM 7459 C LYS A1004 -53.512 -4.946 -18.762 1.00104.51 C ATOM 7460 O LYS A1004 -53.424 -5.834 -19.608 1.00123.92 O ATOM 7461 CB LYS A1004 -53.069 -5.678 -16.439 1.00108.06 C ATOM 7462 CG LYS A1004 -53.558 -5.805 -15.014 1.00113.83 C ATOM 7463 CD LYS A1004 -53.711 -4.443 -14.343 1.00120.12 C ATOM 7464 CE LYS A1004 -54.109 -4.605 -12.886 1.00119.39 C ATOM 7465 NZ LYS A1004 -53.948 -3.360 -12.096 1.00123.81 N ATOM 7466 N LYS A1005 -53.096 -3.702 -18.957 1.00 93.98 N ATOM 7467 CA LYS A1005 -52.288 -3.337 -20.097 1.00 93.08 C ATOM 7468 C LYS A1005 -50.856 -3.099 -19.686 1.00 98.17 C ATOM 7469 O LYS A1005 -50.568 -2.880 -18.514 1.00100.84 O ATOM 7470 CB LYS A1005 -52.815 -2.085 -20.768 1.00 89.88 C ATOM 7471 CG LYS A1005 -54.097 -2.295 -21.523 1.00 86.02 C ATOM 7472 CD LYS A1005 -54.441 -1.046 -22.315 1.00 84.84 C ATOM 7473 CE LYS A1005 -55.938 -0.809 -22.394 1.00 84.71 C ATOM 7474 NZ LYS A1005 -56.295 -0.113 -23.654 1.00 89.12 N ATOM 7475 N GLY A1006 -49.957 -3.187 -20.657 1.00102.60 N ATOM 7476 CA GLY A1006 -48.552 -2.890 -20.461 1.00 96.61 C ATOM 7477 C GLY A1006 -47.950 -2.288 -21.723 1.00 93.16 C ATOM 7478 O GLY A1006 -48.444 -2.497 -22.829 1.00 84.20 O ATOM 7479 N LEU A1007 -46.869 -1.515 -21.530 1.00 95.74 N ATOM 7480 CA LEU A1007 -46.134 -0.905 -22.609 1.00 95.34 C ATOM 7481 C LEU A1007 -44.647 -1.078 -22.329 1.00 94.71 C ATOM 7482 O LEU A1007 -44.202 -1.080 -21.182 1.00 89.92 O ATOM 7483 CB LEU A1007 -46.434 0.582 -22.607 1.00 97.73 C ATOM 7484 CG LEU A1007 -46.099 1.329 -23.887 1.00104.15 C ATOM 7485 CD1 LEU A1007 -47.064 0.933 -24.993 1.00109.69 C ATOM 7486 CD2 LEU A1007 -46.184 2.818 -23.642 1.00109.93 C ATOM 7487 N ALA A1008 -43.882 -1.236 -23.399 1.00 93.39 N ATOM 7488 CA ALA A1008 -42.428 -1.338 -23.307 1.00 93.35 C ATOM 7489 C ALA A1008 -41.784 -0.707 -24.524 1.00 95.85 C ATOM 7490 O ALA A1008 -42.391 -0.653 -25.575 1.00 94.97 O ATOM 7491 CB ALA A1008 -41.994 -2.789 -23.234 1.00 87.39 C ATOM 7492 N MET A1009 -40.543 -0.249 -24.366 1.00101.56 N ATOM 7493 CA MET A1009 -39.733 0.174 -25.496 1.00104.45 C ATOM 7494 C MET A1009 -38.283 -0.303 -25.317 1.00106.13 C ATOM 7495 O MET A1009 -37.664 -0.101 -24.260 1.00103.27 O ATOM 7496 CB MET A1009 -39.775 1.694 -25.654 1.00 98.23 C ATOM 7497 CG MET A1009 -39.052 2.148 -26.914 1.00100.71 C ATOM 7498 SD MET A1009 -38.983 3.911 -27.198 1.00 90.83 S ATOM 7499 CE MET A1009 -40.721 4.265 -27.396 1.00 90.71 C ATOM 7500 N VAL A1010 -37.766 -0.939 -26.374 1.00 93.07 N ATOM 7501 CA VAL A1010 -36.401 -1.442 -26.401 1.00 94.72 C ATOM 7502 C VAL A1010 -35.688 -0.813 -27.602 1.00 95.84 C ATOM 7503 O VAL A1010 -36.317 -0.590 -28.637 1.00 90.50 O ATOM 7504 CB VAL A1010 -36.342 -2.986 -26.518 1.00 95.51 C ATOM 7505 CG1 VAL A1010 -37.049 -3.633 -25.346 1.00 96.40 C ATOM 7506 CG2 VAL A1010 -36.953 -3.484 -27.820 1.00 99.30 C ATOM 7507 N PRO A1011 -34.383 -0.505 -27.452 1.00100.57 N ATOM 7508 CA PRO A1011 -33.554 -0.004 -28.556 1.00101.56 C ATOM 7509 C PRO A1011 -32.738 -1.145 -29.210 1.00109.02 C ATOM 7510 O PRO A1011 -32.613 -2.253 -28.645 1.00103.34 O ATOM 7511 CB PRO A1011 -32.639 0.971 -27.845 1.00 98.45 C ATOM 7512 CG PRO A1011 -32.403 0.293 -26.516 1.00 98.67 C ATOM 7513 CD PRO A1011 -33.589 -0.576 -26.211 1.00 96.34 C ATOM 7514 N LEU A1012 -32.171 -0.853 -30.378 1.00105.23 N ATOM 7515 CA LEU A1012 -31.407 -1.820 -31.147 1.00 97.66 C ATOM 7516 C LEU A1012 -30.097 -1.208 -31.617 1.00 99.16 C ATOM 7517 O LEU A1012 -30.105 -0.187 -32.312 1.00 92.71 O ATOM 7518 CB LEU A1012 -32.270 -2.229 -32.322 1.00100.33 C ATOM 7519 CG LEU A1012 -31.819 -3.410 -33.159 1.00102.83 C ATOM 7520 CD1 LEU A1012 -32.338 -4.713 -32.575 1.00 95.29 C ATOM 7521 CD2 LEU A1012 -32.305 -3.195 -34.586 1.00107.63 C ATOM 7522 N LYS A1013 -28.974 -1.825 -31.232 1.00 93.76 N ATOM 7523 CA LYS A1013 -27.739 -1.734 -32.012 1.00 97.59 C ATOM 7524 C LYS A1013 -27.421 -3.155 -32.460 1.00106.74 C ATOM 7525 O LYS A1013 -27.112 -4.016 -31.613 1.00110.55 O ATOM 7526 CB LYS A1013 -26.582 -1.160 -31.185 1.00 99.99 C ATOM 7527 CG LYS A1013 -25.249 -1.092 -31.940 1.00101.62 C ATOM 7528 CD LYS A1013 -24.123 -0.370 -31.192 1.00 91.86 C ATOM 7529 CE LYS A1013 -23.544 -1.162 -30.013 1.00 88.83 C ATOM 7530 NZ LYS A1013 -23.214 -2.602 -30.242 1.00 88.41 N ATOM 7531 N PHE A1014 -27.561 -3.411 -33.763 1.00110.01 N ATOM 7532 CA PHE A1014 -27.275 -4.722 -34.322 1.00104.73 C ATOM 7533 C PHE A1014 -26.054 -4.606 -35.233 1.00101.69 C ATOM 7534 O PHE A1014 -26.151 -4.079 -36.354 1.00101.54 O ATOM 7535 CB PHE A1014 -28.447 -5.279 -35.122 1.00103.78 C ATOM 7536 CG PHE A1014 -28.199 -6.665 -35.656 1.00 99.92 C ATOM 7537 CD1 PHE A1014 -28.104 -7.737 -34.792 1.00100.76 C ATOM 7538 CD2 PHE A1014 -28.053 -6.895 -37.012 1.00 97.31 C ATOM 7539 CE1 PHE A1014 -27.874 -9.013 -35.264 1.00 98.83 C ATOM 7540 CE2 PHE A1014 -27.825 -8.169 -37.495 1.00 94.21 C ATOM 7541 CZ PHE A1014 -27.736 -9.230 -36.619 1.00 94.69 C ATOM 7542 N PRO A1015 -24.888 -5.093 -34.750 1.00 98.00 N ATOM 7543 CA PRO A1015 -23.679 -5.053 -35.576 1.00 92.61 C ATOM 7544 C PRO A1015 -23.709 -6.123 -36.633 1.00 88.47 C ATOM 7545 O PRO A1015 -24.301 -7.176 -36.432 1.00 88.26 O ATOM 7546 CB PRO A1015 -22.559 -5.398 -34.588 1.00 93.77 C ATOM 7547 CG PRO A1015 -23.190 -5.472 -33.230 1.00 97.55 C ATOM 7548 CD PRO A1015 -24.638 -5.746 -33.454 1.00 93.53 C ATOM 7549 N VAL A1016 -23.035 -5.837 -37.742 1.00 93.84 N ATOM 7550 CA VAL A1016 -23.017 -6.709 -38.919 1.00 98.99 C ATOM 7551 C VAL A1016 -21.568 -6.917 -39.368 1.00 97.21 C ATOM 7552 O VAL A1016 -20.790 -5.968 -39.461 1.00 91.14 O ATOM 7553 CB VAL A1016 -23.854 -6.049 -40.050 1.00 97.22 C ATOM 7554 CG1 VAL A1016 -23.666 -6.747 -41.385 1.00 92.84 C ATOM 7555 CG2 VAL A1016 -25.327 -6.018 -39.668 1.00 97.25 C ATOM 7556 N GLY A1017 -21.232 -8.167 -39.646 1.00 99.37 N ATOM 7557 CA GLY A1017 -19.865 -8.534 -39.993 1.00101.22 C ATOM 7558 C GLY A1017 -19.601 -9.973 -39.638 1.00101.05 C ATOM 7559 O GLY A1017 -20.171 -10.484 -38.672 1.00100.06 O ATOM 7560 N LEU A1018 -18.686 -10.592 -40.387 1.00101.59 N ATOM 7561 CA LEU A1018 -18.324 -11.980 -40.191 1.00107.43 C ATOM 7562 C LEU A1018 -16.893 -12.005 -39.634 1.00112.10 C ATOM 7563 O LEU A1018 -16.301 -10.960 -39.428 1.00120.59 O ATOM 7564 CB LEU A1018 -18.472 -12.727 -41.509 1.00106.73 C ATOM 7565 CG LEU A1018 -19.792 -12.355 -42.224 1.00 99.47 C ATOM 7566 CD1 LEU A1018 -19.607 -12.384 -43.747 1.00 91.58 C ATOM 7567 CD2 LEU A1018 -20.975 -13.197 -41.706 1.00 92.55 C ATOM 7568 N GLY A1019 -16.369 -13.192 -39.357 1.00117.61 N ATOM 7569 CA GLY A1019 -15.125 -13.304 -38.575 1.00128.33 C ATOM 7570 C GLY A1019 -13.879 -12.798 -39.266 1.00128.15 C ATOM 7571 O GLY A1019 -13.004 -12.148 -38.651 1.00119.99 O ATOM 7572 N SER A1020 -13.792 -13.068 -40.579 1.00122.45 N ATOM 7573 CA SER A1020 -12.642 -12.672 -41.381 1.00120.54 C ATOM 7574 C SER A1020 -13.050 -12.018 -42.693 1.00107.33 C ATOM 7575 O SER A1020 -14.225 -12.007 -43.084 1.00 93.25 O ATOM 7576 CB SER A1020 -11.736 -13.873 -41.664 1.00127.31 C ATOM 7577 OG SER A1020 -12.239 -14.665 -42.724 1.00130.01 O ATOM 7578 N ARG A1021 -12.055 -11.437 -43.350 1.00105.60 N ATOM 7579 CA ARG A1021 -12.232 -10.889 -44.694 1.00108.82 C ATOM 7580 C ARG A1021 -12.622 -11.985 -45.683 1.00109.08 C ATOM 7581 O ARG A1021 -13.484 -11.770 -46.523 1.00112.98 O ATOM 7582 CB ARG A1021 -10.954 -10.235 -45.189 1.00107.90 C ATOM 7583 CG ARG A1021 -11.162 -9.335 -46.394 1.00107.24 C ATOM 7584 CD ARG A1021 -9.887 -9.279 -47.209 1.00119.62 C ATOM 7585 NE ARG A1021 -9.846 -8.205 -48.210 1.00133.92 N ATOM 7586 CZ ARG A1021 -8.881 -8.061 -49.130 1.00129.79 C ATOM 7587 NH1 ARG A1021 -7.857 -8.913 -49.194 1.00122.19 N ATOM 7588 NH2 ARG A1021 -8.933 -7.058 -49.997 1.00123.65 N ATOM 7589 N ALA A1022 -11.990 -13.150 -45.580 1.00108.97 N ATOM 7590 CA ALA A1022 -12.254 -14.280 -46.465 1.00108.18 C ATOM 7591 C ALA A1022 -13.698 -14.795 -46.395 1.00100.94 C ATOM 7592 O ALA A1022 -14.250 -15.226 -47.410 1.00105.11 O ATOM 7593 CB ALA A1022 -11.290 -15.403 -46.131 1.00116.89 C ATOM 7594 N ALA A1023 -14.297 -14.747 -45.210 1.00 90.41 N ATOM 7595 CA ALA A1023 -15.707 -15.148 -45.037 1.00 91.14 C ATOM 7596 C ALA A1023 -16.686 -14.225 -45.753 1.00 84.60 C ATOM 7597 O ALA A1023 -17.792 -14.646 -46.080 1.00 90.89 O ATOM 7598 CB ALA A1023 -16.073 -15.270 -43.568 1.00 95.43 C ATOM 7599 N GLY A1024 -16.284 -12.979 -45.980 1.00 85.63 N ATOM 7600 CA GLY A1024 -17.105 -12.000 -46.684 1.00 86.63 C ATOM 7601 C GLY A1024 -16.873 -11.875 -48.179 1.00 89.84 C ATOM 7602 O GLY A1024 -17.491 -11.020 -48.814 1.00 93.49 O ATOM 7603 N GLN A1025 -15.994 -12.704 -48.753 1.00 90.50 N ATOM 7604 CA GLN A1025 -15.738 -12.666 -50.204 1.00 87.46 C ATOM 7605 C GLN A1025 -16.924 -13.207 -50.992 1.00 84.91 C ATOM 7606 O GLN A1025 -17.689 -14.039 -50.509 1.00 93.69 O ATOM 7607 CB GLN A1025 -14.410 -13.367 -50.567 1.00 85.40 C ATOM 7608 CG GLN A1025 -14.477 -14.812 -51.050 1.00 84.03 C ATOM 7609 CD GLN A1025 -13.125 -15.531 -50.953 1.00 84.24 C ATOM 7610 OE1 GLN A1025 -12.533 -15.949 -51.967 1.00 79.27 O ATOM 7611 NE2 GLN A1025 -12.631 -15.689 -49.719 1.00 80.59 N ATOM 7612 N ALA A1026 -17.080 -12.719 -52.211 1.00 78.59 N ATOM 7613 CA ALA A1026 -18.295 -12.981 -52.979 1.00 72.46 C ATOM 7614 C ALA A1026 -17.979 -12.805 -54.446 1.00 67.31 C ATOM 7615 O ALA A1026 -17.166 -11.958 -54.799 1.00 71.79 O ATOM 7616 CB ALA A1026 -19.395 -12.012 -52.566 1.00 68.94 C ATOM 7617 N ALA A1027 -18.650 -13.617 -55.273 1.00 71.25 N ATOM 7618 CA ALA A1027 -18.382 -13.675 -56.696 1.00 77.04 C ATOM 7619 C ALA A1027 -19.651 -13.791 -57.543 1.00 74.67 C ATOM 7620 O ALA A1027 -20.715 -14.218 -57.067 1.00 70.78 O ATOM 7621 CB ALA A1027 -17.397 -14.792 -57.026 1.00 78.46 C ATOM 7622 N ALA A1028 -19.505 -13.389 -58.797 1.00 71.85 N ATOM 7623 CA ALA A1028 -20.605 -13.347 -59.764 1.00 79.60 C ATOM 7624 C ALA A1028 -20.068 -13.681 -61.166 1.00 78.42 C ATOM 7625 O ALA A1028 -18.856 -13.661 -61.402 1.00 79.92 O ATOM 7626 CB ALA A1028 -21.202 -11.954 -59.761 1.00 83.52 C ATOM 7627 N LEU A1029 -20.970 -14.003 -62.083 1.00 77.02 N ATOM 7628 CA LEU A1029 -20.610 -14.287 -63.456 1.00 73.97 C ATOM 7629 C LEU A1029 -21.662 -13.641 -64.347 1.00 79.82 C ATOM 7630 O LEU A1029 -22.858 -13.909 -64.173 1.00 82.34 O ATOM 7631 CB LEU A1029 -20.556 -15.788 -63.682 1.00 74.74 C ATOM 7632 CG LEU A1029 -20.076 -16.275 -65.050 1.00 79.58 C ATOM 7633 CD1 LEU A1029 -18.708 -15.720 -65.375 1.00 86.54 C ATOM 7634 CD2 LEU A1029 -20.036 -17.789 -65.101 1.00 83.60 C ATOM 7635 N VAL A1030 -21.223 -12.793 -65.284 1.00 67.82 N ATOM 7636 CA VAL A1030 -22.125 -12.061 -66.165 1.00 68.78 C ATOM 7637 C VAL A1030 -21.798 -12.311 -67.646 1.00 74.52 C ATOM 7638 O VAL A1030 -20.663 -12.114 -68.090 1.00 79.65 O ATOM 7639 CB VAL A1030 -22.053 -10.587 -65.786 1.00 69.92 C ATOM 7640 CG1 VAL A1030 -23.056 -9.754 -66.586 1.00 74.51 C ATOM 7641 CG2 VAL A1030 -22.323 -10.464 -64.295 1.00 68.87 C ATOM 7642 N HIS A1031 -22.811 -12.764 -68.391 1.00 81.00 N ATOM 7643 CA HIS A1031 -22.782 -12.865 -69.865 1.00 79.38 C ATOM 7644 C HIS A1031 -23.655 -11.810 -70.507 1.00 77.43 C ATOM 7645 O HIS A1031 -24.726 -11.506 -69.999 1.00 83.29 O ATOM 7646 CB HIS A1031 -23.259 -14.243 -70.332 1.00 82.15 C ATOM 7647 CG HIS A1031 -22.685 -15.362 -69.533 1.00 85.41 C ATOM 7648 ND1 HIS A1031 -21.335 -15.627 -69.494 1.00 88.00 N ATOM 7649 CD2 HIS A1031 -23.268 -16.242 -68.689 1.00 91.74 C ATOM 7650 CE1 HIS A1031 -21.111 -16.640 -68.678 1.00 94.20 C ATOM 7651 NE2 HIS A1031 -22.269 -17.029 -68.174 1.00 99.35 N ATOM 7652 N ILE A1032 -23.203 -11.259 -71.623 1.00 79.68 N ATOM 7653 CA ILE A1032 -24.032 -10.436 -72.500 1.00 76.44 C ATOM 7654 C ILE A1032 -24.132 -11.159 -73.828 1.00 80.91 C ATOM 7655 O ILE A1032 -23.130 -11.363 -74.493 1.00 77.89 O ATOM 7656 CB ILE A1032 -23.401 -9.063 -72.697 1.00 69.31 C ATOM 7657 CG1 ILE A1032 -23.027 -8.484 -71.318 1.00 72.14 C ATOM 7658 CG2 ILE A1032 -24.357 -8.189 -73.488 1.00 71.85 C ATOM 7659 CD1 ILE A1032 -23.101 -6.970 -71.183 1.00 74.15 C ATOM 7660 N TYR A1033 -25.341 -11.585 -74.182 1.00 87.29 N ATOM 7661 CA TYR A1033 -25.585 -12.238 -75.458 1.00 86.68 C ATOM 7662 C TYR A1033 -25.711 -11.193 -76.577 1.00 84.22 C ATOM 7663 O TYR A1033 -25.903 -10.011 -76.308 1.00 84.65 O ATOM 7664 CB TYR A1033 -26.819 -13.168 -75.376 1.00 88.76 C ATOM 7665 CG TYR A1033 -26.605 -14.298 -74.384 1.00 84.78 C ATOM 7666 CD1 TYR A1033 -25.646 -15.272 -74.607 1.00 78.73 C ATOM 7667 CD2 TYR A1033 -27.323 -14.353 -73.209 1.00 90.95 C ATOM 7668 CE1 TYR A1033 -25.416 -16.268 -73.691 1.00 80.25 C ATOM 7669 CE2 TYR A1033 -27.106 -15.353 -72.287 1.00 94.89 C ATOM 7670 CZ TYR A1033 -26.144 -16.302 -72.529 1.00 88.83 C ATOM 7671 OH TYR A1033 -25.936 -17.287 -71.586 1.00 96.86 O ATOM 7672 N LEU A1034 -25.599 -11.650 -77.826 1.00 87.10 N ATOM 7673 CA LEU A1034 -25.564 -10.787 -79.007 1.00 82.57 C ATOM 7674 C LEU A1034 -26.867 -10.043 -79.332 1.00 80.66 C ATOM 7675 O LEU A1034 -26.861 -9.071 -80.096 1.00 81.47 O ATOM 7676 CB LEU A1034 -25.178 -11.627 -80.208 1.00 83.02 C ATOM 7677 CG LEU A1034 -23.672 -11.594 -80.379 1.00 87.81 C ATOM 7678 CD1 LEU A1034 -22.945 -12.153 -79.162 1.00 86.77 C ATOM 7679 CD2 LEU A1034 -23.318 -12.314 -81.668 1.00 91.90 C ATOM 7680 N ASP A1035 -27.979 -10.506 -78.770 1.00 83.27 N ATOM 7681 CA ASP A1035 -29.228 -9.731 -78.770 1.00 85.70 C ATOM 7682 C ASP A1035 -29.281 -8.627 -77.672 1.00 86.85 C ATOM 7683 O ASP A1035 -30.301 -7.943 -77.539 1.00 97.76 O ATOM 7684 CB ASP A1035 -30.423 -10.698 -78.673 1.00 87.33 C ATOM 7685 CG ASP A1035 -30.703 -11.184 -77.232 1.00 93.08 C ATOM 7686 OD1 ASP A1035 -29.820 -11.084 -76.337 1.00 86.59 O ATOM 7687 OD2 ASP A1035 -31.836 -11.677 -77.005 1.00 96.08 O ATOM 7688 N GLY A1036 -28.215 -8.491 -76.882 1.00 82.80 N ATOM 7689 CA GLY A1036 -28.131 -7.472 -75.850 1.00 73.63 C ATOM 7690 C GLY A1036 -28.633 -7.865 -74.498 1.00 74.74 C ATOM 7691 O GLY A1036 -28.401 -7.138 -73.543 1.00 80.68 O ATOM 7692 N SER A1037 -29.338 -8.998 -74.395 1.00 84.82 N ATOM 7693 CA SER A1037 -29.856 -9.508 -73.098 1.00 85.40 C ATOM 7694 C SER A1037 -28.716 -10.032 -72.240 1.00 80.99 C ATOM 7695 O SER A1037 -27.677 -10.476 -72.745 1.00 78.75 O ATOM 7696 CB SER A1037 -30.910 -10.609 -73.304 1.00 81.54 C ATOM 7697 OG SER A1037 -30.338 -11.776 -73.875 1.00 74.24 O ATOM 7698 N VAL A1038 -28.942 -10.006 -70.930 1.00 79.45 N ATOM 7699 CA VAL A1038 -27.929 -10.366 -69.965 1.00 80.81 C ATOM 7700 C VAL A1038 -28.365 -11.496 -69.061 1.00 85.71 C ATOM 7701 O VAL A1038 -29.494 -11.519 -68.563 1.00 98.39 O ATOM 7702 CB VAL A1038 -27.495 -9.176 -69.107 1.00 84.76 C ATOM 7703 CG1 VAL A1038 -26.504 -9.637 -68.035 1.00 84.25 C ATOM 7704 CG2 VAL A1038 -26.910 -8.078 -69.993 1.00 86.10 C ATOM 7705 N LEU A1039 -27.444 -12.428 -68.838 1.00 81.84 N ATOM 7706 CA LEU A1039 -27.609 -13.475 -67.844 1.00 76.68 C ATOM 7707 C LEU A1039 -26.580 -13.264 -66.733 1.00 71.03 C ATOM 7708 O LEU A1039 -25.389 -13.188 -67.015 1.00 71.88 O ATOM 7709 CB LEU A1039 -27.412 -14.867 -68.452 1.00 70.48 C ATOM 7710 CG LEU A1039 -27.810 -15.911 -67.413 1.00 72.34 C ATOM 7711 CD1 LEU A1039 -29.096 -16.598 -67.843 1.00 71.09 C ATOM 7712 CD2 LEU A1039 -26.664 -16.885 -67.121 1.00 76.34 C ATOM 7713 N VAL A1040 -27.072 -13.186 -65.495 1.00 70.44 N ATOM 7714 CA VAL A1040 -26.231 -13.027 -64.337 1.00 72.50 C ATOM 7715 C VAL A1040 -26.484 -14.142 -63.335 1.00 70.43 C ATOM 7716 O VAL A1040 -27.599 -14.628 -63.204 1.00 58.32 O ATOM 7717 CB VAL A1040 -26.409 -11.622 -63.701 1.00 82.81 C ATOM 7718 CG1 VAL A1040 -27.866 -11.203 -63.651 1.00 79.90 C ATOM 7719 CG2 VAL A1040 -25.767 -11.544 -62.310 1.00 94.01 C ATOM 7720 N THR A1041 -25.416 -14.566 -62.656 1.00 76.80 N ATOM 7721 CA THR A1041 -25.526 -15.430 -61.497 1.00 84.30 C ATOM 7722 C THR A1041 -24.452 -15.016 -60.485 1.00 87.98 C ATOM 7723 O THR A1041 -23.493 -14.319 -60.827 1.00 90.42 O ATOM 7724 CB THR A1041 -25.254 -16.894 -61.817 1.00 90.37 C ATOM 7725 OG1 THR A1041 -25.178 -17.641 -60.585 1.00 89.51 O ATOM 7726 CG2 THR A1041 -23.942 -17.019 -62.625 1.00 87.85 C ATOM 7727 N HIS A1042 -24.639 -15.486 -59.256 1.00 87.21 N ATOM 7728 CA HIS A1042 -23.742 -15.199 -58.144 1.00 81.94 C ATOM 7729 C HIS A1042 -23.953 -16.266 -57.076 1.00 81.52 C ATOM 7730 O HIS A1042 -24.908 -17.067 -57.176 1.00 90.10 O ATOM 7731 CB HIS A1042 -24.051 -13.841 -57.549 1.00 82.06 C ATOM 7732 CG HIS A1042 -25.474 -13.714 -57.141 1.00 85.66 C ATOM 7733 ND1 HIS A1042 -25.941 -14.168 -55.932 1.00 82.65 N ATOM 7734 CD2 HIS A1042 -26.554 -13.284 -57.828 1.00 89.72 C ATOM 7735 CE1 HIS A1042 -27.242 -13.972 -55.869 1.00 89.27 C ATOM 7736 NE2 HIS A1042 -27.640 -13.447 -57.015 1.00 86.51 N ATOM 7737 N GLY A1043 -23.086 -16.257 -56.059 1.00 72.28 N ATOM 7738 CA GLY A1043 -23.068 -17.314 -55.056 1.00 68.34 C ATOM 7739 C GLY A1043 -24.151 -17.284 -53.986 1.00 67.02 C ATOM 7740 O GLY A1043 -24.339 -18.264 -53.270 1.00 57.49 O ATOM 7741 N GLY A1044 -24.830 -16.150 -53.844 1.00 69.38 N ATOM 7742 CA GLY A1044 -25.994 -16.047 -52.993 1.00 79.73 C ATOM 7743 C GLY A1044 -27.225 -16.866 -53.369 1.00 81.93 C ATOM 7744 O GLY A1044 -27.511 -17.068 -54.548 1.00 77.29 O ATOM 7745 N ILE A1045 -27.944 -17.306 -52.333 1.00 82.14 N ATOM 7746 CA ILE A1045 -29.149 -18.125 -52.433 1.00 80.14 C ATOM 7747 C ILE A1045 -30.388 -17.317 -52.076 1.00 86.22 C ATOM 7748 O ILE A1045 -30.412 -16.675 -51.024 1.00 90.88 O ATOM 7749 CB ILE A1045 -29.097 -19.259 -51.398 1.00 78.04 C ATOM 7750 CG1 ILE A1045 -28.087 -20.323 -51.821 1.00 84.39 C ATOM 7751 CG2 ILE A1045 -30.471 -19.857 -51.164 1.00 77.19 C ATOM 7752 CD1 ILE A1045 -28.175 -20.745 -53.274 1.00 85.35 C ATOM 7753 N GLU A1046 -31.404 -17.368 -52.945 1.00 88.79 N ATOM 7754 CA GLU A1046 -32.694 -16.727 -52.677 1.00 80.23 C ATOM 7755 C GLU A1046 -33.545 -17.633 -51.779 1.00 85.79 C ATOM 7756 O GLU A1046 -34.013 -18.695 -52.190 1.00 88.07 O ATOM 7757 CB GLU A1046 -33.393 -16.394 -53.990 1.00 78.62 C ATOM 7758 CG GLU A1046 -34.824 -15.892 -53.857 1.00 85.02 C ATOM 7759 CD GLU A1046 -34.950 -14.403 -53.569 1.00 86.95 C ATOM 7760 OE1 GLU A1046 -34.876 -13.556 -54.522 1.00 72.27 O ATOM 7761 OE2 GLU A1046 -35.183 -14.103 -52.372 1.00 95.82 O ATOM 7762 N MET A1047 -33.727 -17.198 -50.537 1.00 98.89 N ATOM 7763 CA MET A1047 -34.574 -17.856 -49.537 1.00101.12 C ATOM 7764 C MET A1047 -35.875 -17.080 -49.279 1.00 94.13 C ATOM 7765 O MET A1047 -36.585 -17.394 -48.311 1.00 94.01 O ATOM 7766 CB MET A1047 -33.809 -17.919 -48.187 1.00105.42 C ATOM 7767 CG MET A1047 -32.312 -18.257 -48.240 1.00104.63 C ATOM 7768 SD MET A1047 -31.447 -18.161 -46.646 1.00 95.58 S ATOM 7769 CE MET A1047 -30.532 -16.649 -46.880 1.00102.27 C ATOM 7770 N GLY A1048 -36.189 -16.083 -50.117 1.00 81.52 N ATOM 7771 CA GLY A1048 -37.353 -15.241 -49.902 1.00 88.55 C ATOM 7772 C GLY A1048 -37.038 -13.820 -49.473 1.00 92.01 C ATOM 7773 O GLY A1048 -37.930 -12.971 -49.436 1.00 94.28 O ATOM 7774 N GLN A1049 -35.762 -13.559 -49.186 1.00 95.89 N ATOM 7775 CA GLN A1049 -35.274 -12.222 -48.854 1.00 96.87 C ATOM 7776 C GLN A1049 -35.067 -11.319 -50.083 1.00 89.93 C ATOM 7777 O GLN A1049 -34.698 -10.155 -49.926 1.00 94.25 O ATOM 7778 CB GLN A1049 -33.987 -12.310 -48.004 1.00102.44 C ATOM 7779 CG GLN A1049 -32.662 -12.396 -48.756 1.00103.72 C ATOM 7780 CD GLN A1049 -32.434 -13.730 -49.408 1.00 95.63 C ATOM 7781 OE1 GLN A1049 -33.372 -14.430 -49.749 1.00104.31 O ATOM 7782 NE2 GLN A1049 -31.182 -14.090 -49.580 1.00 94.02 N ATOM 7783 N GLY A1050 -35.288 -11.818 -51.287 1.00 87.02 N ATOM 7784 CA GLY A1050 -35.196 -10.985 -52.489 1.00 91.41 C ATOM 7785 C GLY A1050 -33.797 -10.630 -52.972 1.00 89.60 C ATOM 7786 O GLY A1050 -33.608 -9.560 -53.567 1.00 81.99 O ATOM 7787 N VAL A1051 -32.811 -11.499 -52.712 1.00 89.05 N ATOM 7788 CA VAL A1051 -31.440 -11.196 -53.124 1.00 80.75 C ATOM 7789 C VAL A1051 -31.326 -11.124 -54.645 1.00 77.71 C ATOM 7790 O VAL A1051 -30.705 -10.214 -55.146 1.00 69.88 O ATOM 7791 CB VAL A1051 -30.382 -12.135 -52.530 1.00 75.53 C ATOM 7792 CG1 VAL A1051 -30.560 -13.572 -53.002 1.00 75.84 C ATOM 7793 CG2 VAL A1051 -29.000 -11.627 -52.910 1.00 76.01 C ATOM 7794 N HIS A1052 -31.964 -12.038 -55.370 1.00 80.87 N ATOM 7795 CA HIS A1052 -31.875 -12.022 -56.834 1.00 82.87 C ATOM 7796 C HIS A1052 -32.557 -10.770 -57.440 1.00 86.36 C ATOM 7797 O HIS A1052 -32.041 -10.195 -58.395 1.00 84.76 O ATOM 7798 CB HIS A1052 -32.344 -13.338 -57.468 1.00 82.68 C ATOM 7799 CG HIS A1052 -31.507 -14.519 -57.080 1.00 88.22 C ATOM 7800 ND1 HIS A1052 -31.814 -15.811 -57.439 1.00101.20 N ATOM 7801 CD2 HIS A1052 -30.396 -14.605 -56.316 1.00102.33 C ATOM 7802 CE1 HIS A1052 -30.920 -16.640 -56.930 1.00109.13 C ATOM 7803 NE2 HIS A1052 -30.044 -15.931 -56.246 1.00113.08 N ATOM 7804 N THR A1053 -33.682 -10.337 -56.873 1.00 88.07 N ATOM 7805 CA THR A1053 -34.309 -9.089 -57.256 1.00 88.25 C ATOM 7806 C THR A1053 -33.360 -7.886 -57.142 1.00 92.95 C ATOM 7807 O THR A1053 -33.256 -7.052 -58.029 1.00 95.60 O ATOM 7808 CB THR A1053 -35.433 -8.806 -56.243 1.00 85.81 C ATOM 7809 OG1 THR A1053 -36.101 -10.025 -55.888 1.00 89.08 O ATOM 7810 CG2 THR A1053 -36.400 -7.805 -56.786 1.00 83.01 C ATOM 7811 N LYS A1054 -32.658 -7.820 -56.018 1.00 89.18 N ATOM 7812 CA LYS A1054 -31.678 -6.745 -55.773 1.00 88.50 C ATOM 7813 C LYS A1054 -30.469 -6.757 -56.708 1.00 87.87 C ATOM 7814 O LYS A1054 -29.966 -5.702 -57.053 1.00 92.45 O ATOM 7815 CB LYS A1054 -31.191 -6.784 -54.317 1.00 91.17 C ATOM 7816 CG LYS A1054 -32.163 -6.221 -53.299 1.00 88.91 C ATOM 7817 CD LYS A1054 -31.635 -6.416 -51.890 1.00 87.25 C ATOM 7818 CE LYS A1054 -32.468 -5.632 -50.895 1.00 91.80 C ATOM 7819 NZ LYS A1054 -31.986 -5.904 -49.518 1.00100.65 N ATOM 7820 N MET A1055 -30.003 -7.937 -57.116 1.00 82.03 N ATOM 7821 CA MET A1055 -28.860 -8.046 -58.028 1.00 80.04 C ATOM 7822 C MET A1055 -29.204 -7.561 -59.437 1.00 81.47 C ATOM 7823 O MET A1055 -28.370 -6.963 -60.109 1.00 89.52 O ATOM 7824 CB MET A1055 -28.363 -9.471 -58.061 1.00 86.74 C ATOM 7825 CG MET A1055 -27.899 -10.010 -56.722 1.00 85.82 C ATOM 7826 SD MET A1055 -26.524 -9.063 -56.085 1.00 86.77 S ATOM 7827 CE MET A1055 -27.379 -7.992 -54.942 1.00 89.13 C ATOM 7828 N ILE A1056 -30.432 -7.806 -59.872 1.00 79.31 N ATOM 7829 CA ILE A1056 -30.903 -7.313 -61.163 1.00 79.21 C ATOM 7830 C ILE A1056 -31.090 -5.788 -61.104 1.00 81.01 C ATOM 7831 O ILE A1056 -30.897 -5.099 -62.101 1.00 87.53 O ATOM 7832 CB ILE A1056 -32.239 -7.935 -61.556 1.00 80.88 C ATOM 7833 CG1 ILE A1056 -32.125 -9.465 -61.669 1.00 82.98 C ATOM 7834 CG2 ILE A1056 -32.737 -7.305 -62.843 1.00 79.18 C ATOM 7835 CD1 ILE A1056 -31.607 -9.976 -62.999 1.00 86.30 C ATOM 7836 N GLN A1057 -31.492 -5.272 -59.942 1.00 80.73 N ATOM 7837 CA GLN A1057 -31.544 -3.823 -59.701 1.00 76.83 C ATOM 7838 C GLN A1057 -30.156 -3.215 -59.801 1.00 85.14 C ATOM 7839 O GLN A1057 -30.000 -2.146 -60.362 1.00105.73 O ATOM 7840 CB GLN A1057 -32.093 -3.537 -58.298 1.00 66.67 C ATOM 7841 CG GLN A1057 -33.592 -3.697 -58.163 1.00 67.80 C ATOM 7842 CD GLN A1057 -34.145 -3.269 -56.805 1.00 69.75 C ATOM 7843 OE1 GLN A1057 -34.797 -4.040 -56.118 1.00 69.24 O ATOM 7844 NE2 GLN A1057 -33.907 -2.029 -56.430 1.00 77.68 N ATOM 7845 N VAL A1058 -29.159 -3.901 -59.248 1.00 83.09 N ATOM 7846 CA VAL A1058 -27.758 -3.487 -59.377 1.00 88.54 C ATOM 7847 C VAL A1058 -27.340 -3.517 -60.856 1.00 87.17 C ATOM 7848 O VAL A1058 -26.818 -2.527 -61.372 1.00 78.22 O ATOM 7849 CB VAL A1058 -26.838 -4.368 -58.491 1.00 88.04 C ATOM 7850 CG1 VAL A1058 -25.372 -4.024 -58.704 1.00 90.22 C ATOM 7851 CG2 VAL A1058 -27.204 -4.223 -57.024 1.00 86.77 C ATOM 7852 N VAL A1059 -27.585 -4.637 -61.535 1.00 83.77 N ATOM 7853 CA VAL A1059 -27.206 -4.769 -62.942 1.00 78.08 C ATOM 7854 C VAL A1059 -27.878 -3.670 -63.771 1.00 74.43 C ATOM 7855 O VAL A1059 -27.237 -3.041 -64.603 1.00 72.99 O ATOM 7856 CB VAL A1059 -27.620 -6.166 -63.485 1.00 84.25 C ATOM 7857 CG1 VAL A1059 -27.517 -6.223 -65.006 1.00 84.58 C ATOM 7858 CG2 VAL A1059 -26.791 -7.282 -62.838 1.00 81.50 C ATOM 7859 N SER A1060 -29.160 -3.438 -63.515 1.00 76.37 N ATOM 7860 CA SER A1060 -29.922 -2.423 -64.234 1.00 81.72 C ATOM 7861 C SER A1060 -29.339 -1.014 -64.098 1.00 86.89 C ATOM 7862 O SER A1060 -29.301 -0.269 -65.069 1.00 87.41 O ATOM 7863 CB SER A1060 -31.366 -2.412 -63.815 1.00 81.57 C ATOM 7864 OG SER A1060 -32.109 -1.694 -64.782 1.00 92.89 O ATOM 7865 N ARG A1061 -28.904 -0.656 -62.894 1.00 86.67 N ATOM 7866 CA ARG A1061 -28.226 0.626 -62.668 1.00 88.06 C ATOM 7867 C ARG A1061 -26.861 0.667 -63.336 1.00 86.45 C ATOM 7868 O ARG A1061 -26.539 1.639 -64.007 1.00102.39 O ATOM 7869 CB ARG A1061 -28.028 0.944 -61.191 1.00 93.20 C ATOM 7870 CG ARG A1061 -26.868 1.912 -60.967 1.00 99.44 C ATOM 7871 CD ARG A1061 -26.756 2.389 -59.527 1.00109.90 C ATOM 7872 NE ARG A1061 -27.725 3.427 -59.196 1.00109.92 N ATOM 7873 CZ ARG A1061 -27.796 4.034 -58.017 1.00111.23 C ATOM 7874 NH1 ARG A1061 -26.938 3.736 -57.043 1.00109.92 N ATOM 7875 NH2 ARG A1061 -28.726 4.955 -57.820 1.00114.17 N ATOM 7876 N GLU A1062 -26.052 -0.371 -63.141 1.00 85.54 N ATOM 7877 CA GLU A1062 -24.648 -0.315 -63.543 1.00 85.46 C ATOM 7878 C GLU A1062 -24.442 -0.341 -65.063 1.00 84.90 C ATOM 7879 O GLU A1062 -23.598 0.387 -65.580 1.00 89.96 O ATOM 7880 CB GLU A1062 -23.837 -1.396 -62.849 1.00 94.11 C ATOM 7881 CG GLU A1062 -23.597 -1.110 -61.373 1.00 99.89 C ATOM 7882 CD GLU A1062 -22.698 0.093 -61.118 1.00106.41 C ATOM 7883 OE1 GLU A1062 -21.946 0.491 -62.044 1.00116.40 O ATOM 7884 OE2 GLU A1062 -22.739 0.635 -59.981 1.00104.01 O ATOM 7885 N LEU A1063 -25.208 -1.170 -65.766 1.00 87.08 N ATOM 7886 CA LEU A1063 -25.186 -1.199 -67.222 1.00 95.80 C ATOM 7887 C LEU A1063 -26.203 -0.256 -67.886 1.00 98.00 C ATOM 7888 O LEU A1063 -26.263 -0.179 -69.100 1.00 88.24 O ATOM 7889 CB LEU A1063 -25.444 -2.629 -67.692 1.00 96.77 C ATOM 7890 CG LEU A1063 -24.590 -3.707 -67.039 1.00 91.52 C ATOM 7891 CD1 LEU A1063 -24.826 -5.023 -67.769 1.00 93.18 C ATOM 7892 CD2 LEU A1063 -23.127 -3.308 -67.058 1.00 86.64 C ATOM 7893 N ARG A1064 -27.015 0.436 -67.088 1.00101.21 N ATOM 7894 CA ARG A1064 -27.957 1.442 -67.596 1.00104.84 C ATOM 7895 C ARG A1064 -28.904 0.816 -68.620 1.00 99.79 C ATOM 7896 O ARG A1064 -28.973 1.219 -69.773 1.00103.28 O ATOM 7897 CB ARG A1064 -27.312 2.780 -68.022 1.00119.28 C ATOM 7898 CG ARG A1064 -26.548 2.844 -69.341 1.00129.98 C ATOM 7899 CD ARG A1064 -25.815 4.178 -69.491 1.00131.18 C ATOM 7900 NE ARG A1064 -24.370 4.098 -69.230 1.00130.51 N ATOM 7901 CZ ARG A1064 -23.772 4.320 -68.054 1.00124.78 C ATOM 7902 NH1 ARG A1064 -24.474 4.639 -66.969 1.00124.14 N ATOM 7903 NH2 ARG A1064 -22.448 4.224 -67.959 1.00115.26 N ATOM 7904 N MET A1065 -29.614 -0.207 -68.156 1.00100.47 N ATOM 7905 CA MET A1065 -30.586 -0.955 -68.970 1.00 88.11 C ATOM 7906 C MET A1065 -31.742 -1.381 -68.081 1.00 83.59 C ATOM 7907 O MET A1065 -31.572 -1.490 -66.869 1.00 75.85 O ATOM 7908 CB MET A1065 -29.942 -2.194 -69.612 1.00 84.24 C ATOM 7909 CG MET A1065 -29.778 -3.357 -68.640 1.00 85.90 C ATOM 7910 SD MET A1065 -28.972 -4.849 -69.251 1.00 85.51 S ATOM 7911 CE MET A1065 -27.572 -4.217 -70.156 1.00 82.01 C ATOM 7912 N PRO A1066 -32.918 -1.618 -68.665 1.00 79.22 N ATOM 7913 CA PRO A1066 -34.081 -2.022 -67.863 1.00 77.64 C ATOM 7914 C PRO A1066 -33.930 -3.436 -67.288 1.00 84.19 C ATOM 7915 O PRO A1066 -33.237 -4.305 -67.875 1.00101.22 O ATOM 7916 CB PRO A1066 -35.225 -1.948 -68.856 1.00 71.91 C ATOM 7917 CG PRO A1066 -34.581 -2.225 -70.164 1.00 72.55 C ATOM 7918 CD PRO A1066 -33.204 -1.658 -70.106 1.00 74.68 C ATOM 7919 N MET A1067 -34.575 -3.665 -66.133 1.00 85.96 N ATOM 7920 CA MET A1067 -34.454 -4.966 -65.449 1.00 75.66 C ATOM 7921 C MET A1067 -35.037 -6.111 -66.273 1.00 70.77 C ATOM 7922 O MET A1067 -34.591 -7.244 -66.151 1.00 66.68 O ATOM 7923 CB MET A1067 -35.075 -4.910 -64.070 1.00 77.96 C ATOM 7924 CG MET A1067 -34.298 -4.034 -63.123 1.00 79.25 C ATOM 7925 SD MET A1067 -35.329 -3.618 -61.746 1.00 90.50 S ATOM 7926 CE MET A1067 -35.881 -5.245 -61.226 1.00 92.29 C ATOM 7927 N SER A1068 -35.996 -5.799 -67.135 1.00 72.53 N ATOM 7928 CA SER A1068 -36.561 -6.720 -68.115 1.00 74.00 C ATOM 7929 C SER A1068 -35.534 -7.320 -69.088 1.00 73.84 C ATOM 7930 O SER A1068 -35.793 -8.362 -69.702 1.00 78.88 O ATOM 7931 CB SER A1068 -37.560 -5.930 -68.950 1.00 76.61 C ATOM 7932 OG SER A1068 -36.894 -5.091 -69.883 1.00 70.49 O ATOM 7933 N ASN A1069 -34.405 -6.639 -69.266 1.00 77.50 N ATOM 7934 CA ASN A1069 -33.333 -7.117 -70.128 1.00 76.74 C ATOM 7935 C ASN A1069 -32.321 -8.052 -69.443 1.00 76.01 C ATOM 7936 O ASN A1069 -31.489 -8.647 -70.119 1.00 85.51 O ATOM 7937 CB ASN A1069 -32.601 -5.934 -70.742 1.00 70.54 C ATOM 7938 CG ASN A1069 -31.781 -6.340 -71.921 1.00 65.16 C ATOM 7939 OD1 ASN A1069 -32.314 -6.743 -72.942 1.00 68.61 O ATOM 7940 ND2 ASN A1069 -30.482 -6.273 -71.777 1.00 62.44 N ATOM 7941 N VAL A1070 -32.390 -8.157 -68.121 1.00 71.84 N ATOM 7942 CA VAL A1070 -31.482 -8.995 -67.321 1.00 79.58 C ATOM 7943 C VAL A1070 -32.241 -10.213 -66.827 1.00 74.74 C ATOM 7944 O VAL A1070 -33.428 -10.106 -66.533 1.00 81.63 O ATOM 7945 CB VAL A1070 -30.983 -8.184 -66.107 1.00 88.70 C ATOM 7946 CG1 VAL A1070 -29.769 -8.836 -65.469 1.00 92.95 C ATOM 7947 CG2 VAL A1070 -30.629 -6.764 -66.526 1.00 87.55 C ATOM 7948 N HIS A1071 -31.585 -11.356 -66.743 1.00 70.85 N ATOM 7949 CA HIS A1071 -32.248 -12.581 -66.252 1.00 80.73 C ATOM 7950 C HIS A1071 -31.302 -13.431 -65.466 1.00 74.07 C ATOM 7951 O HIS A1071 -30.106 -13.383 -65.669 1.00 75.28 O ATOM 7952 CB HIS A1071 -32.918 -13.398 -67.372 1.00 88.66 C ATOM 7953 CG HIS A1071 -33.653 -14.612 -66.879 1.00 84.26 C ATOM 7954 ND1 HIS A1071 -34.774 -14.531 -66.082 1.00 83.81 N ATOM 7955 CD2 HIS A1071 -33.420 -15.931 -67.064 1.00 81.44 C ATOM 7956 CE1 HIS A1071 -35.211 -15.746 -65.815 1.00 80.96 C ATOM 7957 NE2 HIS A1071 -34.406 -16.613 -66.399 1.00 81.01 N ATOM 7958 N LEU A1072 -31.851 -14.178 -64.539 1.00 73.80 N ATOM 7959 CA LEU A1072 -31.077 -14.993 -63.596 1.00 79.62 C ATOM 7960 C LEU A1072 -31.887 -16.259 -63.442 1.00 82.35 C ATOM 7961 O LEU A1072 -33.116 -16.202 -63.375 1.00 96.79 O ATOM 7962 CB LEU A1072 -30.926 -14.231 -62.286 1.00 78.52 C ATOM 7963 CG LEU A1072 -30.028 -14.854 -61.232 1.00 97.08 C ATOM 7964 CD1 LEU A1072 -29.356 -13.773 -60.394 1.00100.49 C ATOM 7965 CD2 LEU A1072 -30.806 -15.823 -60.351 1.00103.28 C ATOM 7966 N ARG A1073 -31.218 -17.411 -63.424 1.00 86.61 N ATOM 7967 CA ARG A1073 -31.873 -18.727 -63.310 1.00 80.78 C ATOM 7968 C ARG A1073 -31.774 -19.236 -61.872 1.00 79.14 C ATOM 7969 O ARG A1073 -32.752 -19.718 -61.304 1.00 79.09 O ATOM 7970 CB ARG A1073 -31.220 -19.738 -64.260 1.00 83.38 C ATOM 7971 CG ARG A1073 -31.413 -19.465 -65.748 1.00 87.96 C ATOM 7972 CD ARG A1073 -30.714 -20.537 -66.592 1.00 95.66 C ATOM 7973 NE ARG A1073 -31.427 -21.826 -66.588 1.00 97.25 N ATOM 7974 CZ ARG A1073 -32.197 -22.315 -67.571 1.00 95.53 C ATOM 7975 NH1 ARG A1073 -32.388 -21.669 -68.722 1.00105.95 N ATOM 7976 NH2 ARG A1073 -32.792 -23.484 -67.399 1.00 90.81 N ATOM 7977 N GLY A1074 -30.574 -19.169 -61.302 1.00 78.49 N ATOM 7978 CA GLY A1074 -30.312 -19.754 -60.011 1.00 73.69 C ATOM 7979 C GLY A1074 -28.894 -19.581 -59.527 1.00 69.59 C ATOM 7980 O GLY A1074 -28.186 -18.650 -59.911 1.00 80.21 O ATOM 7981 N THR A1075 -28.496 -20.487 -58.647 1.00 67.58 N ATOM 7982 CA THR A1075 -27.156 -20.510 -58.045 1.00 75.05 C ATOM 7983 C THR A1075 -26.594 -21.901 -58.243 1.00 83.82 C ATOM 7984 O THR A1075 -27.305 -22.892 -58.126 1.00 92.40 O ATOM 7985 CB THR A1075 -27.213 -20.140 -56.557 1.00 77.72 C ATOM 7986 OG1 THR A1075 -27.712 -18.805 -56.397 1.00 81.30 O ATOM 7987 CG2 THR A1075 -25.843 -20.243 -55.923 1.00 85.42 C ATOM 7988 N SER A1076 -25.311 -21.986 -58.530 1.00 85.96 N ATOM 7989 CA SER A1076 -24.670 -23.264 -58.912 1.00 80.04 C ATOM 7990 C SER A1076 -23.181 -23.226 -58.717 1.00 79.59 C ATOM 7991 O SER A1076 -22.530 -22.293 -59.162 1.00 87.26 O ATOM 7992 CB SER A1076 -24.982 -23.545 -60.387 1.00 79.57 C ATOM 7993 OG SER A1076 -24.644 -24.871 -60.764 1.00 87.33 O ATOM 7994 N THR A1077 -22.633 -24.260 -58.075 1.00 74.61 N ATOM 7995 CA THR A1077 -21.181 -24.438 -57.964 1.00 72.46 C ATOM 7996 C THR A1077 -20.482 -24.550 -59.333 1.00 78.89 C ATOM 7997 O THR A1077 -19.281 -24.294 -59.458 1.00 97.02 O ATOM 7998 CB THR A1077 -20.829 -25.735 -57.194 1.00 70.29 C ATOM 7999 OG1 THR A1077 -21.427 -26.840 -57.864 1.00 77.90 O ATOM 8000 CG2 THR A1077 -21.327 -25.750 -55.741 1.00 67.66 C ATOM 8001 N GLU A1078 -21.251 -24.949 -60.348 1.00 88.25 N ATOM 8002 CA GLU A1078 -20.776 -25.011 -61.730 1.00 82.89 C ATOM 8003 C GLU A1078 -20.526 -23.635 -62.350 1.00 86.36 C ATOM 8004 O GLU A1078 -19.642 -23.505 -63.167 1.00 96.45 O ATOM 8005 CB GLU A1078 -21.760 -25.822 -62.606 1.00 77.56 C ATOM 8006 CG GLU A1078 -21.169 -26.328 -63.926 1.00 84.45 C ATOM 8007 CD GLU A1078 -21.924 -27.502 -64.592 1.00 90.07 C ATOM 8008 OE1 GLU A1078 -22.605 -28.291 -63.906 1.00 99.47 O ATOM 8009 OE2 GLU A1078 -21.821 -27.673 -65.829 1.00 88.34 O ATOM 8010 N THR A1079 -21.274 -22.609 -61.965 1.00 83.78 N ATOM 8011 CA THR A1079 -21.088 -21.284 -62.523 1.00 80.78 C ATOM 8012 C THR A1079 -20.214 -20.387 -61.637 1.00 77.65 C ATOM 8013 O THR A1079 -19.338 -19.685 -62.150 1.00 83.85 O ATOM 8014 CB THR A1079 -22.466 -20.636 -62.793 1.00 86.61 C ATOM 8015 OG1 THR A1079 -23.262 -20.589 -61.586 1.00 89.50 O ATOM 8016 CG2 THR A1079 -23.212 -21.447 -63.856 1.00 89.24 C ATOM 8017 N VAL A1080 -20.484 -20.389 -60.340 1.00 72.40 N ATOM 8018 CA VAL A1080 -19.727 -19.578 -59.393 1.00 69.60 C ATOM 8019 C VAL A1080 -19.185 -20.462 -58.293 1.00 72.35 C ATOM 8020 O VAL A1080 -19.944 -20.957 -57.464 1.00 80.68 O ATOM 8021 CB VAL A1080 -20.596 -18.548 -58.705 1.00 69.38 C ATOM 8022 CG1 VAL A1080 -19.798 -17.896 -57.597 1.00 76.46 C ATOM 8023 CG2 VAL A1080 -21.044 -17.498 -59.695 1.00 69.56 C ATOM 8024 N PRO A1081 -17.872 -20.696 -58.289 1.00 75.86 N ATOM 8025 CA PRO A1081 -17.261 -21.643 -57.356 1.00 78.95 C ATOM 8026 C PRO A1081 -16.860 -20.974 -56.049 1.00 87.38 C ATOM 8027 O PRO A1081 -16.665 -19.743 -55.989 1.00 93.97 O ATOM 8028 CB PRO A1081 -16.004 -22.070 -58.086 1.00 81.28 C ATOM 8029 CG PRO A1081 -15.612 -20.850 -58.826 1.00 82.98 C ATOM 8030 CD PRO A1081 -16.900 -20.235 -59.290 1.00 82.98 C ATOM 8031 N ASN A1082 -16.737 -21.807 -55.017 1.00 95.56 N ATOM 8032 CA ASN A1082 -16.187 -21.402 -53.713 1.00 85.07 C ATOM 8033 C ASN A1082 -17.009 -20.333 -52.961 1.00 80.36 C ATOM 8034 O ASN A1082 -16.448 -19.645 -52.123 1.00 89.99 O ATOM 8035 CB ASN A1082 -14.783 -20.860 -53.936 1.00 82.86 C ATOM 8036 CG ASN A1082 -14.002 -21.678 -54.928 1.00 81.73 C ATOM 8037 OD1 ASN A1082 -14.199 -22.877 -55.041 1.00 77.66 O ATOM 8038 ND2 ASN A1082 -13.105 -21.032 -55.646 1.00 89.37 N ATOM 8039 N ALA A1083 -18.303 -20.197 -53.244 1.00 73.80 N ATOM 8040 CA ALA A1083 -19.110 -19.148 -52.651 1.00 80.65 C ATOM 8041 C ALA A1083 -19.362 -19.426 -51.171 1.00 92.46 C ATOM 8042 O ALA A1083 -19.516 -20.590 -50.774 1.00 89.71 O ATOM 8043 CB ALA A1083 -20.425 -19.046 -53.386 1.00 88.34 C ATOM 8044 N ASN A1084 -19.395 -18.360 -50.361 1.00 97.49 N ATOM 8045 CA ASN A1084 -19.686 -18.518 -48.927 1.00 85.83 C ATOM 8046 C ASN A1084 -21.180 -18.750 -48.698 1.00 77.00 C ATOM 8047 O ASN A1084 -22.003 -18.646 -49.612 1.00 77.78 O ATOM 8048 CB ASN A1084 -19.140 -17.355 -48.108 1.00 82.13 C ATOM 8049 CG ASN A1084 -17.641 -17.464 -47.908 1.00 82.35 C ATOM 8050 OD1 ASN A1084 -17.170 -18.299 -47.136 1.00 91.02 O ATOM 8051 ND2 ASN A1084 -16.882 -16.633 -48.613 1.00 78.31 N ATOM 8052 N ILE A1085 -21.505 -19.065 -47.457 1.00 76.87 N ATOM 8053 CA ILE A1085 -22.883 -19.247 -47.000 1.00 84.68 C ATOM 8054 C ILE A1085 -23.764 -18.024 -47.278 1.00 91.11 C ATOM 8055 O ILE A1085 -23.296 -16.880 -47.194 1.00106.07 O ATOM 8056 CB ILE A1085 -22.917 -19.504 -45.495 1.00 85.47 C ATOM 8057 CG1 ILE A1085 -24.285 -20.073 -45.116 1.00 88.97 C ATOM 8058 CG2 ILE A1085 -22.555 -18.225 -44.726 1.00 85.41 C ATOM 8059 CD1 ILE A1085 -24.215 -21.169 -44.080 1.00 93.91 C ATOM 8060 N SER A1086 -25.023 -18.265 -47.616 1.00 94.23 N ATOM 8061 CA SER A1086 -26.001 -17.188 -47.685 1.00 94.65 C ATOM 8062 C SER A1086 -26.532 -16.916 -46.284 1.00 98.27 C ATOM 8063 O SER A1086 -27.540 -17.490 -45.893 1.00 83.41 O ATOM 8064 CB SER A1086 -27.094 -17.512 -48.682 1.00 96.98 C ATOM 8065 OG SER A1086 -26.526 -17.566 -49.978 1.00 90.67 O ATOM 8066 N GLY A1087 -25.810 -16.083 -45.549 1.00111.21 N ATOM 8067 CA GLY A1087 -26.062 -15.802 -44.152 1.00118.04 C ATOM 8068 C GLY A1087 -25.373 -14.519 -43.678 1.00125.09 C ATOM 8069 O GLY A1087 -24.803 -13.762 -44.478 1.00120.09 O ATOM 8070 N GLY A1088 -25.483 -14.246 -42.378 1.00123.88 N ATOM 8071 CA GLY A1088 -24.871 -13.071 -41.744 1.00126.19 C ATOM 8072 C GLY A1088 -25.442 -11.697 -42.085 1.00125.00 C ATOM 8073 O GLY A1088 -24.783 -10.682 -41.819 1.00123.95 O ATOM 8074 N SER A1089 -26.655 -11.658 -42.651 1.00119.28 N ATOM 8075 CA SER A1089 -27.350 -10.396 -43.057 1.00114.16 C ATOM 8076 C SER A1089 -26.686 -9.622 -44.211 1.00103.26 C ATOM 8077 O SER A1089 -27.078 -8.495 -44.486 1.00 84.13 O ATOM 8078 CB SER A1089 -27.537 -9.455 -41.826 1.00117.59 C ATOM 8079 OG SER A1089 -28.902 -9.285 -41.445 1.00110.19 O ATOM 8080 N VAL A1090 -25.748 -10.256 -44.929 1.00 98.57 N ATOM 8081 CA VAL A1090 -24.916 -9.545 -45.899 1.00100.78 C ATOM 8082 C VAL A1090 -24.849 -10.179 -47.299 1.00 97.50 C ATOM 8083 O VAL A1090 -24.008 -9.841 -48.120 1.00 89.54 O ATOM 8084 CB VAL A1090 -23.495 -9.396 -45.346 1.00106.62 C ATOM 8085 CG1 VAL A1090 -23.490 -8.395 -44.206 1.00105.60 C ATOM 8086 CG2 VAL A1090 -22.957 -10.749 -44.898 1.00110.24 C ATOM 8087 N VAL A1091 -25.778 -11.088 -47.597 1.00106.64 N ATOM 8088 CA VAL A1091 -25.767 -11.805 -48.868 1.00104.32 C ATOM 8089 C VAL A1091 -25.880 -10.792 -49.998 1.00102.63 C ATOM 8090 O VAL A1091 -25.056 -10.813 -50.911 1.00103.75 O ATOM 8091 CB VAL A1091 -26.921 -12.833 -49.000 1.00110.93 C ATOM 8092 CG1 VAL A1091 -26.765 -13.636 -50.282 1.00112.45 C ATOM 8093 CG2 VAL A1091 -26.969 -13.790 -47.815 1.00115.24 C ATOM 8094 N ALA A1092 -26.863 -9.896 -49.924 1.00105.73 N ATOM 8095 CA ALA A1092 -27.066 -8.879 -50.944 1.00108.42 C ATOM 8096 C ALA A1092 -25.913 -7.877 -51.012 1.00103.27 C ATOM 8097 O ALA A1092 -25.424 -7.578 -52.091 1.00110.86 O ATOM 8098 CB ALA A1092 -28.374 -8.150 -50.684 1.00115.97 C ATOM 8099 N ASP A1093 -25.478 -7.378 -49.859 1.00100.28 N ATOM 8100 CA ASP A1093 -24.330 -6.443 -49.784 1.00106.22 C ATOM 8101 C ASP A1093 -23.144 -6.936 -50.595 1.00 85.87 C ATOM 8102 O ASP A1093 -22.602 -6.212 -51.439 1.00 87.52 O ATOM 8103 CB ASP A1093 -23.860 -6.210 -48.348 1.00126.41 C ATOM 8104 CG ASP A1093 -25.005 -6.062 -47.358 1.00139.28 C ATOM 8105 OD1 ASP A1093 -26.069 -6.718 -47.533 1.00138.91 O ATOM 8106 OD2 ASP A1093 -24.807 -5.300 -46.386 1.00133.45 O ATOM 8107 N LEU A1094 -22.760 -8.172 -50.313 1.00 82.52 N ATOM 8108 CA LEU A1094 -21.503 -8.724 -50.777 1.00 87.77 C ATOM 8109 C LEU A1094 -21.604 -9.213 -52.219 1.00 87.00 C ATOM 8110 O LEU A1094 -20.742 -8.894 -53.045 1.00 79.34 O ATOM 8111 CB LEU A1094 -21.122 -9.882 -49.862 1.00 90.09 C ATOM 8112 CG LEU A1094 -20.968 -9.496 -48.388 1.00 83.17 C ATOM 8113 CD1 LEU A1094 -20.803 -10.745 -47.521 1.00 82.24 C ATOM 8114 CD2 LEU A1094 -19.802 -8.525 -48.250 1.00 81.55 C ATOM 8115 N ASN A1095 -22.653 -9.968 -52.528 1.00 84.51 N ATOM 8116 CA ASN A1095 -22.874 -10.405 -53.902 1.00 83.70 C ATOM 8117 C ASN A1095 -23.243 -9.245 -54.804 1.00 78.10 C ATOM 8118 O ASN A1095 -22.919 -9.260 -55.979 1.00 77.67 O ATOM 8119 CB ASN A1095 -23.929 -11.504 -53.966 1.00 87.51 C ATOM 8120 CG ASN A1095 -23.407 -12.833 -53.434 1.00 94.11 C ATOM 8121 OD1 ASN A1095 -22.505 -13.452 -54.021 1.00100.16 O ATOM 8122 ND2 ASN A1095 -23.965 -13.278 -52.316 1.00 97.92 N ATOM 8123 N GLY A1096 -23.910 -8.238 -54.253 1.00 82.09 N ATOM 8124 CA GLY A1096 -24.120 -6.966 -54.954 1.00 84.63 C ATOM 8125 C GLY A1096 -22.839 -6.260 -55.362 1.00 87.90 C ATOM 8126 O GLY A1096 -22.758 -5.728 -56.466 1.00 88.92 O ATOM 8127 N LEU A1097 -21.837 -6.255 -54.483 1.00 84.89 N ATOM 8128 CA LEU A1097 -20.533 -5.691 -54.820 1.00 83.90 C ATOM 8129 C LEU A1097 -19.804 -6.491 -55.902 1.00 84.45 C ATOM 8130 O LEU A1097 -19.098 -5.914 -56.730 1.00 76.11 O ATOM 8131 CB LEU A1097 -19.657 -5.560 -53.581 1.00 80.03 C ATOM 8132 CG LEU A1097 -20.153 -4.433 -52.682 1.00 83.12 C ATOM 8133 CD1 LEU A1097 -19.400 -4.444 -51.363 1.00 90.04 C ATOM 8134 CD2 LEU A1097 -20.014 -3.074 -53.353 1.00 87.93 C ATOM 8135 N ALA A1098 -19.980 -7.808 -55.897 1.00 85.72 N ATOM 8136 CA ALA A1098 -19.358 -8.669 -56.904 1.00 80.67 C ATOM 8137 C ALA A1098 -20.063 -8.580 -58.269 1.00 76.57 C ATOM 8138 O ALA A1098 -19.419 -8.696 -59.310 1.00 79.14 O ATOM 8139 CB ALA A1098 -19.243 -10.100 -56.395 1.00 81.70 C ATOM 8140 N VAL A1099 -21.380 -8.393 -58.256 1.00 69.69 N ATOM 8141 CA VAL A1099 -22.150 -8.216 -59.482 1.00 72.83 C ATOM 8142 C VAL A1099 -21.804 -6.868 -60.118 1.00 82.69 C ATOM 8143 O VAL A1099 -21.558 -6.789 -61.316 1.00 71.92 O ATOM 8144 CB VAL A1099 -23.672 -8.383 -59.263 1.00 79.23 C ATOM 8145 CG1 VAL A1099 -24.464 -7.908 -60.482 1.00 82.98 C ATOM 8146 CG2 VAL A1099 -24.017 -9.835 -58.971 1.00 80.29 C ATOM 8147 N LYS A1100 -21.787 -5.823 -59.296 1.00 94.48 N ATOM 8148 CA LYS A1100 -21.318 -4.499 -59.702 1.00 93.77 C ATOM 8149 C LYS A1100 -19.914 -4.562 -60.306 1.00 94.93 C ATOM 8150 O LYS A1100 -19.651 -3.963 -61.336 1.00101.94 O ATOM 8151 CB LYS A1100 -21.278 -3.623 -58.446 1.00 98.93 C ATOM 8152 CG LYS A1100 -20.807 -2.196 -58.648 1.00105.49 C ATOM 8153 CD LYS A1100 -21.586 -1.264 -57.736 1.00112.99 C ATOM 8154 CE LYS A1100 -21.019 0.146 -57.735 1.00124.59 C ATOM 8155 NZ LYS A1100 -19.929 0.314 -56.735 1.00129.78 N ATOM 8156 N ASP A1101 -19.018 -5.309 -59.673 1.00 90.21 N ATOM 8157 CA ASP A1101 -17.662 -5.469 -60.189 1.00 82.57 C ATOM 8158 C ASP A1101 -17.614 -6.061 -61.612 1.00 83.42 C ATOM 8159 O ASP A1101 -16.887 -5.569 -62.451 1.00 76.53 O ATOM 8160 CB ASP A1101 -16.880 -6.366 -59.255 1.00 79.77 C ATOM 8161 CG ASP A1101 -15.470 -6.524 -59.693 1.00 82.72 C ATOM 8162 OD1 ASP A1101 -14.870 -5.511 -60.113 1.00 87.31 O ATOM 8163 OD2 ASP A1101 -14.966 -7.658 -59.636 1.00 89.34 O ATOM 8164 N ALA A1102 -18.385 -7.113 -61.880 1.00 92.81 N ATOM 8165 CA ALA A1102 -18.462 -7.692 -63.240 1.00 87.69 C ATOM 8166 C ALA A1102 -19.041 -6.728 -64.244 1.00 88.21 C ATOM 8167 O ALA A1102 -18.550 -6.628 -65.356 1.00 97.41 O ATOM 8168 CB ALA A1102 -19.247 -8.981 -63.254 1.00 96.35 C ATOM 8169 N CYS A1103 -20.108 -6.039 -63.858 1.00 95.93 N ATOM 8170 CA CYS A1103 -20.757 -5.043 -64.714 1.00 98.77 C ATOM 8171 C CYS A1103 -19.804 -3.939 -65.122 1.00 97.48 C ATOM 8172 O CYS A1103 -19.776 -3.569 -66.279 1.00100.88 O ATOM 8173 CB CYS A1103 -21.960 -4.443 -64.009 1.00 99.58 C ATOM 8174 SG CYS A1103 -23.276 -5.643 -63.836 1.00105.57 S ATOM 8175 N GLN A1104 -19.037 -3.414 -64.173 1.00 92.75 N ATOM 8176 CA GLN A1104 -18.100 -2.317 -64.447 1.00 98.71 C ATOM 8177 C GLN A1104 -16.988 -2.745 -65.405 1.00 98.63 C ATOM 8178 O GLN A1104 -16.686 -2.042 -66.366 1.00 87.15 O ATOM 8179 CB GLN A1104 -17.458 -1.790 -63.182 1.00 97.89 C ATOM 8180 CG GLN A1104 -18.194 -0.632 -62.536 1.00 99.32 C ATOM 8181 CD GLN A1104 -17.967 -0.625 -61.028 1.00 99.67 C ATOM 8182 OE1 GLN A1104 -18.810 -0.172 -60.256 1.00 86.56 O ATOM 8183 NE2 GLN A1104 -16.826 -1.172 -60.600 1.00100.10 N ATOM 8184 N THR A1105 -16.384 -3.894 -65.128 1.00 95.61 N ATOM 8185 CA THR A1105 -15.466 -4.543 -66.054 1.00 88.18 C ATOM 8186 C THR A1105 -16.047 -4.591 -67.463 1.00 85.87 C ATOM 8187 O THR A1105 -15.381 -4.195 -68.416 1.00113.44 O ATOM 8188 CB THR A1105 -15.125 -5.995 -65.651 1.00 83.27 C ATOM 8189 OG1 THR A1105 -15.169 -6.149 -64.231 1.00 84.66 O ATOM 8190 CG2 THR A1105 -13.738 -6.359 -66.127 1.00 86.12 C ATOM 8191 N LEU A1106 -17.278 -5.074 -67.584 1.00 82.80 N ATOM 8192 CA LEU A1106 -17.944 -5.167 -68.883 1.00 87.76 C ATOM 8193 C LEU A1106 -18.147 -3.798 -69.515 1.00 81.50 C ATOM 8194 O LEU A1106 -17.948 -3.637 -70.710 1.00 82.67 O ATOM 8195 CB LEU A1106 -19.313 -5.860 -68.787 1.00 95.31 C ATOM 8196 CG LEU A1106 -19.322 -7.396 -68.832 1.00102.53 C ATOM 8197 CD1 LEU A1106 -20.687 -7.933 -68.435 1.00103.50 C ATOM 8198 CD2 LEU A1106 -18.923 -7.930 -70.205 1.00106.57 C ATOM 8199 N LEU A1107 -18.530 -2.816 -68.712 1.00 77.12 N ATOM 8200 CA LEU A1107 -18.736 -1.461 -69.206 1.00 86.19 C ATOM 8201 C LEU A1107 -17.432 -0.813 -69.636 1.00101.42 C ATOM 8202 O LEU A1107 -17.434 -0.086 -70.614 1.00112.46 O ATOM 8203 CB LEU A1107 -19.372 -0.633 -68.116 1.00 88.94 C ATOM 8204 CG LEU A1107 -20.291 0.445 -68.651 1.00 96.04 C ATOM 8205 CD1 LEU A1107 -21.474 -0.204 -69.363 1.00 96.01 C ATOM 8206 CD2 LEU A1107 -20.732 1.348 -67.498 1.00105.12 C ATOM 8207 N LYS A1108 -16.323 -1.071 -68.931 1.00104.65 N ATOM 8208 CA LYS A1108 -14.987 -0.553 -69.332 1.00102.73 C ATOM 8209 C LYS A1108 -14.583 -1.041 -70.720 1.00106.41 C ATOM 8210 O LYS A1108 -14.120 -0.254 -71.542 1.00122.26 O ATOM 8211 CB LYS A1108 -13.849 -1.030 -68.399 1.00105.62 C ATOM 8212 CG LYS A1108 -13.469 -0.114 -67.241 1.00125.26 C ATOM 8213 CD LYS A1108 -14.363 -0.363 -66.022 1.00151.28 C ATOM 8214 CE LYS A1108 -13.905 0.333 -64.738 1.00151.03 C ATOM 8215 NZ LYS A1108 -14.963 0.351 -63.677 1.00139.16 N ATOM 8216 N ARG A1109 -14.751 -2.341 -70.959 1.00101.30 N ATOM 8217 CA ARG A1109 -14.465 -2.956 -72.256 1.00 97.20 C ATOM 8218 C ARG A1109 -15.265 -2.343 -73.389 1.00 92.65 C ATOM 8219 O ARG A1109 -14.759 -2.190 -74.490 1.00 92.74 O ATOM 8220 CB ARG A1109 -14.719 -4.449 -72.195 1.00103.34 C ATOM 8221 CG ARG A1109 -13.522 -5.193 -71.636 1.00108.67 C ATOM 8222 CD ARG A1109 -13.665 -6.683 -71.814 1.00 97.17 C ATOM 8223 NE ARG A1109 -13.584 -7.308 -70.509 1.00 89.00 N ATOM 8224 CZ ARG A1109 -14.130 -8.471 -70.216 1.00 86.16 C ATOM 8225 NH1 ARG A1109 -14.796 -9.158 -71.137 1.00 85.90 N ATOM 8226 NH2 ARG A1109 -14.002 -8.953 -68.990 1.00 94.89 N ATOM 8227 N LEU A1110 -16.512 -2.004 -73.098 1.00100.07 N ATOM 8228 CA LEU A1110 -17.448 -1.460 -74.080 1.00110.04 C ATOM 8229 C LEU A1110 -17.414 0.054 -74.275 1.00122.72 C ATOM 8230 O LEU A1110 -17.999 0.548 -75.239 1.00120.18 O ATOM 8231 CB LEU A1110 -18.873 -1.871 -73.695 1.00103.78 C ATOM 8232 CG LEU A1110 -19.207 -3.360 -73.799 1.00 92.37 C ATOM 8233 CD1 LEU A1110 -20.427 -3.679 -72.950 1.00 87.94 C ATOM 8234 CD2 LEU A1110 -19.436 -3.753 -75.249 1.00 89.82 C ATOM 8235 N GLU A1111 -16.764 0.797 -73.382 1.00127.97 N ATOM 8236 CA GLU A1111 -16.801 2.272 -73.438 1.00133.09 C ATOM 8237 C GLU A1111 -16.361 2.876 -74.778 1.00116.76 C ATOM 8238 O GLU A1111 -16.971 3.841 -75.233 1.00119.44 O ATOM 8239 CB GLU A1111 -15.958 2.872 -72.296 1.00138.88 C ATOM 8240 CG GLU A1111 -16.805 3.232 -71.083 1.00150.19 C ATOM 8241 CD GLU A1111 -16.016 3.570 -69.824 1.00150.76 C ATOM 8242 OE1 GLU A1111 -14.827 3.952 -69.950 1.00139.54 O ATOM 8243 OE2 GLU A1111 -16.601 3.467 -68.710 1.00127.27 O ATOM 8244 N PRO A1112 -15.327 2.310 -75.424 1.00 98.05 N ATOM 8245 CA PRO A1112 -15.010 2.661 -76.808 1.00 94.67 C ATOM 8246 C PRO A1112 -16.205 2.561 -77.758 1.00106.64 C ATOM 8247 O PRO A1112 -16.460 3.493 -78.531 1.00114.89 O ATOM 8248 CB PRO A1112 -14.018 1.569 -77.211 1.00 88.93 C ATOM 8249 CG PRO A1112 -13.349 1.181 -75.941 1.00 94.76 C ATOM 8250 CD PRO A1112 -14.171 1.675 -74.778 1.00 97.02 C ATOM 8251 N ILE A1113 -16.923 1.439 -77.686 1.00117.82 N ATOM 8252 CA ILE A1113 -18.108 1.190 -78.523 1.00123.67 C ATOM 8253 C ILE A1113 -19.284 2.106 -78.155 1.00122.24 C ATOM 8254 O ILE A1113 -20.028 2.557 -79.038 1.00126.26 O ATOM 8255 CB ILE A1113 -18.513 -0.294 -78.480 1.00115.84 C ATOM 8256 CG1 ILE A1113 -17.339 -1.140 -79.025 1.00115.54 C ATOM 8257 CG2 ILE A1113 -19.811 -0.487 -79.251 1.00112.51 C ATOM 8258 CD1 ILE A1113 -17.688 -2.503 -79.591 1.00113.54 C ATOM 8259 N ILE A1114 -19.432 2.395 -76.865 1.00120.21 N ATOM 8260 CA ILE A1114 -20.528 3.240 -76.381 1.00131.35 C ATOM 8261 C ILE A1114 -20.328 4.713 -76.758 1.00132.39 C ATOM 8262 O ILE A1114 -21.277 5.369 -77.193 1.00134.64 O ATOM 8263 CB ILE A1114 -20.821 3.067 -74.869 1.00131.43 C ATOM 8264 CG1 ILE A1114 -21.188 1.594 -74.605 1.00137.16 C ATOM 8265 CG2 ILE A1114 -21.931 4.028 -74.417 1.00119.95 C ATOM 8266 CD1 ILE A1114 -22.173 1.354 -73.482 1.00138.34 C ATOM 8267 N SER A1115 -19.109 5.230 -76.607 1.00137.17 N ATOM 8268 CA SER A1115 -18.797 6.618 -76.999 1.00132.19 C ATOM 8269 C SER A1115 -18.955 6.867 -78.515 1.00129.40 C ATOM 8270 O SER A1115 -19.366 7.956 -78.936 1.00138.25 O ATOM 8271 CB SER A1115 -17.367 6.982 -76.579 1.00126.96 C ATOM 8272 OG SER A1115 -16.419 6.402 -77.467 1.00129.44 O ATOM 8273 N LYS A1116 -18.662 5.842 -79.316 1.00120.37 N ATOM 8274 CA LYS A1116 -18.727 5.940 -80.776 1.00123.07 C ATOM 8275 C LYS A1116 -20.149 5.815 -81.345 1.00113.13 C ATOM 8276 O LYS A1116 -20.362 6.036 -82.532 1.00103.54 O ATOM 8277 CB LYS A1116 -17.751 4.967 -81.446 1.00127.44 C ATOM 8278 CG LYS A1116 -17.112 5.574 -82.689 1.00133.68 C ATOM 8279 CD LYS A1116 -16.618 4.539 -83.684 1.00136.25 C ATOM 8280 CE LYS A1116 -16.455 5.183 -85.051 1.00144.14 C ATOM 8281 NZ LYS A1116 -16.006 4.206 -86.076 1.00153.39 N ATOM 8282 N ASN A1117 -21.117 5.458 -80.492 1.00111.01 N ATOM 8283 CA ASN A1117 -22.521 5.254 -80.874 1.00113.98 C ATOM 8284 C ASN A1117 -23.372 5.372 -79.607 1.00114.21 C ATOM 8285 O ASN A1117 -23.933 4.382 -79.125 1.00119.10 O ATOM 8286 CB ASN A1117 -22.654 3.886 -81.545 1.00114.22 C ATOM 8287 CG ASN A1117 -24.090 3.457 -81.738 1.00113.88 C ATOM 8288 OD1 ASN A1117 -25.019 4.231 -81.495 1.00103.65 O ATOM 8289 ND2 ASN A1117 -24.281 2.203 -82.166 1.00116.51 N ATOM 8290 N PRO A1118 -23.453 6.602 -79.037 1.00108.76 N ATOM 8291 CA PRO A1118 -24.085 6.763 -77.717 1.00103.32 C ATOM 8292 C PRO A1118 -25.597 6.571 -77.708 1.00 99.34 C ATOM 8293 O PRO A1118 -26.138 6.294 -76.642 1.00 95.83 O ATOM 8294 CB PRO A1118 -23.649 8.168 -77.279 1.00105.41 C ATOM 8295 CG PRO A1118 -22.373 8.406 -78.014 1.00104.58 C ATOM 8296 CD PRO A1118 -22.627 7.781 -79.362 1.00109.62 C ATOM 8297 N LYS A1119 -26.258 6.678 -78.861 1.00112.29 N ATOM 8298 CA LYS A1119 -27.694 6.473 -78.961 1.00132.84 C ATOM 8299 C LYS A1119 -28.106 5.050 -79.405 1.00128.28 C ATOM 8300 O LYS A1119 -29.240 4.850 -79.806 1.00127.97 O ATOM 8301 CB LYS A1119 -28.274 7.469 -79.978 1.00146.11 C ATOM 8302 CG LYS A1119 -28.219 8.932 -79.556 1.00155.87 C ATOM 8303 CD LYS A1119 -29.254 9.264 -78.485 1.00154.63 C ATOM 8304 CE LYS A1119 -29.795 10.679 -78.643 1.00155.52 C ATOM 8305 NZ LYS A1119 -28.730 11.707 -78.501 1.00158.38 N ATOM 8306 N GLY A1120 -27.171 4.110 -79.340 1.00124.26 N ATOM 8307 CA GLY A1120 -27.411 2.751 -79.838 1.00117.91 C ATOM 8308 C GLY A1120 -27.951 1.832 -78.758 1.00112.00 C ATOM 8309 O GLY A1120 -27.728 2.049 -77.570 1.00103.40 O ATOM 8310 N THR A1121 -28.674 0.805 -79.189 1.00107.38 N ATOM 8311 CA THR A1121 -29.235 -0.196 -78.292 1.00104.66 C ATOM 8312 C THR A1121 -28.155 -1.119 -77.739 1.00103.73 C ATOM 8313 O THR A1121 -27.058 -1.174 -78.285 1.00109.76 O ATOM 8314 CB THR A1121 -30.239 -1.084 -79.071 1.00106.12 C ATOM 8315 OG1 THR A1121 -29.630 -1.564 -80.281 1.00 99.66 O ATOM 8316 CG2 THR A1121 -31.492 -0.297 -79.437 1.00104.08 C ATOM 8317 N TRP A1122 -28.459 -1.847 -76.665 1.00100.36 N ATOM 8318 CA TRP A1122 -27.537 -2.878 -76.160 1.00 95.00 C ATOM 8319 C TRP A1122 -27.297 -4.025 -77.177 1.00 95.45 C ATOM 8320 O TRP A1122 -26.204 -4.601 -77.229 1.00 98.17 O ATOM 8321 CB TRP A1122 -28.041 -3.439 -74.820 1.00 94.87 C ATOM 8322 CG TRP A1122 -27.451 -2.758 -73.616 1.00 94.24 C ATOM 8323 CD1 TRP A1122 -28.084 -1.900 -72.754 1.00 97.92 C ATOM 8324 CD2 TRP A1122 -26.109 -2.886 -73.138 1.00 91.18 C ATOM 8325 NE1 TRP A1122 -27.213 -1.488 -71.765 1.00 94.12 N ATOM 8326 CE2 TRP A1122 -25.991 -2.076 -71.980 1.00 95.71 C ATOM 8327 CE3 TRP A1122 -24.992 -3.609 -73.569 1.00 89.11 C ATOM 8328 CZ2 TRP A1122 -24.781 -1.970 -71.248 1.00 91.78 C ATOM 8329 CZ3 TRP A1122 -23.789 -3.507 -72.837 1.00 88.06 C ATOM 8330 CH2 TRP A1122 -23.696 -2.688 -71.695 1.00 84.36 C ATOM 8331 N LYS A1123 -28.317 -4.330 -77.983 1.00 90.07 N ATOM 8332 CA LYS A1123 -28.177 -5.255 -79.099 1.00 83.10 C ATOM 8333 C LYS A1123 -27.121 -4.825 -80.105 1.00 82.65 C ATOM 8334 O LYS A1123 -26.403 -5.664 -80.638 1.00 87.99 O ATOM 8335 CB LYS A1123 -29.552 -5.463 -79.768 1.00 87.96 C ATOM 8336 CG LYS A1123 -29.509 -6.396 -80.962 1.00101.00 C ATOM 8337 CD LYS A1123 -30.717 -7.306 -81.109 1.00114.54 C ATOM 8338 CE LYS A1123 -30.403 -8.376 -82.164 1.00127.82 C ATOM 8339 NZ LYS A1123 -31.580 -9.175 -82.614 1.00131.51 N ATOM 8340 N ASP A1124 -27.037 -3.530 -80.382 1.00 88.31 N ATOM 8341 CA ASP A1124 -26.059 -2.997 -81.337 1.00 95.99 C ATOM 8342 C ASP A1124 -24.654 -3.013 -80.754 1.00100.00 C ATOM 8343 O ASP A1124 -23.697 -3.370 -81.450 1.00110.62 O ATOM 8344 CB ASP A1124 -26.485 -1.578 -81.721 1.00111.14 C ATOM 8345 CG ASP A1124 -26.108 -1.211 -83.143 1.00129.41 C ATOM 8346 OD1 ASP A1124 -25.019 -1.631 -83.606 1.00139.59 O ATOM 8347 OD2 ASP A1124 -26.904 -0.482 -83.787 1.00140.76 O ATOM 8348 N TRP A1125 -24.552 -2.607 -79.487 1.00 94.38 N ATOM 8349 CA TRP A1125 -23.282 -2.578 -78.771 1.00 98.30 C ATOM 8350 C TRP A1125 -22.701 -3.974 -78.588 1.00 95.36 C ATOM 8351 O TRP A1125 -21.508 -4.182 -78.805 1.00 91.76 O ATOM 8352 CB TRP A1125 -23.389 -1.900 -77.389 1.00103.63 C ATOM 8353 CG TRP A1125 -23.733 -0.430 -77.421 1.00105.38 C ATOM 8354 CD1 TRP A1125 -23.462 0.450 -78.415 1.00107.14 C ATOM 8355 CD2 TRP A1125 -24.400 0.314 -76.398 1.00109.80 C ATOM 8356 NE1 TRP A1125 -23.928 1.695 -78.084 1.00109.86 N ATOM 8357 CE2 TRP A1125 -24.512 1.638 -76.852 1.00108.68 C ATOM 8358 CE3 TRP A1125 -24.932 -0.018 -75.148 1.00124.58 C ATOM 8359 CZ2 TRP A1125 -25.125 2.639 -76.103 1.00124.80 C ATOM 8360 CZ3 TRP A1125 -25.545 0.981 -74.395 1.00130.96 C ATOM 8361 CH2 TRP A1125 -25.633 2.293 -74.877 1.00133.06 C ATOM 8362 N ALA A1126 -23.554 -4.916 -78.196 1.00 99.88 N ATOM 8363 CA ALA A1126 -23.170 -6.324 -78.069 1.00100.52 C ATOM 8364 C ALA A1126 -22.704 -6.906 -79.398 1.00 93.19 C ATOM 8365 O ALA A1126 -21.706 -7.621 -79.447 1.00 93.23 O ATOM 8366 CB ALA A1126 -24.336 -7.153 -77.540 1.00 97.06 C ATOM 8367 N GLN A1127 -23.420 -6.588 -80.475 1.00 91.10 N ATOM 8368 CA GLN A1127 -23.107 -7.137 -81.786 1.00 94.50 C ATOM 8369 C GLN A1127 -21.788 -6.611 -82.308 1.00 96.35 C ATOM 8370 O GLN A1127 -20.959 -7.400 -82.738 1.00101.23 O ATOM 8371 CB GLN A1127 -24.191 -6.772 -82.791 1.00102.82 C ATOM 8372 CG GLN A1127 -24.043 -7.536 -84.086 1.00106.75 C ATOM 8373 CD GLN A1127 -24.050 -9.015 -83.816 1.00105.32 C ATOM 8374 OE1 GLN A1127 -24.861 -9.488 -83.020 1.00116.50 O ATOM 8375 NE2 GLN A1127 -23.137 -9.750 -84.438 1.00101.45 N ATOM 8376 N THR A1128 -21.577 -5.296 -82.264 1.00 93.60 N ATOM 8377 CA THR A1128 -20.308 -4.727 -82.735 1.00 91.91 C ATOM 8378 C THR A1128 -19.129 -5.156 -81.846 1.00 91.14 C ATOM 8379 O THR A1128 -18.029 -5.326 -82.354 1.00 99.82 O ATOM 8380 CB THR A1128 -20.439 -3.226 -82.869 1.00 82.47 C ATOM 8381 OG1 THR A1128 -20.610 -2.697 -81.565 1.00 86.44 O ATOM 8382 CG2 THR A1128 -21.665 -2.860 -83.772 1.00 75.24 C ATOM 8383 N ALA A1129 -19.365 -5.356 -80.548 1.00 90.48 N ATOM 8384 CA ALA A1129 -18.354 -5.928 -79.646 1.00 91.68 C ATOM 8385 C ALA A1129 -17.914 -7.325 -80.095 1.00 86.60 C ATOM 8386 O ALA A1129 -16.717 -7.622 -80.149 1.00 86.91 O ATOM 8387 CB ALA A1129 -18.911 -5.993 -78.234 1.00 94.38 C ATOM 8388 N PHE A1130 -18.884 -8.162 -80.442 1.00 87.70 N ATOM 8389 CA PHE A1130 -18.575 -9.465 -81.009 1.00 97.85 C ATOM 8390 C PHE A1130 -17.801 -9.307 -82.319 1.00101.46 C ATOM 8391 O PHE A1130 -16.785 -9.971 -82.512 1.00122.24 O ATOM 8392 CB PHE A1130 -19.821 -10.302 -81.239 1.00 92.65 C ATOM 8393 CG PHE A1130 -19.514 -11.712 -81.649 1.00 87.50 C ATOM 8394 CD1 PHE A1130 -18.894 -12.578 -80.764 1.00 86.94 C ATOM 8395 CD2 PHE A1130 -19.815 -12.166 -82.926 1.00 86.23 C ATOM 8396 CE1 PHE A1130 -18.605 -13.880 -81.143 1.00 87.18 C ATOM 8397 CE2 PHE A1130 -19.530 -13.467 -83.311 1.00 85.18 C ATOM 8398 CZ PHE A1130 -18.927 -14.328 -82.417 1.00 85.64 C ATOM 8399 N ASP A1131 -18.264 -8.414 -83.191 1.00 91.77 N ATOM 8400 CA ASP A1131 -17.627 -8.195 -84.495 1.00 95.86 C ATOM 8401 C ASP A1131 -16.187 -7.666 -84.368 1.00 93.54 C ATOM 8402 O ASP A1131 -15.388 -7.847 -85.287 1.00 95.43 O ATOM 8403 CB ASP A1131 -18.464 -7.206 -85.357 1.00 97.34 C ATOM 8404 CG ASP A1131 -19.863 -7.753 -85.755 1.00 99.51 C ATOM 8405 OD1 ASP A1131 -20.177 -8.922 -85.462 1.00100.48 O ATOM 8406 OD2 ASP A1131 -20.657 -7.005 -86.378 1.00 94.89 O ATOM 8407 N GLU A1132 -15.874 -7.016 -83.243 1.00 82.23 N ATOM 8408 CA GLU A1132 -14.532 -6.511 -82.963 1.00 81.18 C ATOM 8409 C GLU A1132 -13.757 -7.367 -81.974 1.00 80.36 C ATOM 8410 O GLU A1132 -12.761 -6.910 -81.414 1.00 91.45 O ATOM 8411 CB GLU A1132 -14.602 -5.063 -82.515 1.00 91.92 C ATOM 8412 CG GLU A1132 -14.729 -4.141 -83.723 1.00104.36 C ATOM 8413 CD GLU A1132 -15.476 -2.855 -83.425 1.00114.46 C ATOM 8414 OE1 GLU A1132 -15.331 -2.323 -82.291 1.00119.47 O ATOM 8415 OE2 GLU A1132 -16.206 -2.389 -84.336 1.00108.40 O ATOM 8416 N SER A1133 -14.187 -8.607 -81.755 1.00 75.64 N ATOM 8417 CA SER A1133 -13.502 -9.533 -80.837 1.00 78.71 C ATOM 8418 C SER A1133 -13.260 -8.968 -79.436 1.00 77.24 C ATOM 8419 O SER A1133 -12.136 -8.975 -78.914 1.00 74.00 O ATOM 8420 CB SER A1133 -12.181 -10.096 -81.423 1.00 76.63 C ATOM 8421 OG SER A1133 -12.391 -10.876 -82.600 1.00 77.24 O ATOM 8422 N ILE A1134 -14.344 -8.464 -78.845 1.00 90.98 N ATOM 8423 CA ILE A1134 -14.370 -8.057 -77.450 1.00101.52 C ATOM 8424 C ILE A1134 -15.221 -9.082 -76.699 1.00106.45 C ATOM 8425 O ILE A1134 -16.340 -9.444 -77.112 1.00116.48 O ATOM 8426 CB ILE A1134 -14.920 -6.649 -77.215 1.00 99.52 C ATOM 8427 CG1 ILE A1134 -14.070 -5.632 -77.976 1.00110.39 C ATOM 8428 CG2 ILE A1134 -14.897 -6.340 -75.727 1.00 95.72 C ATOM 8429 CD1 ILE A1134 -14.664 -4.244 -78.016 1.00116.92 C ATOM 8430 N ASN A1135 -14.654 -9.556 -75.586 1.00 97.70 N ATOM 8431 CA ASN A1135 -15.262 -10.600 -74.772 1.00 88.35 C ATOM 8432 C ASN A1135 -16.452 -10.012 -73.992 1.00 93.13 C ATOM 8433 O ASN A1135 -16.341 -8.932 -73.373 1.00101.95 O ATOM 8434 CB ASN A1135 -14.207 -11.179 -73.812 1.00 85.03 C ATOM 8435 CG ASN A1135 -14.765 -12.221 -72.833 1.00 82.08 C ATOM 8436 OD1 ASN A1135 -15.777 -12.890 -73.065 1.00 85.45 O ATOM 8437 ND2 ASN A1135 -14.065 -12.380 -71.738 1.00 81.21 N ATOM 8438 N LEU A1136 -17.585 -10.724 -74.036 1.00 87.34 N ATOM 8439 CA LEU A1136 -18.829 -10.299 -73.348 1.00 81.52 C ATOM 8440 C LEU A1136 -19.172 -11.165 -72.117 1.00 85.35 C ATOM 8441 O LEU A1136 -20.321 -11.218 -71.711 1.00 85.40 O ATOM 8442 CB LEU A1136 -19.969 -10.291 -74.343 1.00 77.32 C ATOM 8443 CG LEU A1136 -19.809 -9.201 -75.414 1.00 83.21 C ATOM 8444 CD1 LEU A1136 -20.484 -9.577 -76.734 1.00 91.93 C ATOM 8445 CD2 LEU A1136 -20.320 -7.857 -74.928 1.00 76.38 C ATOM 8446 N SER A1137 -18.173 -11.813 -71.531 1.00 89.43 N ATOM 8447 CA SER A1137 -18.353 -12.582 -70.319 1.00 83.81 C ATOM 8448 C SER A1137 -17.367 -12.056 -69.292 1.00 83.26 C ATOM 8449 O SER A1137 -16.221 -11.727 -69.627 1.00 88.05 O ATOM 8450 CB SER A1137 -18.201 -14.069 -70.580 1.00 89.92 C ATOM 8451 OG SER A1137 -19.147 -14.771 -69.808 1.00 95.46 O ATOM 8452 N ALA A1138 -17.800 -11.958 -68.051 1.00 78.72 N ATOM 8453 CA ALA A1138 -16.931 -11.386 -66.995 1.00 76.64 C ATOM 8454 C ALA A1138 -17.258 -11.956 -65.650 1.00 77.57 C ATOM 8455 O ALA A1138 -18.423 -12.031 -65.262 1.00 80.32 O ATOM 8456 CB ALA A1138 -17.034 -9.874 -66.952 1.00 73.97 C ATOM 8457 N VAL A1139 -16.217 -12.395 -64.941 1.00 79.24 N ATOM 8458 CA VAL A1139 -16.313 -12.718 -63.526 1.00 75.02 C ATOM 8459 C VAL A1139 -16.285 -11.405 -62.762 1.00 82.18 C ATOM 8460 O VAL A1139 -15.585 -10.485 -63.132 1.00 99.88 O ATOM 8461 CB VAL A1139 -15.158 -13.564 -63.060 1.00 74.70 C ATOM 8462 CG1 VAL A1139 -15.232 -13.732 -61.553 1.00 81.28 C ATOM 8463 CG2 VAL A1139 -15.212 -14.914 -63.759 1.00 77.68 C ATOM 8464 N GLY A1140 -17.075 -11.335 -61.703 1.00 85.06 N ATOM 8465 CA GLY A1140 -17.040 -10.242 -60.738 1.00 80.06 C ATOM 8466 C GLY A1140 -16.612 -10.838 -59.431 1.00 82.69 C ATOM 8467 O GLY A1140 -16.882 -12.015 -59.165 1.00 77.32 O ATOM 8468 N TYR A1141 -15.927 -10.035 -58.631 1.00 86.61 N ATOM 8469 CA TYR A1141 -15.332 -10.496 -57.374 1.00 82.81 C ATOM 8470 C TYR A1141 -15.252 -9.366 -56.369 1.00 83.87 C ATOM 8471 O TYR A1141 -14.829 -8.257 -56.688 1.00 88.38 O ATOM 8472 CB TYR A1141 -13.921 -11.023 -57.617 1.00 78.25 C ATOM 8473 CG TYR A1141 -13.350 -11.771 -56.442 1.00 80.72 C ATOM 8474 CD1 TYR A1141 -13.993 -12.893 -55.939 1.00 86.20 C ATOM 8475 CD2 TYR A1141 -12.154 -11.387 -55.846 1.00 85.08 C ATOM 8476 CE1 TYR A1141 -13.475 -13.606 -54.863 1.00 83.96 C ATOM 8477 CE2 TYR A1141 -11.621 -12.098 -54.770 1.00 85.02 C ATOM 8478 CZ TYR A1141 -12.286 -13.215 -54.279 1.00 79.09 C ATOM 8479 OH TYR A1141 -11.798 -13.945 -53.210 1.00 61.54 O ATOM 8480 N PHE A1142 -15.685 -9.656 -55.155 1.00 87.01 N ATOM 8481 CA PHE A1142 -15.481 -8.766 -54.016 1.00 89.45 C ATOM 8482 C PHE A1142 -14.747 -9.552 -52.941 1.00 81.01 C ATOM 8483 O PHE A1142 -15.146 -10.657 -52.580 1.00 63.65 O ATOM 8484 CB PHE A1142 -16.805 -8.256 -53.494 1.00 98.62 C ATOM 8485 CG PHE A1142 -16.647 -7.446 -52.280 1.00 96.75 C ATOM 8486 CD1 PHE A1142 -15.969 -6.241 -52.353 1.00 93.60 C ATOM 8487 CD2 PHE A1142 -17.083 -7.914 -51.062 1.00 94.98 C ATOM 8488 CE1 PHE A1142 -15.764 -5.481 -51.232 1.00 92.20 C ATOM 8489 CE2 PHE A1142 -16.889 -7.153 -49.932 1.00102.63 C ATOM 8490 CZ PHE A1142 -16.222 -5.937 -50.017 1.00 98.53 C ATOM 8491 N ARG A1143 -13.679 -8.944 -52.419 1.00 89.84 N ATOM 8492 CA ARG A1143 -12.720 -9.650 -51.564 1.00 87.09 C ATOM 8493 C ARG A1143 -13.199 -9.818 -50.136 1.00 86.90 C ATOM 8494 O ARG A1143 -12.746 -10.720 -49.444 1.00 75.16 O ATOM 8495 CB ARG A1143 -11.399 -8.898 -51.534 1.00 87.39 C ATOM 8496 CG ARG A1143 -10.866 -8.541 -52.914 1.00100.36 C ATOM 8497 CD ARG A1143 -9.389 -8.157 -52.892 1.00112.65 C ATOM 8498 NE ARG A1143 -8.557 -9.223 -52.321 1.00123.31 N ATOM 8499 CZ ARG A1143 -7.226 -9.264 -52.350 1.00128.81 C ATOM 8500 NH1 ARG A1143 -6.513 -8.290 -52.914 1.00136.31 N ATOM 8501 NH2 ARG A1143 -6.600 -10.304 -51.808 1.00132.82 N ATOM 8502 N GLY A1144 -14.094 -8.941 -49.689 1.00 92.23 N ATOM 8503 CA GLY A1144 -14.683 -9.024 -48.356 1.00 88.54 C ATOM 8504 C GLY A1144 -14.351 -7.826 -47.511 1.00 92.66 C ATOM 8505 O GLY A1144 -13.319 -7.182 -47.704 1.00 95.46 O ATOM 8506 N TYR A1145 -15.240 -7.519 -46.566 1.00105.77 N ATOM 8507 CA TYR A1145 -15.041 -6.414 -45.639 1.00114.34 C ATOM 8508 C TYR A1145 -13.937 -6.853 -44.674 1.00113.53 C ATOM 8509 O TYR A1145 -13.921 -8.012 -44.206 1.00102.12 O ATOM 8510 CB TYR A1145 -16.328 -6.079 -44.849 1.00120.74 C ATOM 8511 CG TYR A1145 -17.596 -5.672 -45.633 1.00117.71 C ATOM 8512 CD1 TYR A1145 -17.553 -4.761 -46.702 1.00111.55 C ATOM 8513 CD2 TYR A1145 -18.859 -6.147 -45.228 1.00118.77 C ATOM 8514 CE1 TYR A1145 -18.722 -4.384 -47.375 1.00120.45 C ATOM 8515 CE2 TYR A1145 -20.030 -5.780 -45.891 1.00124.78 C ATOM 8516 CZ TYR A1145 -19.974 -4.904 -46.969 1.00127.66 C ATOM 8517 OH TYR A1145 -21.166 -4.560 -47.623 1.00113.41 O ATOM 8518 N GLU A1146 -13.009 -5.928 -44.398 1.00109.97 N ATOM 8519 CA GLU A1146 -11.936 -6.187 -43.456 1.00103.82 C ATOM 8520 C GLU A1146 -12.568 -6.389 -42.084 1.00111.42 C ATOM 8521 O GLU A1146 -13.494 -5.660 -41.703 1.00124.32 O ATOM 8522 CB GLU A1146 -10.924 -5.053 -43.413 1.00103.64 C ATOM 8523 CG GLU A1146 -10.085 -4.930 -44.674 1.00111.60 C ATOM 8524 CD GLU A1146 -9.255 -6.172 -44.987 1.00118.45 C ATOM 8525 OE1 GLU A1146 -8.553 -6.715 -44.094 1.00112.76 O ATOM 8526 OE2 GLU A1146 -9.293 -6.597 -46.159 1.00124.67 O ATOM 8527 N SER A1147 -12.085 -7.392 -41.358 1.00113.27 N ATOM 8528 CA SER A1147 -12.689 -7.788 -40.092 1.00124.24 C ATOM 8529 C SER A1147 -11.739 -8.633 -39.262 1.00125.52 C ATOM 8530 O SER A1147 -11.031 -9.487 -39.812 1.00146.87 O ATOM 8531 CB SER A1147 -13.969 -8.562 -40.347 1.00135.20 C ATOM 8532 OG SER A1147 -14.143 -9.542 -39.344 1.00148.29 O ATOM 8533 N ASP A1148 -11.722 -8.405 -37.951 1.00116.71 N ATOM 8534 CA ASP A1148 -10.894 -9.205 -37.055 1.00117.00 C ATOM 8535 C ASP A1148 -11.275 -9.075 -35.575 1.00111.02 C ATOM 8536 O ASP A1148 -11.929 -8.128 -35.129 1.00106.55 O ATOM 8537 CB ASP A1148 -9.411 -8.890 -37.251 1.00120.86 C ATOM 8538 CG ASP A1148 -9.142 -7.425 -37.256 1.00124.72 C ATOM 8539 OD1 ASP A1148 -9.152 -6.827 -36.153 1.00127.23 O ATOM 8540 OD2 ASP A1148 -8.939 -6.881 -38.365 1.00124.51 O ATOM 8541 N MET A1149 -10.769 -10.043 -34.826 1.00111.64 N ATOM 8542 CA MET A1149 -11.067 -10.215 -33.429 1.00116.95 C ATOM 8543 C MET A1149 -9.928 -11.020 -32.790 1.00124.63 C ATOM 8544 O MET A1149 -9.671 -12.171 -33.154 1.00130.38 O ATOM 8545 CB MET A1149 -12.370 -10.990 -33.296 1.00120.69 C ATOM 8546 CG MET A1149 -12.898 -11.059 -31.881 1.00123.05 C ATOM 8547 SD MET A1149 -13.373 -9.420 -31.326 1.00124.03 S ATOM 8548 CE MET A1149 -13.247 -9.653 -29.560 1.00125.54 C ATOM 8549 N ASN A1150 -9.263 -10.404 -31.817 1.00128.50 N ATOM 8550 CA ASN A1150 -8.373 -11.101 -30.909 1.00125.59 C ATOM 8551 C ASN A1150 -9.226 -11.520 -29.699 1.00110.69 C ATOM 8552 O ASN A1150 -9.582 -10.684 -28.856 1.00116.62 O ATOM 8553 CB ASN A1150 -7.220 -10.185 -30.530 1.00131.72 C ATOM 8554 CG ASN A1150 -6.090 -10.932 -29.869 1.00142.32 C ATOM 8555 OD1 ASN A1150 -6.262 -11.526 -28.798 1.00140.34 O ATOM 8556 ND2 ASN A1150 -4.922 -10.915 -30.504 1.00147.82 N ATOM 8557 N TRP A1151 -9.575 -12.810 -29.639 1.00102.00 N ATOM 8558 CA TRP A1151 -10.423 -13.319 -28.564 1.00115.72 C ATOM 8559 C TRP A1151 -9.729 -13.471 -27.201 1.00120.73 C ATOM 8560 O TRP A1151 -10.408 -13.587 -26.175 1.00109.31 O ATOM 8561 CB TRP A1151 -11.124 -14.630 -28.962 1.00115.86 C ATOM 8562 CG TRP A1151 -12.495 -14.323 -29.403 1.00117.52 C ATOM 8563 CD1 TRP A1151 -12.955 -14.274 -30.678 1.00123.49 C ATOM 8564 CD2 TRP A1151 -13.572 -13.900 -28.568 1.00118.51 C ATOM 8565 NE1 TRP A1151 -14.268 -13.880 -30.690 1.00123.81 N ATOM 8566 CE2 TRP A1151 -14.668 -13.641 -29.403 1.00119.12 C ATOM 8567 CE3 TRP A1151 -13.716 -13.725 -27.187 1.00131.73 C ATOM 8568 CZ2 TRP A1151 -15.898 -13.228 -28.909 1.00125.70 C ATOM 8569 CZ3 TRP A1151 -14.944 -13.316 -26.695 1.00131.27 C ATOM 8570 CH2 TRP A1151 -16.015 -13.071 -27.553 1.00127.67 C ATOM 8571 N GLU A1152 -8.395 -13.466 -27.183 1.00126.23 N ATOM 8572 CA GLU A1152 -7.652 -13.505 -25.923 1.00129.58 C ATOM 8573 C GLU A1152 -7.787 -12.183 -25.172 1.00129.18 C ATOM 8574 O GLU A1152 -8.194 -12.154 -24.008 1.00117.91 O ATOM 8575 CB GLU A1152 -6.175 -13.812 -26.180 1.00124.21 C ATOM 8576 CG GLU A1152 -5.511 -14.534 -25.021 1.00132.27 C ATOM 8577 CD GLU A1152 -6.226 -15.832 -24.661 1.00142.55 C ATOM 8578 OE1 GLU A1152 -6.253 -16.769 -25.495 1.00152.90 O ATOM 8579 OE2 GLU A1152 -6.779 -15.907 -23.544 1.00142.50 O ATOM 8580 N LYS A1153 -7.453 -11.093 -25.862 1.00131.39 N ATOM 8581 CA LYS A1153 -7.574 -9.735 -25.322 1.00137.24 C ATOM 8582 C LYS A1153 -9.012 -9.213 -25.306 1.00144.93 C ATOM 8583 O LYS A1153 -9.297 -8.227 -24.631 1.00164.58 O ATOM 8584 CB LYS A1153 -6.773 -8.724 -26.165 1.00136.23 C ATOM 8585 CG LYS A1153 -5.329 -9.090 -26.451 1.00144.30 C ATOM 8586 CD LYS A1153 -4.659 -8.099 -27.402 1.00143.46 C ATOM 8587 CE LYS A1153 -3.774 -8.815 -28.420 1.00141.00 C ATOM 8588 NZ LYS A1153 -2.477 -8.144 -28.680 1.00138.88 N ATOM 8589 N GLY A1154 -9.907 -9.850 -26.062 1.00151.88 N ATOM 8590 CA GLY A1154 -11.295 -9.416 -26.149 1.00148.74 C ATOM 8591 C GLY A1154 -11.510 -8.131 -26.938 1.00150.79 C ATOM 8592 O GLY A1154 -12.532 -7.465 -26.753 1.00161.80 O ATOM 8593 N GLU A1155 -10.561 -7.775 -27.821 1.00141.39 N ATOM 8594 CA GLU A1155 -10.608 -6.531 -28.589 1.00136.46 C ATOM 8595 C GLU A1155 -10.389 -6.757 -30.085 1.00122.72 C ATOM 8596 O GLU A1155 -9.620 -7.617 -30.465 1.00126.42 O ATOM 8597 CB GLU A1155 -9.524 -5.558 -28.069 1.00150.03 C ATOM 8598 CG GLU A1155 -8.263 -5.411 -28.939 1.00154.35 C ATOM 8599 CD GLU A1155 -7.088 -4.749 -28.223 1.00151.53 C ATOM 8600 OE1 GLU A1155 -6.558 -5.358 -27.264 1.00149.58 O ATOM 8601 OE2 GLU A1155 -6.676 -3.639 -28.639 1.00135.79 O ATOM 8602 N GLY A1156 -11.055 -5.943 -30.901 1.00114.56 N ATOM 8603 CA GLY A1156 -10.980 -6.092 -32.346 1.00118.11 C ATOM 8604 C GLY A1156 -11.959 -5.204 -33.089 1.00116.89 C ATOM 8605 O GLY A1156 -12.738 -4.452 -32.468 1.00110.27 O ATOM 8606 N GLN A1157 -11.930 -5.311 -34.418 1.00118.60 N ATOM 8607 CA GLN A1157 -12.839 -4.595 -35.314 1.00123.30 C ATOM 8608 C GLN A1157 -13.634 -5.621 -36.109 1.00119.96 C ATOM 8609 O GLN A1157 -13.465 -5.731 -37.315 1.00127.31 O ATOM 8610 CB GLN A1157 -12.052 -3.687 -36.266 1.00126.33 C ATOM 8611 CG GLN A1157 -11.093 -2.731 -35.575 1.00121.41 C ATOM 8612 CD GLN A1157 -11.789 -1.494 -35.070 1.00119.79 C ATOM 8613 OE1 GLN A1157 -12.388 -0.756 -35.854 1.00133.21 O ATOM 8614 NE2 GLN A1157 -11.718 -1.254 -33.759 1.00110.44 N ATOM 8615 N PRO A1158 -14.493 -6.398 -35.426 1.00120.62 N ATOM 8616 CA PRO A1158 -15.229 -7.471 -36.093 1.00118.38 C ATOM 8617 C PRO A1158 -16.310 -7.018 -37.058 1.00112.44 C ATOM 8618 O PRO A1158 -16.612 -7.736 -38.017 1.00121.67 O ATOM 8619 CB PRO A1158 -15.875 -8.247 -34.939 1.00117.02 C ATOM 8620 CG PRO A1158 -15.918 -7.285 -33.814 1.00125.77 C ATOM 8621 CD PRO A1158 -14.725 -6.399 -33.971 1.00122.58 C ATOM 8622 N PHE A1159 -16.880 -5.832 -36.822 1.00106.57 N ATOM 8623 CA PHE A1159 -18.061 -5.381 -37.552 1.00 93.73 C ATOM 8624 C PHE A1159 -17.819 -4.189 -38.485 1.00 88.60 C ATOM 8625 O PHE A1159 -17.103 -3.237 -38.161 1.00 88.37 O ATOM 8626 CB PHE A1159 -19.182 -5.074 -36.582 1.00 95.25 C ATOM 8627 CG PHE A1159 -19.416 -6.168 -35.590 1.00 92.74 C ATOM 8628 CD1 PHE A1159 -19.910 -7.382 -35.997 1.00100.32 C ATOM 8629 CD2 PHE A1159 -19.138 -5.986 -34.257 1.00 91.49 C ATOM 8630 CE1 PHE A1159 -20.124 -8.400 -35.087 1.00102.84 C ATOM 8631 CE2 PHE A1159 -19.357 -6.997 -33.338 1.00 92.29 C ATOM 8632 CZ PHE A1159 -19.842 -8.208 -33.752 1.00 91.32 C ATOM 8633 N GLU A1160 -18.427 -4.265 -39.653 1.00 92.50 N ATOM 8634 CA GLU A1160 -18.272 -3.271 -40.719 1.00 96.31 C ATOM 8635 C GLU A1160 -19.185 -2.071 -40.478 1.00 94.45 C ATOM 8636 O GLU A1160 -18.829 -0.951 -40.819 1.00 93.19 O ATOM 8637 CB GLU A1160 -18.637 -3.939 -42.048 1.00 99.77 C ATOM 8638 CG GLU A1160 -18.665 -3.005 -43.244 1.00115.19 C ATOM 8639 CD GLU A1160 -17.291 -2.514 -43.656 1.00125.47 C ATOM 8640 OE1 GLU A1160 -16.347 -2.636 -42.843 1.00118.98 O ATOM 8641 OE2 GLU A1160 -17.159 -2.017 -44.805 1.00134.35 O ATOM 8642 N TYR A1161 -20.369 -2.326 -39.927 1.00 91.77 N ATOM 8643 CA TYR A1161 -21.353 -1.299 -39.616 1.00 92.11 C ATOM 8644 C TYR A1161 -22.401 -1.813 -38.625 1.00 98.48 C ATOM 8645 O TYR A1161 -22.447 -3.009 -38.336 1.00 94.85 O ATOM 8646 CB TYR A1161 -22.050 -0.794 -40.885 1.00 93.39 C ATOM 8647 CG TYR A1161 -22.686 -1.870 -41.725 1.00 92.53 C ATOM 8648 CD1 TYR A1161 -23.945 -2.389 -41.424 1.00 93.54 C ATOM 8649 CD2 TYR A1161 -22.033 -2.356 -42.831 1.00104.06 C ATOM 8650 CE1 TYR A1161 -24.522 -3.376 -42.208 1.00 97.52 C ATOM 8651 CE2 TYR A1161 -22.593 -3.335 -43.627 1.00115.12 C ATOM 8652 CZ TYR A1161 -23.835 -3.845 -43.320 1.00109.57 C ATOM 8653 OH TYR A1161 -24.338 -4.821 -44.153 1.00106.19 O ATOM 8654 N PHE A1162 -23.224 -0.890 -38.119 1.00102.02 N ATOM 8655 CA PHE A1162 -24.215 -1.217 -37.106 1.00102.90 C ATOM 8656 C PHE A1162 -25.591 -0.712 -37.544 1.00105.45 C ATOM 8657 O PHE A1162 -25.740 0.447 -37.904 1.00103.31 O ATOM 8658 CB PHE A1162 -23.870 -0.511 -35.814 1.00100.84 C ATOM 8659 CG PHE A1162 -22.548 -0.905 -35.264 1.00103.52 C ATOM 8660 CD1 PHE A1162 -21.382 -0.425 -35.837 1.00106.94 C ATOM 8661 CD2 PHE A1162 -22.464 -1.766 -34.187 1.00 99.04 C ATOM 8662 CE1 PHE A1162 -20.149 -0.791 -35.342 1.00102.84 C ATOM 8663 CE2 PHE A1162 -21.238 -2.132 -33.681 1.00103.48 C ATOM 8664 CZ PHE A1162 -20.078 -1.644 -34.259 1.00108.66 C ATOM 8665 N VAL A1163 -26.565 -1.602 -37.535 1.00109.05 N ATOM 8666 CA VAL A1163 -27.932 -1.209 -37.811 1.00112.93 C ATOM 8667 C VAL A1163 -28.550 -0.755 -36.496 1.00123.03 C ATOM 8668 O VAL A1163 -28.457 -1.468 -35.476 1.00112.38 O ATOM 8669 CB VAL A1163 -28.665 -2.340 -38.503 1.00114.87 C ATOM 8670 CG1 VAL A1163 -29.997 -1.847 -39.034 1.00119.01 C ATOM 8671 CG2 VAL A1163 -27.784 -2.861 -39.636 1.00117.77 C ATOM 8672 N TYR A1164 -29.150 0.444 -36.518 1.00126.63 N ATOM 8673 CA TYR A1164 -29.814 1.015 -35.335 1.00109.16 C ATOM 8674 C TYR A1164 -31.332 1.061 -35.455 1.00103.55 C ATOM 8675 O TYR A1164 -31.865 1.301 -36.520 1.00 98.24 O ATOM 8676 CB TYR A1164 -29.320 2.438 -35.044 1.00100.10 C ATOM 8677 CG TYR A1164 -27.890 2.482 -34.616 1.00 93.32 C ATOM 8678 CD1 TYR A1164 -27.499 1.899 -33.414 1.00 88.94 C ATOM 8679 CD2 TYR A1164 -26.909 3.088 -35.423 1.00 85.93 C ATOM 8680 CE1 TYR A1164 -26.170 1.917 -33.019 1.00 90.89 C ATOM 8681 CE2 TYR A1164 -25.571 3.114 -35.035 1.00 80.32 C ATOM 8682 CZ TYR A1164 -25.204 2.520 -33.837 1.00 85.79 C ATOM 8683 OH TYR A1164 -23.887 2.520 -33.429 1.00 84.63 O ATOM 8684 N GLY A1165 -32.011 0.839 -34.345 1.00 96.25 N ATOM 8685 CA GLY A1165 -33.454 0.878 -34.348 1.00 90.71 C ATOM 8686 C GLY A1165 -34.017 0.981 -32.962 1.00 89.03 C ATOM 8687 O GLY A1165 -33.270 0.988 -31.976 1.00101.56 O ATOM 8688 N ALA A1166 -35.328 1.083 -32.895 1.00 87.29 N ATOM 8689 CA ALA A1166 -36.060 1.051 -31.633 1.00100.15 C ATOM 8690 C ALA A1166 -37.457 0.542 -31.899 1.00 95.03 C ATOM 8691 O ALA A1166 -37.922 0.615 -33.029 1.00 92.42 O ATOM 8692 CB ALA A1166 -36.115 2.436 -31.017 1.00115.32 C ATOM 8693 N ALA A1167 -38.126 0.040 -30.864 1.00 94.43 N ATOM 8694 CA ALA A1167 -39.470 -0.484 -31.028 1.00 97.14 C ATOM 8695 C ALA A1167 -40.268 -0.404 -29.745 1.00102.50 C ATOM 8696 O ALA A1167 -39.767 -0.742 -28.672 1.00 94.48 O ATOM 8697 CB ALA A1167 -39.408 -1.930 -31.480 1.00104.30 C ATOM 8698 N CYS A1168 -41.519 0.028 -29.886 1.00105.74 N ATOM 8699 CA CYS A1168 -42.456 0.176 -28.795 1.00102.86 C ATOM 8700 C CYS A1168 -43.612 -0.785 -29.032 1.00 96.64 C ATOM 8701 O CYS A1168 -44.067 -0.929 -30.169 1.00 95.34 O ATOM 8702 CB CYS A1168 -42.948 1.613 -28.770 1.00104.06 C ATOM 8703 SG CYS A1168 -44.343 1.855 -27.672 1.00116.42 S ATOM 8704 N SER A1169 -44.087 -1.437 -27.971 1.00 88.11 N ATOM 8705 CA SER A1169 -45.198 -2.404 -28.065 1.00 89.09 C ATOM 8706 C SER A1169 -46.168 -2.304 -26.882 1.00 85.82 C ATOM 8707 O SER A1169 -45.736 -2.178 -25.743 1.00 86.17 O ATOM 8708 CB SER A1169 -44.671 -3.852 -28.077 1.00 90.74 C ATOM 8709 OG SER A1169 -44.503 -4.371 -29.384 1.00 89.71 O ATOM 8710 N GLU A1170 -47.464 -2.417 -27.174 1.00 88.28 N ATOM 8711 CA GLU A1170 -48.511 -2.362 -26.175 1.00 96.95 C ATOM 8712 C GLU A1170 -49.368 -3.616 -26.228 1.00100.42 C ATOM 8713 O GLU A1170 -49.735 -4.068 -27.309 1.00106.23 O ATOM 8714 CB GLU A1170 -49.387 -1.146 -26.386 1.00 98.34 C ATOM 8715 CG GLU A1170 -50.532 -0.999 -25.395 1.00 99.26 C ATOM 8716 CD GLU A1170 -51.352 0.265 -25.632 1.00114.20 C ATOM 8717 OE1 GLU A1170 -50.999 1.064 -26.530 1.00120.58 O ATOM 8718 OE2 GLU A1170 -52.358 0.473 -24.917 1.00126.01 O ATOM 8719 N VAL A1171 -49.692 -4.156 -25.059 1.00 96.36 N ATOM 8720 CA VAL A1171 -50.498 -5.381 -24.940 1.00 91.02 C ATOM 8721 C VAL A1171 -51.573 -5.255 -23.861 1.00 93.55 C ATOM 8722 O VAL A1171 -51.479 -4.409 -22.990 1.00104.84 O ATOM 8723 CB VAL A1171 -49.585 -6.588 -24.641 1.00 93.69 C ATOM 8724 CG1 VAL A1171 -48.400 -6.600 -25.593 1.00 92.78 C ATOM 8725 CG2 VAL A1171 -49.084 -6.567 -23.208 1.00 94.87 C ATOM 8726 N GLU A1172 -52.604 -6.091 -23.943 1.00 93.46 N ATOM 8727 CA GLU A1172 -53.566 -6.269 -22.853 1.00 98.14 C ATOM 8728 C GLU A1172 -53.625 -7.757 -22.535 1.00 92.49 C ATOM 8729 O GLU A1172 -53.807 -8.576 -23.441 1.00 92.30 O ATOM 8730 CB GLU A1172 -54.957 -5.761 -23.259 1.00100.14 C ATOM 8731 CG GLU A1172 -56.070 -6.237 -22.324 1.00107.33 C ATOM 8732 CD GLU A1172 -57.378 -5.448 -22.408 1.00110.95 C ATOM 8733 OE1 GLU A1172 -57.637 -4.742 -23.409 1.00103.84 O ATOM 8734 OE2 GLU A1172 -58.181 -5.564 -21.454 1.00122.17 O ATOM 8735 N ILE A1173 -53.481 -8.096 -21.258 1.00 85.82 N ATOM 8736 CA ILE A1173 -53.570 -9.483 -20.800 1.00 86.60 C ATOM 8737 C ILE A1173 -54.867 -9.747 -20.058 1.00 91.35 C ATOM 8738 O ILE A1173 -55.448 -8.845 -19.494 1.00 99.04 O ATOM 8739 CB ILE A1173 -52.340 -9.858 -19.962 1.00 85.02 C ATOM 8740 CG1 ILE A1173 -52.572 -9.585 -18.480 1.00 88.70 C ATOM 8741 CG2 ILE A1173 -51.130 -9.103 -20.493 1.00 85.73 C ATOM 8742 CD1 ILE A1173 -51.304 -9.515 -17.654 1.00 93.40 C ATOM 8743 N ASP A1174 -55.308 -10.998 -20.104 1.00106.99 N ATOM 8744 CA ASP A1174 -56.411 -11.522 -19.309 1.00112.70 C ATOM 8745 C ASP A1174 -55.747 -12.228 -18.127 1.00108.27 C ATOM 8746 O ASP A1174 -55.094 -13.254 -18.302 1.00115.47 O ATOM 8747 CB ASP A1174 -57.314 -12.455 -20.140 1.00110.30 C ATOM 8748 CG ASP A1174 -58.522 -12.959 -19.360 1.00115.72 C ATOM 8749 OD1 ASP A1174 -58.475 -12.934 -18.102 1.00113.65 O ATOM 8750 OD2 ASP A1174 -59.510 -13.386 -20.012 1.00113.35 O ATOM 8751 N CYS A1175 -55.907 -11.674 -16.933 1.00100.51 N ATOM 8752 CA CYS A1175 -55.276 -12.251 -15.752 1.00100.41 C ATOM 8753 C CYS A1175 -55.934 -13.549 -15.278 1.00 97.41 C ATOM 8754 O CYS A1175 -55.337 -14.285 -14.512 1.00 97.82 O ATOM 8755 CB CYS A1175 -55.241 -11.237 -14.617 1.00108.29 C ATOM 8756 SG CYS A1175 -54.353 -9.724 -15.049 1.00107.58 S ATOM 8757 N LEU A1176 -57.160 -13.815 -15.720 1.00 94.60 N ATOM 8758 CA LEU A1176 -57.911 -15.028 -15.375 1.00109.67 C ATOM 8759 C LEU A1176 -57.593 -16.251 -16.258 1.00115.41 C ATOM 8760 O LEU A1176 -57.726 -17.390 -15.815 1.00117.42 O ATOM 8761 CB LEU A1176 -59.405 -14.750 -15.545 1.00111.35 C ATOM 8762 CG LEU A1176 -60.188 -14.097 -14.423 1.00103.01 C ATOM 8763 CD1 LEU A1176 -61.343 -13.305 -15.018 1.00 96.25 C ATOM 8764 CD2 LEU A1176 -60.658 -15.178 -13.457 1.00105.04 C ATOM 8765 N THR A1177 -57.227 -16.004 -17.513 1.00109.90 N ATOM 8766 CA THR A1177 -56.941 -17.067 -18.465 1.00101.99 C ATOM 8767 C THR A1177 -55.481 -17.091 -18.954 1.00 97.65 C ATOM 8768 O THR A1177 -55.052 -18.086 -19.547 1.00112.63 O ATOM 8769 CB THR A1177 -57.876 -16.965 -19.695 1.00107.64 C ATOM 8770 OG1 THR A1177 -57.495 -15.853 -20.517 1.00108.90 O ATOM 8771 CG2 THR A1177 -59.335 -16.804 -19.269 1.00109.68 C ATOM 8772 N GLY A1178 -54.724 -16.022 -18.716 1.00 89.21 N ATOM 8773 CA GLY A1178 -53.382 -15.893 -19.249 1.00 87.82 C ATOM 8774 C GLY A1178 -53.302 -15.571 -20.729 1.00 86.71 C ATOM 8775 O GLY A1178 -52.228 -15.660 -21.321 1.00 97.65 O ATOM 8776 N ASP A1179 -54.421 -15.179 -21.324 1.00 87.60 N ATOM 8777 CA ASP A1179 -54.455 -14.778 -22.738 1.00 96.93 C ATOM 8778 C ASP A1179 -53.804 -13.401 -22.873 1.00 87.94 C ATOM 8779 O ASP A1179 -53.605 -12.707 -21.879 1.00 84.75 O ATOM 8780 CB ASP A1179 -55.913 -14.724 -23.217 1.00102.50 C ATOM 8781 CG ASP A1179 -56.043 -14.645 -24.723 1.00102.55 C ATOM 8782 OD1 ASP A1179 -56.078 -15.715 -25.367 1.00111.26 O ATOM 8783 OD2 ASP A1179 -56.138 -13.516 -25.256 1.00102.94 O ATOM 8784 N HIS A1180 -53.459 -13.014 -24.083 1.00 86.63 N ATOM 8785 CA HIS A1180 -53.079 -11.633 -24.356 1.00 86.97 C ATOM 8786 C HIS A1180 -53.378 -11.219 -25.787 1.00 84.83 C ATOM 8787 O HIS A1180 -53.686 -12.061 -26.644 1.00105.02 O ATOM 8788 CB HIS A1180 -51.606 -11.410 -24.036 1.00 88.98 C ATOM 8789 CG HIS A1180 -50.677 -11.752 -25.156 1.00 91.40 C ATOM 8790 ND1 HIS A1180 -50.305 -13.045 -25.446 1.00 90.67 N ATOM 8791 CD2 HIS A1180 -50.021 -10.963 -26.041 1.00 94.84 C ATOM 8792 CE1 HIS A1180 -49.462 -13.040 -26.466 1.00 92.05 C ATOM 8793 NE2 HIS A1180 -49.272 -11.789 -26.844 1.00 90.30 N ATOM 8794 N LYS A1181 -53.296 -9.919 -26.016 1.00 71.25 N ATOM 8795 CA LYS A1181 -53.570 -9.334 -27.309 1.00 88.41 C ATOM 8796 C LYS A1181 -52.538 -8.248 -27.533 1.00 85.59 C ATOM 8797 O LYS A1181 -52.268 -7.483 -26.619 1.00 93.89 O ATOM 8798 CB LYS A1181 -54.972 -8.713 -27.368 1.00 97.95 C ATOM 8799 CG LYS A1181 -55.301 -8.030 -28.700 1.00106.60 C ATOM 8800 CD LYS A1181 -55.247 -8.991 -29.899 1.00114.33 C ATOM 8801 CE LYS A1181 -55.232 -8.229 -31.220 1.00120.15 C ATOM 8802 NZ LYS A1181 -55.758 -9.014 -32.371 1.00124.11 N ATOM 8803 N ASN A1182 -51.948 -8.231 -28.724 1.00 86.98 N ATOM 8804 CA ASN A1182 -51.007 -7.200 -29.112 1.00 89.62 C ATOM 8805 C ASN A1182 -51.809 -6.085 -29.691 1.00 87.86 C ATOM 8806 O ASN A1182 -52.449 -6.251 -30.718 1.00101.63 O ATOM 8807 CB ASN A1182 -50.005 -7.741 -30.095 1.00 95.31 C ATOM 8808 CG ASN A1182 -49.128 -8.793 -29.472 1.00 97.79 C ATOM 8809 OD1 ASN A1182 -49.200 -9.045 -28.259 1.00 80.00 O ATOM 8810 ND2 ASN A1182 -48.295 -9.425 -30.295 1.00109.47 N ATOM 8811 N ILE A1183 -51.788 -4.942 -29.019 1.00 91.54 N ATOM 8812 CA ILE A1183 -52.610 -3.807 -29.414 1.00 91.87 C ATOM 8813 C ILE A1183 -51.922 -3.026 -30.519 1.00 94.14 C ATOM 8814 O ILE A1183 -52.510 -2.756 -31.558 1.00 91.99 O ATOM 8815 CB ILE A1183 -52.877 -2.887 -28.201 1.00 88.06 C ATOM 8816 CG1 ILE A1183 -54.025 -3.468 -27.374 1.00 91.32 C ATOM 8817 CG2 ILE A1183 -53.220 -1.465 -28.623 1.00 88.37 C ATOM 8818 CD1 ILE A1183 -53.738 -3.556 -25.897 1.00 98.13 C ATOM 8819 N ARG A1184 -50.670 -2.662 -30.281 1.00 90.86 N ATOM 8820 CA ARG A1184 -49.963 -1.784 -31.186 1.00 95.77 C ATOM 8821 C ARG A1184 -48.468 -1.971 -31.078 1.00 98.48 C ATOM 8822 O ARG A1184 -47.947 -2.203 -29.988 1.00106.25 O ATOM 8823 CB ARG A1184 -50.287 -0.330 -30.877 1.00 97.62 C ATOM 8824 CG ARG A1184 -49.529 0.653 -31.740 1.00 95.34 C ATOM 8825 CD ARG A1184 -49.753 2.070 -31.279 1.00 98.13 C ATOM 8826 NE ARG A1184 -49.313 3.003 -32.302 1.00103.67 N ATOM 8827 CZ ARG A1184 -49.417 4.318 -32.205 1.00107.08 C ATOM 8828 NH1 ARG A1184 -49.922 4.861 -31.111 1.00107.87 N ATOM 8829 NH2 ARG A1184 -49.008 5.091 -33.207 1.00116.91 N ATOM 8830 N THR A1185 -47.791 -1.837 -32.211 1.00 93.43 N ATOM 8831 CA THR A1185 -46.346 -1.840 -32.248 1.00 88.37 C ATOM 8832 C THR A1185 -45.844 -0.735 -33.174 1.00 92.79 C ATOM 8833 O THR A1185 -46.430 -0.489 -34.224 1.00 88.84 O ATOM 8834 CB THR A1185 -45.823 -3.216 -32.662 1.00 89.54 C ATOM 8835 OG1 THR A1185 -46.425 -4.217 -31.833 1.00 78.80 O ATOM 8836 CG2 THR A1185 -44.320 -3.291 -32.508 1.00 95.14 C ATOM 8837 N ASP A1186 -44.788 -0.052 -32.742 1.00102.35 N ATOM 8838 CA ASP A1186 -44.196 1.081 -33.459 1.00110.63 C ATOM 8839 C ASP A1186 -42.708 0.784 -33.626 1.00111.73 C ATOM 8840 O ASP A1186 -42.046 0.448 -32.649 1.00 97.44 O ATOM 8841 CB ASP A1186 -44.312 2.335 -32.593 1.00117.23 C ATOM 8842 CG ASP A1186 -45.743 2.756 -32.352 1.00120.16 C ATOM 8843 OD1 ASP A1186 -46.355 3.312 -33.291 1.00124.19 O ATOM 8844 OD2 ASP A1186 -46.239 2.561 -31.217 1.00107.93 O ATOM 8845 N ILE A1187 -42.196 0.901 -34.849 1.00107.90 N ATOM 8846 CA ILE A1187 -40.804 0.564 -35.145 1.00102.33 C ATOM 8847 C ILE A1187 -40.155 1.645 -35.987 1.00 95.64 C ATOM 8848 O ILE A1187 -40.643 1.977 -37.066 1.00 98.75 O ATOM 8849 CB ILE A1187 -40.670 -0.799 -35.847 1.00105.19 C ATOM 8850 CG1 ILE A1187 -41.219 -1.915 -34.943 1.00107.57 C ATOM 8851 CG2 ILE A1187 -39.209 -1.063 -36.187 1.00108.08 C ATOM 8852 CD1 ILE A1187 -41.257 -3.294 -35.567 1.00109.59 C ATOM 8853 N VAL A1188 -39.031 2.181 -35.509 1.00 95.87 N ATOM 8854 CA VAL A1188 -38.179 3.060 -36.318 1.00 96.92 C ATOM 8855 C VAL A1188 -36.851 2.356 -36.557 1.00 93.94 C ATOM 8856 O VAL A1188 -36.329 1.673 -35.668 1.00 91.15 O ATOM 8857 CB VAL A1188 -37.900 4.406 -35.657 1.00103.25 C ATOM 8858 CG1 VAL A1188 -37.209 5.333 -36.656 1.00103.95 C ATOM 8859 CG2 VAL A1188 -39.190 5.021 -35.138 1.00107.79 C ATOM 8860 N MET A1189 -36.290 2.565 -37.745 1.00 88.45 N ATOM 8861 CA MET A1189 -35.124 1.791 -38.184 1.00 99.15 C ATOM 8862 C MET A1189 -34.192 2.553 -39.110 1.00105.09 C ATOM 8863 O MET A1189 -34.619 3.011 -40.155 1.00108.78 O ATOM 8864 CB MET A1189 -35.621 0.523 -38.881 1.00103.58 C ATOM 8865 CG MET A1189 -34.598 -0.610 -38.990 1.00106.84 C ATOM 8866 SD MET A1189 -34.298 -1.582 -37.500 1.00113.61 S ATOM 8867 CE MET A1189 -35.874 -1.455 -36.657 1.00113.51 C ATOM 8868 N ASP A1190 -32.918 2.615 -38.738 1.00105.56 N ATOM 8869 CA ASP A1190 -31.842 3.191 -39.569 1.00112.19 C ATOM 8870 C ASP A1190 -31.334 2.135 -40.541 1.00115.41 C ATOM 8871 O ASP A1190 -30.631 1.224 -40.114 1.00127.74 O ATOM 8872 CB ASP A1190 -30.695 3.648 -38.631 1.00120.92 C ATOM 8873 CG ASP A1190 -29.432 4.154 -39.370 1.00123.89 C ATOM 8874 OD1 ASP A1190 -29.484 4.483 -40.582 1.00117.39 O ATOM 8875 OD2 ASP A1190 -28.371 4.235 -38.696 1.00113.32 O ATOM 8876 N VAL A1191 -31.667 2.262 -41.822 1.00114.73 N ATOM 8877 CA VAL A1191 -31.295 1.275 -42.842 1.00121.15 C ATOM 8878 C VAL A1191 -30.266 1.786 -43.868 1.00129.75 C ATOM 8879 O VAL A1191 -30.001 1.103 -44.875 1.00155.21 O ATOM 8880 CB VAL A1191 -32.539 0.802 -43.599 1.00119.35 C ATOM 8881 CG1 VAL A1191 -33.540 0.249 -42.602 1.00117.91 C ATOM 8882 CG2 VAL A1191 -33.135 1.936 -44.446 1.00120.22 C ATOM 8883 N GLY A1192 -29.702 2.971 -43.618 1.00121.94 N ATOM 8884 CA GLY A1192 -28.929 3.684 -44.631 1.00115.29 C ATOM 8885 C GLY A1192 -29.843 4.044 -45.790 1.00104.40 C ATOM 8886 O GLY A1192 -30.998 4.439 -45.574 1.00 93.74 O ATOM 8887 N CYS A1193 -29.329 3.896 -47.008 1.00113.36 N ATOM 8888 CA CYS A1193 -30.164 3.954 -48.218 1.00122.44 C ATOM 8889 C CYS A1193 -30.633 2.569 -48.609 1.00118.85 C ATOM 8890 O CYS A1193 -29.858 1.769 -49.130 1.00125.60 O ATOM 8891 CB CYS A1193 -29.399 4.631 -49.351 1.00116.49 C ATOM 8892 SG CYS A1193 -28.401 5.967 -48.670 1.00120.87 S ATOM 8893 N SER A1194 -31.901 2.292 -48.365 1.00111.65 N ATOM 8894 CA SER A1194 -32.509 1.026 -48.781 1.00111.49 C ATOM 8895 C SER A1194 -32.395 0.821 -50.303 1.00112.65 C ATOM 8896 O SER A1194 -32.764 1.712 -51.076 1.00109.35 O ATOM 8897 CB SER A1194 -33.970 0.959 -48.359 1.00109.66 C ATOM 8898 OG SER A1194 -34.470 -0.356 -48.498 1.00102.74 O ATOM 8899 N ILE A1195 -31.838 -0.325 -50.709 1.00110.37 N ATOM 8900 CA ILE A1195 -31.765 -0.698 -52.135 1.00103.72 C ATOM 8901 C ILE A1195 -33.143 -1.050 -52.685 1.00103.41 C ATOM 8902 O ILE A1195 -33.435 -0.872 -53.862 1.00 94.11 O ATOM 8903 CB ILE A1195 -30.835 -1.926 -52.386 1.00107.72 C ATOM 8904 CG1 ILE A1195 -29.466 -1.763 -51.713 1.00119.13 C ATOM 8905 CG2 ILE A1195 -30.624 -2.157 -53.884 1.00101.86 C ATOM 8906 CD1 ILE A1195 -28.643 -3.039 -51.626 1.00127.16 C ATOM 8907 N ASN A1196 -34.010 -1.558 -51.819 1.00112.23 N ATOM 8908 CA ASN A1196 -35.425 -1.840 -52.147 1.00 97.58 C ATOM 8909 C ASN A1196 -36.240 -1.792 -50.861 1.00 91.78 C ATOM 8910 O ASN A1196 -36.218 -2.735 -50.078 1.00 88.02 O ATOM 8911 CB ASN A1196 -35.567 -3.215 -52.799 1.00 98.75 C ATOM 8912 CG ASN A1196 -36.923 -3.431 -53.412 1.00 89.37 C ATOM 8913 OD1 ASN A1196 -37.946 -3.304 -52.755 1.00 92.07 O ATOM 8914 ND2 ASN A1196 -36.935 -3.771 -54.680 1.00 89.02 N ATOM 8915 N PRO A1197 -36.952 -0.679 -50.620 1.00 91.56 N ATOM 8916 CA PRO A1197 -37.662 -0.542 -49.342 1.00 87.72 C ATOM 8917 C PRO A1197 -38.857 -1.458 -49.157 1.00 86.66 C ATOM 8918 O PRO A1197 -39.219 -1.716 -48.017 1.00 93.09 O ATOM 8919 CB PRO A1197 -38.125 0.915 -49.334 1.00 84.10 C ATOM 8920 CG PRO A1197 -37.893 1.415 -50.725 1.00 95.99 C ATOM 8921 CD PRO A1197 -36.787 0.606 -51.308 1.00 93.86 C ATOM 8922 N ALA A1198 -39.466 -1.941 -50.234 1.00 86.12 N ATOM 8923 CA ALA A1198 -40.520 -2.944 -50.140 1.00 87.42 C ATOM 8924 C ALA A1198 -39.967 -4.211 -49.503 1.00 87.49 C ATOM 8925 O ALA A1198 -40.515 -4.718 -48.513 1.00101.64 O ATOM 8926 CB ALA A1198 -41.089 -3.243 -51.520 1.00 86.56 C ATOM 8927 N ILE A1199 -38.869 -4.696 -50.080 1.00 82.90 N ATOM 8928 CA ILE A1199 -38.160 -5.888 -49.614 1.00 81.55 C ATOM 8929 C ILE A1199 -37.578 -5.685 -48.209 1.00 87.69 C ATOM 8930 O ILE A1199 -37.687 -6.567 -47.356 1.00 86.51 O ATOM 8931 CB ILE A1199 -37.052 -6.251 -50.653 1.00 75.91 C ATOM 8932 CG1 ILE A1199 -37.713 -6.905 -51.862 1.00 71.78 C ATOM 8933 CG2 ILE A1199 -35.964 -7.166 -50.091 1.00 74.47 C ATOM 8934 CD1 ILE A1199 -36.954 -6.761 -53.151 1.00 74.43 C ATOM 8935 N ASP A1200 -36.978 -4.525 -47.965 1.00 91.80 N ATOM 8936 CA ASP A1200 -36.402 -4.249 -46.654 1.00 96.11 C ATOM 8937 C ASP A1200 -37.466 -4.094 -45.547 1.00 92.69 C ATOM 8938 O ASP A1200 -37.310 -4.660 -44.468 1.00 96.98 O ATOM 8939 CB ASP A1200 -35.441 -3.053 -46.791 1.00107.03 C ATOM 8940 CG ASP A1200 -34.147 -3.434 -47.560 1.00115.16 C ATOM 8941 OD1 ASP A1200 -33.512 -4.428 -47.137 1.00122.68 O ATOM 8942 OD2 ASP A1200 -33.766 -2.779 -48.575 1.00102.29 O ATOM 8943 N ILE A1201 -38.574 -3.408 -45.817 1.00 86.47 N ATOM 8944 CA ILE A1201 -39.705 -3.373 -44.854 1.00 85.34 C ATOM 8945 C ILE A1201 -40.318 -4.761 -44.645 1.00 87.75 C ATOM 8946 O ILE A1201 -40.691 -5.113 -43.528 1.00 88.03 O ATOM 8947 CB ILE A1201 -40.815 -2.370 -45.239 1.00 91.46 C ATOM 8948 CG1 ILE A1201 -40.314 -0.923 -45.160 1.00 90.19 C ATOM 8949 CG2 ILE A1201 -42.022 -2.534 -44.312 1.00 98.76 C ATOM 8950 CD1 ILE A1201 -41.361 0.121 -45.534 1.00 89.75 C ATOM 8951 N GLY A1202 -40.406 -5.562 -45.707 1.00 88.50 N ATOM 8952 CA GLY A1202 -40.822 -6.967 -45.589 1.00 84.33 C ATOM 8953 C GLY A1202 -39.976 -7.771 -44.615 1.00 89.23 C ATOM 8954 O GLY A1202 -40.494 -8.601 -43.868 1.00 86.29 O ATOM 8955 N GLN A1203 -38.668 -7.522 -44.622 1.00 95.98 N ATOM 8956 CA GLN A1203 -37.724 -8.205 -43.732 1.00 92.94 C ATOM 8957 C GLN A1203 -37.848 -7.765 -42.279 1.00 90.17 C ATOM 8958 O GLN A1203 -37.700 -8.579 -41.380 1.00104.20 O ATOM 8959 CB GLN A1203 -36.303 -7.923 -44.197 1.00 96.45 C ATOM 8960 CG GLN A1203 -35.929 -8.623 -45.494 1.00105.15 C ATOM 8961 CD GLN A1203 -35.367 -10.010 -45.250 1.00113.81 C ATOM 8962 OE1 GLN A1203 -36.120 -10.969 -45.023 1.00122.54 O ATOM 8963 NE2 GLN A1203 -34.032 -10.124 -45.284 1.00115.40 N ATOM 8964 N ILE A1204 -38.118 -6.484 -42.057 1.00 89.65 N ATOM 8965 CA ILE A1204 -38.331 -5.953 -40.701 1.00 94.50 C ATOM 8966 C ILE A1204 -39.568 -6.585 -40.038 1.00 94.56 C ATOM 8967 O ILE A1204 -39.477 -7.097 -38.924 1.00 81.06 O ATOM 8968 CB ILE A1204 -38.384 -4.401 -40.625 1.00100.12 C ATOM 8969 CG1 ILE A1204 -37.120 -3.779 -41.235 1.00 98.29 C ATOM 8970 CG2 ILE A1204 -38.482 -3.949 -39.170 1.00 99.36 C ATOM 8971 CD1 ILE A1204 -37.195 -2.290 -41.459 1.00 91.32 C ATOM 8972 N GLU A1205 -40.701 -6.565 -40.739 1.00105.67 N ATOM 8973 CA GLU A1205 -41.968 -7.157 -40.260 1.00 99.63 C ATOM 8974 C GLU A1205 -41.842 -8.638 -39.981 1.00 91.20 C ATOM 8975 O GLU A1205 -42.251 -9.115 -38.919 1.00 98.18 O ATOM 8976 CB GLU A1205 -43.072 -6.984 -41.302 1.00104.58 C ATOM 8977 CG GLU A1205 -43.511 -5.551 -41.551 1.00119.65 C ATOM 8978 CD GLU A1205 -44.493 -5.408 -42.715 1.00138.25 C ATOM 8979 OE1 GLU A1205 -44.796 -6.413 -43.401 1.00151.98 O ATOM 8980 OE2 GLU A1205 -44.969 -4.272 -42.958 1.00145.03 O ATOM 8981 N GLY A1206 -41.303 -9.361 -40.960 1.00 77.86 N ATOM 8982 CA GLY A1206 -41.056 -10.784 -40.839 1.00 79.72 C ATOM 8983 C GLY A1206 -40.177 -11.153 -39.662 1.00 82.68 C ATOM 8984 O GLY A1206 -40.530 -12.016 -38.878 1.00 77.06 O ATOM 8985 N ALA A1207 -39.030 -10.506 -39.544 1.00 87.65 N ATOM 8986 CA ALA A1207 -38.155 -10.717 -38.391 1.00 87.91 C ATOM 8987 C ALA A1207 -38.858 -10.388 -37.060 1.00 81.75 C ATOM 8988 O ALA A1207 -38.743 -11.147 -36.099 1.00 81.12 O ATOM 8989 CB ALA A1207 -36.879 -9.876 -38.567 1.00 80.66 C ATOM 8990 N PHE A1208 -39.600 -9.281 -37.023 1.00 74.06 N ATOM 8991 CA PHE A1208 -40.303 -8.845 -35.817 1.00 79.79 C ATOM 8992 C PHE A1208 -41.292 -9.896 -35.332 1.00 81.83 C ATOM 8993 O PHE A1208 -41.253 -10.276 -34.159 1.00 94.00 O ATOM 8994 CB PHE A1208 -41.039 -7.523 -36.022 1.00 85.54 C ATOM 8995 CG PHE A1208 -41.996 -7.217 -34.903 1.00 96.64 C ATOM 8996 CD1 PHE A1208 -41.523 -6.826 -33.662 1.00 98.02 C ATOM 8997 CD2 PHE A1208 -43.373 -7.397 -35.065 1.00106.10 C ATOM 8998 CE1 PHE A1208 -42.409 -6.582 -32.625 1.00103.99 C ATOM 8999 CE2 PHE A1208 -44.262 -7.163 -34.026 1.00100.02 C ATOM 9000 CZ PHE A1208 -43.779 -6.754 -32.806 1.00100.32 C ATOM 9001 N ILE A1209 -42.159 -10.367 -36.233 1.00 79.60 N ATOM 9002 CA ILE A1209 -43.151 -11.404 -35.905 1.00 85.00 C ATOM 9003 C ILE A1209 -42.481 -12.716 -35.489 1.00 90.41 C ATOM 9004 O ILE A1209 -42.966 -13.416 -34.603 1.00 98.53 O ATOM 9005 CB ILE A1209 -44.064 -11.693 -37.099 1.00 86.64 C ATOM 9006 CG1 ILE A1209 -44.923 -10.468 -37.395 1.00 89.76 C ATOM 9007 CG2 ILE A1209 -44.954 -12.907 -36.829 1.00 88.81 C ATOM 9008 CD1 ILE A1209 -46.080 -10.290 -36.433 1.00100.47 C ATOM 9009 N GLN A1210 -41.349 -13.024 -36.107 1.00 93.52 N ATOM 9010 CA GLN A1210 -40.592 -14.233 -35.775 1.00 93.90 C ATOM 9011 C GLN A1210 -40.032 -14.131 -34.363 1.00 93.42 C ATOM 9012 O GLN A1210 -40.093 -15.083 -33.597 1.00 92.21 O ATOM 9013 CB GLN A1210 -39.483 -14.439 -36.801 1.00 91.70 C ATOM 9014 CG GLN A1210 -39.022 -15.871 -36.956 1.00 95.41 C ATOM 9015 CD GLN A1210 -38.358 -16.096 -38.303 1.00103.19 C ATOM 9016 OE1 GLN A1210 -37.700 -15.196 -38.840 1.00 96.34 O ATOM 9017 NE2 GLN A1210 -38.533 -17.298 -38.863 1.00101.82 N ATOM 9018 N GLY A1211 -39.496 -12.964 -34.027 1.00 92.41 N ATOM 9019 CA GLY A1211 -39.091 -12.666 -32.668 1.00 92.82 C ATOM 9020 C GLY A1211 -40.249 -12.602 -31.697 1.00 87.13 C ATOM 9021 O GLY A1211 -40.146 -13.089 -30.577 1.00 80.67 O ATOM 9022 N MET A1212 -41.356 -12.008 -32.123 1.00 81.39 N ATOM 9023 CA MET A1212 -42.549 -11.971 -31.294 1.00 81.79 C ATOM 9024 C MET A1212 -42.949 -13.392 -30.884 1.00 79.06 C ATOM 9025 O MET A1212 -43.191 -13.643 -29.712 1.00 69.90 O ATOM 9026 CB MET A1212 -43.689 -11.276 -32.028 1.00 89.75 C ATOM 9027 CG MET A1212 -44.890 -10.955 -31.157 1.00 93.72 C ATOM 9028 SD MET A1212 -46.412 -11.059 -32.110 1.00102.49 S ATOM 9029 CE MET A1212 -46.590 -12.847 -32.283 1.00 97.18 C ATOM 9030 N GLY A1213 -42.995 -14.308 -31.849 1.00 82.02 N ATOM 9031 CA GLY A1213 -43.269 -15.727 -31.576 1.00 86.01 C ATOM 9032 C GLY A1213 -42.268 -16.411 -30.647 1.00 90.31 C ATOM 9033 O GLY A1213 -42.671 -17.127 -29.730 1.00 78.82 O ATOM 9034 N LEU A1214 -40.977 -16.194 -30.881 1.00 92.85 N ATOM 9035 CA LEU A1214 -39.898 -16.713 -30.017 1.00 94.61 C ATOM 9036 C LEU A1214 -40.114 -16.367 -28.545 1.00 81.58 C ATOM 9037 O LEU A1214 -39.864 -17.187 -27.670 1.00 73.88 O ATOM 9038 CB LEU A1214 -38.517 -16.181 -30.485 1.00 99.68 C ATOM 9039 CG LEU A1214 -37.293 -16.214 -29.534 1.00100.85 C ATOM 9040 CD1 LEU A1214 -36.780 -17.609 -29.179 1.00 97.13 C ATOM 9041 CD2 LEU A1214 -36.170 -15.393 -30.146 1.00100.48 C ATOM 9042 N TYR A1215 -40.550 -15.136 -28.298 1.00 76.07 N ATOM 9043 CA TYR A1215 -40.667 -14.613 -26.951 1.00 77.63 C ATOM 9044 C TYR A1215 -42.045 -14.814 -26.322 1.00 82.52 C ATOM 9045 O TYR A1215 -42.159 -14.729 -25.105 1.00 72.38 O ATOM 9046 CB TYR A1215 -40.345 -13.135 -26.903 1.00 72.35 C ATOM 9047 CG TYR A1215 -38.969 -12.755 -27.354 1.00 66.91 C ATOM 9048 CD1 TYR A1215 -37.836 -13.187 -26.676 1.00 63.48 C ATOM 9049 CD2 TYR A1215 -38.810 -11.893 -28.427 1.00 69.72 C ATOM 9050 CE1 TYR A1215 -36.572 -12.793 -27.092 1.00 69.21 C ATOM 9051 CE2 TYR A1215 -37.563 -11.494 -28.862 1.00 74.10 C ATOM 9052 CZ TYR A1215 -36.438 -11.937 -28.206 1.00 73.61 C ATOM 9053 OH TYR A1215 -35.214 -11.498 -28.694 1.00 68.48 O ATOM 9054 N THR A1216 -43.084 -15.093 -27.112 1.00 90.04 N ATOM 9055 CA THR A1216 -44.449 -15.289 -26.570 1.00 94.45 C ATOM 9056 C THR A1216 -45.013 -16.712 -26.752 1.00 97.71 C ATOM 9057 O THR A1216 -45.187 -17.442 -25.774 1.00110.97 O ATOM 9058 CB THR A1216 -45.460 -14.338 -27.259 1.00 96.59 C ATOM 9059 OG1 THR A1216 -45.410 -14.502 -28.682 1.00 85.97 O ATOM 9060 CG2 THR A1216 -45.146 -12.927 -26.944 1.00105.50 C ATOM 9061 N ILE A1217 -45.322 -17.098 -27.978 1.00 84.10 N ATOM 9062 CA ILE A1217 -46.126 -18.304 -28.201 1.00 79.91 C ATOM 9063 C ILE A1217 -45.365 -19.568 -28.627 1.00 81.19 C ATOM 9064 O ILE A1217 -45.867 -20.667 -28.384 1.00 79.11 O ATOM 9065 CB ILE A1217 -47.210 -18.052 -29.240 1.00 79.34 C ATOM 9066 CG1 ILE A1217 -46.687 -17.153 -30.348 1.00 87.63 C ATOM 9067 CG2 ILE A1217 -48.391 -17.371 -28.581 1.00 83.51 C ATOM 9068 CD1 ILE A1217 -47.647 -16.981 -31.499 1.00 99.11 C ATOM 9069 N GLU A1218 -44.163 -19.422 -29.172 1.00 88.37 N ATOM 9070 CA GLU A1218 -43.414 -20.581 -29.682 1.00 84.13 C ATOM 9071 C GLU A1218 -42.671 -21.277 -28.541 1.00 83.24 C ATOM 9072 O GLU A1218 -41.862 -20.681 -27.843 1.00 77.10 O ATOM 9073 CB GLU A1218 -42.415 -20.145 -30.727 1.00 84.02 C ATOM 9074 CG GLU A1218 -43.112 -19.616 -31.945 1.00 82.03 C ATOM 9075 CD GLU A1218 -42.182 -19.250 -33.054 1.00 76.78 C ATOM 9076 OE1 GLU A1218 -41.223 -20.009 -33.330 1.00 67.15 O ATOM 9077 OE2 GLU A1218 -42.461 -18.206 -33.670 1.00 79.45 O ATOM 9078 N GLU A1219 -42.955 -22.564 -28.377 1.00 81.49 N ATOM 9079 CA GLU A1219 -42.574 -23.341 -27.188 1.00 81.84 C ATOM 9080 C GLU A1219 -42.375 -24.828 -27.554 1.00 87.73 C ATOM 9081 O GLU A1219 -43.254 -25.447 -28.175 1.00106.94 O ATOM 9082 CB GLU A1219 -43.729 -23.164 -26.195 1.00 83.66 C ATOM 9083 CG GLU A1219 -43.877 -24.222 -25.111 1.00 95.04 C ATOM 9084 CD GLU A1219 -44.629 -23.729 -23.868 1.00 98.77 C ATOM 9085 OE1 GLU A1219 -45.878 -23.651 -23.891 1.00100.44 O ATOM 9086 OE2 GLU A1219 -43.963 -23.428 -22.849 1.00108.67 O ATOM 9087 N LEU A1220 -41.220 -25.387 -27.167 1.00 86.21 N ATOM 9088 CA LEU A1220 -40.872 -26.769 -27.486 1.00 96.24 C ATOM 9089 C LEU A1220 -40.986 -27.623 -26.225 1.00 94.46 C ATOM 9090 O LEU A1220 -40.270 -27.372 -25.250 1.00108.32 O ATOM 9091 CB LEU A1220 -39.419 -26.875 -28.004 1.00106.31 C ATOM 9092 CG LEU A1220 -38.886 -26.237 -29.300 1.00104.34 C ATOM 9093 CD1 LEU A1220 -37.350 -26.333 -29.389 1.00 98.54 C ATOM 9094 CD2 LEU A1220 -39.554 -26.883 -30.506 1.00103.59 C ATOM 9095 N ASN A1221 -41.854 -28.627 -26.253 1.00 87.94 N ATOM 9096 CA ASN A1221 -42.170 -29.388 -25.053 1.00 98.27 C ATOM 9097 C ASN A1221 -41.488 -30.739 -25.073 1.00 97.14 C ATOM 9098 O ASN A1221 -41.873 -31.552 -25.913 1.00105.49 O ATOM 9099 CB ASN A1221 -43.700 -29.632 -24.969 1.00104.42 C ATOM 9100 CG ASN A1221 -44.528 -28.357 -25.089 1.00 96.63 C ATOM 9101 OD1 ASN A1221 -45.556 -28.318 -25.776 1.00 94.01 O ATOM 9102 ND2 ASN A1221 -44.098 -27.320 -24.405 1.00 97.29 N ATOM 9103 N TYR A1222 -40.516 -30.965 -24.171 1.00 83.43 N ATOM 9104 CA TYR A1222 -39.815 -32.230 -24.086 1.00 83.03 C ATOM 9105 C TYR A1222 -40.197 -33.011 -22.827 1.00 85.66 C ATOM 9106 O TYR A1222 -40.420 -32.430 -21.787 1.00 99.24 O ATOM 9107 CB TYR A1222 -38.311 -32.007 -24.117 1.00 77.13 C ATOM 9108 CG TYR A1222 -37.774 -31.523 -25.441 1.00 83.56 C ATOM 9109 CD1 TYR A1222 -37.554 -32.414 -26.496 1.00 84.83 C ATOM 9110 CD2 TYR A1222 -37.452 -30.167 -25.637 1.00 89.14 C ATOM 9111 CE1 TYR A1222 -37.045 -31.968 -27.716 1.00 88.85 C ATOM 9112 CE2 TYR A1222 -36.944 -29.709 -26.851 1.00 87.70 C ATOM 9113 CZ TYR A1222 -36.743 -30.611 -27.889 1.00 92.80 C ATOM 9114 OH TYR A1222 -36.245 -30.161 -29.102 1.00 97.77 O ATOM 9115 N SER A1223 -40.265 -34.331 -22.940 1.00 82.68 N ATOM 9116 CA SER A1223 -40.541 -35.196 -21.794 1.00 86.04 C ATOM 9117 C SER A1223 -39.278 -35.359 -20.941 1.00 93.95 C ATOM 9118 O SER A1223 -38.180 -35.130 -21.446 1.00 99.16 O ATOM 9119 CB SER A1223 -40.990 -36.562 -22.299 1.00 93.89 C ATOM 9120 OG SER A1223 -39.957 -37.207 -23.033 1.00 93.65 O ATOM 9121 N PRO A1224 -39.418 -35.772 -19.667 1.00100.93 N ATOM 9122 CA PRO A1224 -38.287 -36.188 -18.820 1.00 97.76 C ATOM 9123 C PRO A1224 -37.380 -37.274 -19.421 1.00 99.87 C ATOM 9124 O PRO A1224 -36.258 -37.442 -18.970 1.00 86.01 O ATOM 9125 CB PRO A1224 -38.975 -36.740 -17.583 1.00114.58 C ATOM 9126 CG PRO A1224 -40.303 -36.076 -17.554 1.00115.62 C ATOM 9127 CD PRO A1224 -40.706 -35.948 -18.980 1.00112.10 C ATOM 9128 N GLN A1225 -37.894 -38.037 -20.385 1.00103.22 N ATOM 9129 CA GLN A1225 -37.143 -38.960 -21.231 1.00110.46 C ATOM 9130 C GLN A1225 -36.496 -38.327 -22.499 1.00104.11 C ATOM 9131 O GLN A1225 -35.808 -39.020 -23.244 1.00107.55 O ATOM 9132 CB GLN A1225 -38.127 -40.030 -21.753 1.00118.48 C ATOM 9133 CG GLN A1225 -38.472 -41.088 -20.751 1.00121.32 C ATOM 9134 CD GLN A1225 -37.202 -41.718 -20.263 1.00128.13 C ATOM 9135 OE1 GLN A1225 -36.635 -42.574 -20.940 1.00119.89 O ATOM 9136 NE2 GLN A1225 -36.698 -41.245 -19.119 1.00133.59 N ATOM 9137 N GLY A1226 -36.729 -37.037 -22.738 1.00 95.97 N ATOM 9138 CA GLY A1226 -36.159 -36.326 -23.878 1.00 91.06 C ATOM 9139 C GLY A1226 -36.921 -36.451 -25.189 1.00 96.75 C ATOM 9140 O GLY A1226 -36.393 -36.088 -26.241 1.00113.18 O ATOM 9141 N ILE A1227 -38.161 -36.936 -25.135 1.00105.42 N ATOM 9142 CA ILE A1227 -38.987 -37.090 -26.336 1.00107.65 C ATOM 9143 C ILE A1227 -39.650 -35.745 -26.569 1.00100.83 C ATOM 9144 O ILE A1227 -40.146 -35.145 -25.636 1.00113.09 O ATOM 9145 CB ILE A1227 -40.096 -38.161 -26.182 1.00 98.44 C ATOM 9146 CG1 ILE A1227 -39.471 -39.544 -26.122 1.00 98.21 C ATOM 9147 CG2 ILE A1227 -41.080 -38.111 -27.355 1.00 91.55 C ATOM 9148 CD1 ILE A1227 -38.381 -39.710 -25.085 1.00101.52 C ATOM 9149 N LEU A1228 -39.658 -35.280 -27.811 1.00 90.76 N ATOM 9150 CA LEU A1228 -40.378 -34.059 -28.169 1.00 96.20 C ATOM 9151 C LEU A1228 -41.870 -34.363 -28.274 1.00101.54 C ATOM 9152 O LEU A1228 -42.258 -35.382 -28.856 1.00117.14 O ATOM 9153 CB LEU A1228 -39.869 -33.489 -29.492 1.00 93.05 C ATOM 9154 CG LEU A1228 -40.503 -32.170 -29.934 1.00 88.27 C ATOM 9155 CD1 LEU A1228 -39.987 -31.025 -29.080 1.00 88.40 C ATOM 9156 CD2 LEU A1228 -40.262 -31.898 -31.415 1.00 88.08 C ATOM 9157 N HIS A1229 -42.696 -33.481 -27.711 1.00101.93 N ATOM 9158 CA HIS A1229 -44.148 -33.636 -27.759 1.00105.79 C ATOM 9159 C HIS A1229 -44.721 -32.741 -28.838 1.00101.67 C ATOM 9160 O HIS A1229 -44.365 -31.558 -28.939 1.00 89.35 O ATOM 9161 CB HIS A1229 -44.756 -33.326 -26.393 1.00115.01 C ATOM 9162 CG HIS A1229 -44.571 -34.423 -25.394 1.00113.06 C ATOM 9163 ND1 HIS A1229 -44.349 -34.183 -24.055 1.00111.05 N ATOM 9164 CD2 HIS A1229 -44.569 -35.769 -25.544 1.00112.84 C ATOM 9165 CE1 HIS A1229 -44.229 -35.337 -23.423 1.00118.52 C ATOM 9166 NE2 HIS A1229 -44.357 -36.314 -24.304 1.00118.52 N ATOM 9167 N THR A1230 -45.610 -33.321 -29.636 1.00103.88 N ATOM 9168 CA THR A1230 -45.930 -32.789 -30.949 1.00118.54 C ATOM 9169 C THR A1230 -47.425 -32.998 -31.293 1.00114.18 C ATOM 9170 O THR A1230 -47.831 -32.883 -32.451 1.00129.54 O ATOM 9171 CB THR A1230 -44.871 -33.381 -31.958 1.00132.53 C ATOM 9172 OG1 THR A1230 -44.474 -32.397 -32.942 1.00130.07 O ATOM 9173 CG2 THR A1230 -45.318 -34.743 -32.601 1.00128.40 C ATOM 9174 N ARG A1231 -48.255 -33.226 -30.267 1.00105.46 N ATOM 9175 CA ARG A1231 -49.624 -33.681 -30.453 1.00111.16 C ATOM 9176 C ARG A1231 -50.531 -33.099 -29.367 1.00106.14 C ATOM 9177 O ARG A1231 -50.130 -32.956 -28.207 1.00114.08 O ATOM 9178 CB ARG A1231 -49.663 -35.214 -30.434 1.00121.31 C ATOM 9179 CG ARG A1231 -50.352 -35.865 -31.635 1.00134.29 C ATOM 9180 CD ARG A1231 -50.317 -37.396 -31.540 1.00142.22 C ATOM 9181 NE ARG A1231 -49.090 -38.019 -32.069 1.00147.04 N ATOM 9182 CZ ARG A1231 -48.735 -39.301 -31.892 1.00145.02 C ATOM 9183 NH1 ARG A1231 -49.491 -40.142 -31.186 1.00149.16 N ATOM 9184 NH2 ARG A1231 -47.605 -39.758 -32.424 1.00132.27 N ATOM 9185 N GLY A1232 -51.757 -32.746 -29.758 1.00107.47 N ATOM 9186 CA GLY A1232 -52.714 -32.098 -28.848 1.00102.64 C ATOM 9187 C GLY A1232 -52.317 -30.649 -28.586 1.00100.08 C ATOM 9188 O GLY A1232 -51.885 -29.954 -29.496 1.00110.36 O ATOM 9189 N PRO A1233 -52.481 -30.166 -27.350 1.00104.00 N ATOM 9190 CA PRO A1233 -51.953 -28.848 -26.971 1.00112.49 C ATOM 9191 C PRO A1233 -50.415 -28.714 -26.929 1.00117.83 C ATOM 9192 O PRO A1233 -49.921 -27.580 -26.845 1.00125.11 O ATOM 9193 CB PRO A1233 -52.533 -28.616 -25.572 1.00115.28 C ATOM 9194 CG PRO A1233 -53.589 -29.655 -25.368 1.00118.85 C ATOM 9195 CD PRO A1233 -53.706 -30.489 -26.607 1.00111.70 C ATOM 9196 N ASP A1234 -49.673 -29.831 -26.977 1.00113.06 N ATOM 9197 CA ASP A1234 -48.212 -29.784 -27.108 1.00104.35 C ATOM 9198 C ASP A1234 -47.750 -29.322 -28.523 1.00101.39 C ATOM 9199 O ASP A1234 -46.563 -29.027 -28.719 1.00101.25 O ATOM 9200 CB ASP A1234 -47.581 -31.164 -26.822 1.00100.59 C ATOM 9201 CG ASP A1234 -47.826 -31.666 -25.405 1.00104.75 C ATOM 9202 OD1 ASP A1234 -47.623 -30.883 -24.455 1.00125.65 O ATOM 9203 OD2 ASP A1234 -48.177 -32.862 -25.236 1.00 97.09 O ATOM 9204 N GLN A1235 -48.670 -29.292 -29.498 1.00 86.98 N ATOM 9205 CA GLN A1235 -48.382 -28.750 -30.820 1.00 90.72 C ATOM 9206 C GLN A1235 -47.671 -27.411 -30.799 1.00 86.88 C ATOM 9207 O GLN A1235 -48.031 -26.531 -30.033 1.00100.47 O ATOM 9208 CB GLN A1235 -49.679 -28.500 -31.558 1.00106.19 C ATOM 9209 CG GLN A1235 -50.360 -29.704 -32.171 1.00107.97 C ATOM 9210 CD GLN A1235 -51.705 -29.305 -32.754 1.00120.00 C ATOM 9211 OE1 GLN A1235 -52.282 -28.263 -32.390 1.00118.93 O ATOM 9212 NE2 GLN A1235 -52.210 -30.118 -33.669 1.00133.17 N ATOM 9213 N TYR A1236 -46.680 -27.265 -31.675 1.00 86.06 N ATOM 9214 CA TYR A1236 -45.888 -26.057 -31.806 1.00 85.70 C ATOM 9215 C TYR A1236 -46.654 -25.092 -32.695 1.00 90.91 C ATOM 9216 O TYR A1236 -47.123 -25.453 -33.774 1.00107.08 O ATOM 9217 CB TYR A1236 -44.524 -26.405 -32.395 1.00 84.58 C ATOM 9218 CG TYR A1236 -43.548 -25.248 -32.490 1.00 86.60 C ATOM 9219 CD1 TYR A1236 -43.651 -24.290 -33.514 1.00 84.59 C ATOM 9220 CD2 TYR A1236 -42.507 -25.116 -31.573 1.00 81.18 C ATOM 9221 CE1 TYR A1236 -42.752 -23.244 -33.601 1.00 80.08 C ATOM 9222 CE2 TYR A1236 -41.603 -24.075 -31.668 1.00 78.59 C ATOM 9223 CZ TYR A1236 -41.735 -23.147 -32.676 1.00 76.60 C ATOM 9224 OH TYR A1236 -40.843 -22.120 -32.764 1.00 76.56 O ATOM 9225 N LYS A1237 -46.760 -23.849 -32.229 1.00 93.14 N ATOM 9226 CA LYS A1237 -47.523 -22.823 -32.905 1.00 95.42 C ATOM 9227 C LYS A1237 -46.633 -21.644 -33.231 1.00 90.31 C ATOM 9228 O LYS A1237 -46.051 -21.027 -32.340 1.00 95.65 O ATOM 9229 CB LYS A1237 -48.699 -22.391 -32.044 1.00100.80 C ATOM 9230 CG LYS A1237 -49.606 -23.544 -31.638 1.00105.11 C ATOM 9231 CD LYS A1237 -50.483 -24.011 -32.793 1.00107.92 C ATOM 9232 CE LYS A1237 -51.359 -25.181 -32.376 1.00107.37 C ATOM 9233 NZ LYS A1237 -52.179 -25.678 -33.506 1.00109.10 N ATOM 9234 N ILE A1238 -46.503 -21.361 -34.517 1.00 85.70 N ATOM 9235 CA ILE A1238 -45.878 -20.103 -34.981 1.00 87.68 C ATOM 9236 C ILE A1238 -46.945 -19.014 -35.035 1.00 80.55 C ATOM 9237 O ILE A1238 -48.119 -19.335 -35.033 1.00 82.40 O ATOM 9238 CB ILE A1238 -45.208 -20.251 -36.370 1.00 96.70 C ATOM 9239 CG1 ILE A1238 -46.240 -20.487 -37.480 1.00 98.62 C ATOM 9240 CG2 ILE A1238 -44.176 -21.368 -36.346 1.00100.64 C ATOM 9241 CD1 ILE A1238 -45.635 -20.467 -38.867 1.00103.14 C ATOM 9242 N PRO A1239 -46.549 -17.734 -35.078 1.00 83.22 N ATOM 9243 CA PRO A1239 -47.559 -16.655 -35.104 1.00 87.04 C ATOM 9244 C PRO A1239 -48.499 -16.731 -36.326 1.00 95.01 C ATOM 9245 O PRO A1239 -48.046 -16.971 -37.463 1.00108.26 O ATOM 9246 CB PRO A1239 -46.724 -15.350 -35.151 1.00 84.88 C ATOM 9247 CG PRO A1239 -45.303 -15.775 -35.086 1.00 95.23 C ATOM 9248 CD PRO A1239 -45.242 -17.217 -35.509 1.00 92.41 C ATOM 9249 N ALA A1240 -49.794 -16.557 -36.074 1.00 91.90 N ATOM 9250 CA ALA A1240 -50.808 -16.496 -37.119 1.00 94.39 C ATOM 9251 C ALA A1240 -51.308 -15.048 -37.302 1.00 96.69 C ATOM 9252 O ALA A1240 -50.772 -14.141 -36.668 1.00 96.46 O ATOM 9253 CB ALA A1240 -51.943 -17.419 -36.727 1.00101.25 C ATOM 9254 N ILE A1241 -52.306 -14.833 -38.161 1.00 96.24 N ATOM 9255 CA ILE A1241 -52.885 -13.498 -38.373 1.00 91.20 C ATOM 9256 C ILE A1241 -53.452 -12.900 -37.081 1.00 98.31 C ATOM 9257 O ILE A1241 -53.308 -11.702 -36.822 1.00119.82 O ATOM 9258 CB ILE A1241 -54.014 -13.526 -39.430 1.00 91.47 C ATOM 9259 CG1 ILE A1241 -53.495 -14.119 -40.742 1.00102.70 C ATOM 9260 CG2 ILE A1241 -54.576 -12.131 -39.669 1.00 89.43 C ATOM 9261 CD1 ILE A1241 -54.104 -13.549 -42.019 1.00105.57 C ATOM 9262 N CYS A1242 -54.079 -13.750 -36.269 1.00 99.35 N ATOM 9263 CA CYS A1242 -54.693 -13.321 -35.006 1.00106.28 C ATOM 9264 C CYS A1242 -53.697 -12.828 -33.956 1.00109.05 C ATOM 9265 O CYS A1242 -54.117 -12.206 -32.990 1.00128.63 O ATOM 9266 CB CYS A1242 -55.531 -14.448 -34.408 1.00112.58 C ATOM 9267 SG CYS A1242 -54.739 -16.072 -34.427 1.00108.01 S ATOM 9268 N ASP A1243 -52.408 -13.119 -34.135 1.00105.61 N ATOM 9269 CA ASP A1243 -51.336 -12.664 -33.244 1.00105.58 C ATOM 9270 C ASP A1243 -50.646 -11.362 -33.700 1.00105.68 C ATOM 9271 O ASP A1243 -49.826 -10.797 -32.971 1.00113.70 O ATOM 9272 CB ASP A1243 -50.298 -13.781 -33.070 1.00107.78 C ATOM 9273 CG ASP A1243 -50.934 -15.143 -32.797 1.00112.42 C ATOM 9274 OD1 ASP A1243 -52.020 -15.195 -32.178 1.00116.27 O ATOM 9275 OD2 ASP A1243 -50.353 -16.169 -33.217 1.00120.63 O ATOM 9276 N MET A1244 -50.997 -10.878 -34.888 1.00 99.57 N ATOM 9277 CA MET A1244 -50.309 -9.755 -35.502 1.00 93.43 C ATOM 9278 C MET A1244 -50.917 -8.455 -34.910 1.00 99.47 C ATOM 9279 O MET A1244 -52.149 -8.310 -34.856 1.00118.70 O ATOM 9280 CB MET A1244 -50.506 -9.861 -37.002 1.00 96.70 C ATOM 9281 CG MET A1244 -49.635 -8.967 -37.861 1.00113.99 C ATOM 9282 SD MET A1244 -50.442 -7.566 -38.707 1.00138.50 S ATOM 9283 CE MET A1244 -51.699 -8.388 -39.688 1.00129.55 C ATOM 9284 N PRO A1245 -50.067 -7.518 -34.448 1.00 90.62 N ATOM 9285 CA PRO A1245 -50.610 -6.424 -33.642 1.00 89.50 C ATOM 9286 C PRO A1245 -51.638 -5.554 -34.399 1.00 95.63 C ATOM 9287 O PRO A1245 -51.401 -5.188 -35.565 1.00 99.79 O ATOM 9288 CB PRO A1245 -49.363 -5.621 -33.279 1.00 89.40 C ATOM 9289 CG PRO A1245 -48.414 -5.891 -34.409 1.00 88.20 C ATOM 9290 CD PRO A1245 -48.637 -7.332 -34.739 1.00 88.72 C ATOM 9291 N THR A1246 -52.754 -5.248 -33.735 1.00 89.55 N ATOM 9292 CA THR A1246 -53.865 -4.501 -34.321 1.00 92.69 C ATOM 9293 C THR A1246 -53.384 -3.287 -35.109 1.00 97.04 C ATOM 9294 O THR A1246 -53.822 -3.055 -36.223 1.00 94.94 O ATOM 9295 CB THR A1246 -54.825 -4.076 -33.206 1.00 98.91 C ATOM 9296 OG1 THR A1246 -55.245 -5.255 -32.506 1.00 94.33 O ATOM 9297 CG2 THR A1246 -56.043 -3.297 -33.765 1.00104.13 C ATOM 9298 N GLU A1247 -52.470 -2.525 -34.522 1.00105.54 N ATOM 9299 CA GLU A1247 -51.845 -1.385 -35.190 1.00108.53 C ATOM 9300 C GLU A1247 -50.356 -1.659 -35.387 1.00102.40 C ATOM 9301 O GLU A1247 -49.724 -2.313 -34.569 1.00111.29 O ATOM 9302 CB GLU A1247 -52.059 -0.113 -34.382 1.00116.17 C ATOM 9303 CG GLU A1247 -53.279 0.696 -34.804 1.00120.24 C ATOM 9304 CD GLU A1247 -52.970 2.184 -34.893 1.00126.61 C ATOM 9305 OE1 GLU A1247 -52.928 2.866 -33.832 1.00123.65 O ATOM 9306 OE2 GLU A1247 -52.745 2.667 -36.031 1.00123.52 O ATOM 9307 N LEU A1248 -49.799 -1.158 -36.476 1.00 88.54 N ATOM 9308 CA LEU A1248 -48.408 -1.409 -36.789 1.00 95.43 C ATOM 9309 C LEU A1248 -47.826 -0.254 -37.610 1.00 91.04 C ATOM 9310 O LEU A1248 -48.203 -0.064 -38.755 1.00 90.17 O ATOM 9311 CB LEU A1248 -48.263 -2.751 -37.510 1.00109.01 C ATOM 9312 CG LEU A1248 -46.851 -3.168 -37.951 1.00122.15 C ATOM 9313 CD1 LEU A1248 -45.859 -3.094 -36.800 1.00129.04 C ATOM 9314 CD2 LEU A1248 -46.877 -4.576 -38.528 1.00129.89 C ATOM 9315 N HIS A1249 -46.903 0.499 -37.016 1.00 91.62 N ATOM 9316 CA HIS A1249 -46.286 1.633 -37.689 1.00 97.08 C ATOM 9317 C HIS A1249 -44.797 1.383 -37.880 1.00 97.64 C ATOM 9318 O HIS A1249 -44.129 0.937 -36.946 1.00 77.91 O ATOM 9319 CB HIS A1249 -46.550 2.888 -36.899 1.00108.43 C ATOM 9320 CG HIS A1249 -47.996 3.102 -36.596 1.00114.34 C ATOM 9321 ND1 HIS A1249 -48.790 3.958 -37.324 1.00120.10 N ATOM 9322 CD2 HIS A1249 -48.791 2.572 -35.639 1.00115.11 C ATOM 9323 CE1 HIS A1249 -50.010 3.959 -36.817 1.00118.40 C ATOM 9324 NE2 HIS A1249 -50.037 3.126 -35.795 1.00109.38 N ATOM 9325 N ILE A1250 -44.292 1.669 -39.080 1.00104.44 N ATOM 9326 CA ILE A1250 -42.879 1.440 -39.403 1.00101.22 C ATOM 9327 C ILE A1250 -42.268 2.616 -40.147 1.00100.12 C ATOM 9328 O ILE A1250 -42.692 2.934 -41.249 1.00 95.94 O ATOM 9329 CB ILE A1250 -42.690 0.109 -40.142 1.00 97.68 C ATOM 9330 CG1 ILE A1250 -42.502 -1.003 -39.104 1.00 93.98 C ATOM 9331 CG2 ILE A1250 -41.482 0.176 -41.063 1.00102.72 C ATOM 9332 CD1 ILE A1250 -42.749 -2.393 -39.624 1.00 93.79 C ATOM 9333 N ALA A1251 -41.242 3.206 -39.535 1.00103.84 N ATOM 9334 CA ALA A1251 -40.514 4.332 -40.107 1.00107.04 C ATOM 9335 C ALA A1251 -39.088 3.927 -40.455 1.00108.53 C ATOM 9336 O ALA A1251 -38.434 3.201 -39.689 1.00107.38 O ATOM 9337 CB ALA A1251 -40.508 5.502 -39.150 1.00117.45 C ATOM 9338 N LEU A1252 -38.622 4.386 -41.617 1.00103.46 N ATOM 9339 CA LEU A1252 -37.202 4.296 -41.994 1.00105.56 C ATOM 9340 C LEU A1252 -36.562 5.666 -41.832 1.00103.11 C ATOM 9341 O LEU A1252 -36.830 6.579 -42.604 1.00111.86 O ATOM 9342 CB LEU A1252 -37.032 3.773 -43.418 1.00114.71 C ATOM 9343 CG LEU A1252 -37.575 2.358 -43.681 1.00115.39 C ATOM 9344 CD1 LEU A1252 -37.204 1.923 -45.087 1.00119.67 C ATOM 9345 CD2 LEU A1252 -37.092 1.329 -42.669 1.00108.44 C ATOM 9346 N LEU A1253 -35.686 5.786 -40.825 1.00108.52 N ATOM 9347 CA LEU A1253 -34.952 7.022 -40.538 1.00109.78 C ATOM 9348 C LEU A1253 -34.248 7.495 -41.842 1.00113.14 C ATOM 9349 O LEU A1253 -33.716 6.662 -42.603 1.00114.13 O ATOM 9350 CB LEU A1253 -33.981 6.702 -39.412 1.00119.05 C ATOM 9351 CG LEU A1253 -32.962 7.704 -38.895 1.00133.57 C ATOM 9352 CD1 LEU A1253 -32.669 7.415 -37.420 1.00130.15 C ATOM 9353 CD2 LEU A1253 -31.686 7.662 -39.735 1.00138.87 C ATOM 9354 N PRO A1254 -34.294 8.814 -42.141 1.00110.38 N ATOM 9355 CA PRO A1254 -33.642 9.271 -43.375 1.00113.74 C ATOM 9356 C PRO A1254 -32.108 9.007 -43.421 1.00120.98 C ATOM 9357 O PRO A1254 -31.408 9.167 -42.424 1.00112.85 O ATOM 9358 CB PRO A1254 -34.005 10.737 -43.409 1.00115.16 C ATOM 9359 CG PRO A1254 -35.408 10.715 -42.886 1.00110.21 C ATOM 9360 CD PRO A1254 -35.402 9.704 -41.772 1.00106.56 C ATOM 9361 N PRO A1255 -31.590 8.639 -44.601 1.00126.25 N ATOM 9362 CA PRO A1255 -30.230 8.129 -44.840 1.00130.46 C ATOM 9363 C PRO A1255 -29.085 9.047 -44.445 1.00140.51 C ATOM 9364 O PRO A1255 -29.329 10.228 -44.273 1.00158.45 O ATOM 9365 CB PRO A1255 -30.188 8.001 -46.370 1.00131.19 C ATOM 9366 CG PRO A1255 -31.175 9.010 -46.884 1.00117.51 C ATOM 9367 CD PRO A1255 -32.264 9.041 -45.859 1.00116.21 C ATOM 9368 N SER A1256 -27.854 8.525 -44.352 1.00153.39 N ATOM 9369 CA SER A1256 -26.654 9.387 -44.140 1.00167.59 C ATOM 9370 C SER A1256 -25.275 8.793 -44.549 1.00176.68 C ATOM 9371 O SER A1256 -24.267 9.002 -43.861 1.00199.42 O ATOM 9372 CB SER A1256 -26.636 9.978 -42.701 1.00156.76 C ATOM 9373 OG SER A1256 -27.369 9.191 -41.774 1.00153.02 O ATOM 9374 N GLN A1257 -25.232 8.080 -45.680 1.00160.43 N ATOM 9375 CA GLN A1257 -23.971 7.746 -46.402 1.00150.85 C ATOM 9376 C GLN A1257 -22.981 6.790 -45.709 1.00149.66 C ATOM 9377 O GLN A1257 -22.420 7.100 -44.654 1.00139.94 O ATOM 9378 CB GLN A1257 -23.202 9.012 -46.843 1.00142.95 C ATOM 9379 CG GLN A1257 -24.000 10.017 -47.668 1.00141.67 C ATOM 9380 CD GLN A1257 -24.969 9.367 -48.649 1.00131.91 C ATOM 9381 OE1 GLN A1257 -24.678 9.245 -49.840 1.00120.96 O ATOM 9382 NE2 GLN A1257 -26.129 8.945 -48.148 1.00118.25 N ATOM 9383 N ASN A1258 -22.718 5.661 -46.383 1.00152.62 N ATOM 9384 CA ASN A1258 -21.808 4.613 -45.933 1.00147.16 C ATOM 9385 C ASN A1258 -20.986 4.185 -47.157 1.00154.69 C ATOM 9386 O ASN A1258 -21.284 3.154 -47.767 1.00154.78 O ATOM 9387 CB ASN A1258 -22.585 3.380 -45.391 1.00146.91 C ATOM 9388 CG ASN A1258 -23.510 3.691 -44.202 1.00147.73 C ATOM 9389 OD1 ASN A1258 -23.174 3.395 -43.057 1.00148.66 O ATOM 9390 ND2 ASN A1258 -24.701 4.227 -44.481 1.00143.40 N ATOM 9391 N SER A1259 -19.991 4.999 -47.529 1.00164.57 N ATOM 9392 CA SER A1259 -19.144 4.775 -48.706 1.00166.80 C ATOM 9393 C SER A1259 -18.582 3.331 -48.806 1.00171.92 C ATOM 9394 O SER A1259 -18.410 2.784 -49.909 1.00184.92 O ATOM 9395 CB SER A1259 -17.993 5.792 -48.693 1.00157.90 C ATOM 9396 OG SER A1259 -16.873 5.317 -49.415 1.00160.38 O ATOM 9397 N ASN A1260 -18.298 2.751 -47.639 1.00151.56 N ATOM 9398 CA ASN A1260 -17.913 1.342 -47.500 1.00134.03 C ATOM 9399 C ASN A1260 -18.912 0.229 -47.965 1.00135.47 C ATOM 9400 O ASN A1260 -18.466 -0.820 -48.442 1.00139.07 O ATOM 9401 CB ASN A1260 -17.453 1.093 -46.065 1.00128.87 C ATOM 9402 CG ASN A1260 -18.530 1.418 -45.055 1.00137.57 C ATOM 9403 OD1 ASN A1260 -19.455 2.182 -45.349 1.00134.60 O ATOM 9404 ND2 ASN A1260 -18.428 0.837 -43.863 1.00136.43 N ATOM 9405 N THR A1261 -20.225 0.429 -47.817 1.00124.26 N ATOM 9406 CA THR A1261 -21.223 -0.590 -48.201 1.00118.98 C ATOM 9407 C THR A1261 -21.849 -0.314 -49.574 1.00114.07 C ATOM 9408 O THR A1261 -21.711 0.780 -50.131 1.00112.66 O ATOM 9409 CB THR A1261 -22.398 -0.655 -47.205 1.00123.90 C ATOM 9410 OG1 THR A1261 -23.100 0.591 -47.213 1.00125.03 O ATOM 9411 CG2 THR A1261 -21.920 -0.953 -45.801 1.00127.78 C ATOM 9412 N LEU A1262 -22.553 -1.319 -50.093 1.00111.58 N ATOM 9413 CA LEU A1262 -23.182 -1.253 -51.415 1.00113.57 C ATOM 9414 C LEU A1262 -24.291 -0.226 -51.512 1.00111.36 C ATOM 9415 O LEU A1262 -25.371 -0.424 -50.942 1.00100.64 O ATOM 9416 CB LEU A1262 -23.786 -2.610 -51.751 1.00119.01 C ATOM 9417 CG LEU A1262 -24.586 -2.690 -53.048 1.00114.40 C ATOM 9418 CD1 LEU A1262 -23.764 -2.188 -54.237 1.00110.01 C ATOM 9419 CD2 LEU A1262 -25.046 -4.130 -53.228 1.00110.68 C ATOM 9420 N TYR A1263 -24.032 0.851 -52.253 1.00112.26 N ATOM 9421 CA TYR A1263 -24.952 1.998 -52.375 1.00102.80 C ATOM 9422 C TYR A1263 -25.430 2.539 -51.025 1.00100.19 C ATOM 9423 O TYR A1263 -26.585 2.930 -50.890 1.00 85.00 O ATOM 9424 CB TYR A1263 -26.173 1.700 -53.253 1.00 99.73 C ATOM 9425 CG TYR A1263 -25.826 1.256 -54.649 1.00101.98 C ATOM 9426 CD1 TYR A1263 -24.721 1.788 -55.322 1.00 93.15 C ATOM 9427 CD2 TYR A1263 -26.611 0.301 -55.309 1.00101.47 C ATOM 9428 CE1 TYR A1263 -24.406 1.376 -56.602 1.00 93.96 C ATOM 9429 CE2 TYR A1263 -26.294 -0.117 -56.591 1.00 95.71 C ATOM 9430 CZ TYR A1263 -25.192 0.422 -57.223 1.00 92.21 C ATOM 9431 OH TYR A1263 -24.874 0.006 -58.479 1.00 87.04 O ATOM 9432 N SER A1264 -24.537 2.549 -50.027 1.00113.09 N ATOM 9433 CA SER A1264 -24.858 3.036 -48.674 1.00114.36 C ATOM 9434 C SER A1264 -26.017 2.313 -47.979 1.00118.98 C ATOM 9435 O SER A1264 -26.650 2.884 -47.083 1.00117.55 O ATOM 9436 CB SER A1264 -25.149 4.539 -48.771 1.00118.51 C ATOM 9437 OG SER A1264 -24.313 5.163 -49.752 1.00116.55 O ATOM 9438 N SER A1265 -26.313 1.078 -48.386 1.00111.86 N ATOM 9439 CA SER A1265 -27.398 0.314 -47.779 1.00105.50 C ATOM 9440 C SER A1265 -26.872 -0.421 -46.570 1.00109.94 C ATOM 9441 O SER A1265 -25.684 -0.703 -46.484 1.00102.88 O ATOM 9442 CB SER A1265 -27.922 -0.724 -48.759 1.00101.76 C ATOM 9443 OG SER A1265 -27.038 -1.838 -48.842 1.00108.71 O ATOM 9444 N LYS A1266 -27.760 -0.724 -45.631 1.00109.59 N ATOM 9445 CA LYS A1266 -27.402 -1.569 -44.498 1.00103.92 C ATOM 9446 C LYS A1266 -28.212 -2.855 -44.568 1.00 89.06 C ATOM 9447 O LYS A1266 -29.446 -2.827 -44.741 1.00 80.53 O ATOM 9448 CB LYS A1266 -27.553 -0.824 -43.168 1.00119.21 C ATOM 9449 CG LYS A1266 -26.567 0.332 -42.969 1.00123.48 C ATOM 9450 CD LYS A1266 -26.658 0.893 -41.554 1.00130.09 C ATOM 9451 CE LYS A1266 -25.924 2.217 -41.415 1.00135.79 C ATOM 9452 NZ LYS A1266 -26.160 2.836 -40.079 1.00134.06 N ATOM 9453 N GLY A1267 -27.482 -3.957 -44.530 1.00 96.04 N ATOM 9454 CA GLY A1267 -28.058 -5.293 -44.487 1.00101.40 C ATOM 9455 C GLY A1267 -28.830 -5.566 -43.195 1.00100.75 C ATOM 9456 O GLY A1267 -28.254 -5.945 -42.167 1.00 79.76 O ATOM 9457 N LEU A1268 -30.129 -5.350 -43.283 1.00107.08 N ATOM 9458 CA LEU A1268 -31.088 -5.865 -42.313 1.00105.73 C ATOM 9459 C LEU A1268 -31.508 -7.242 -42.794 1.00111.45 C ATOM 9460 O LEU A1268 -31.060 -7.681 -43.856 1.00123.16 O ATOM 9461 CB LEU A1268 -32.306 -4.960 -42.238 1.00103.33 C ATOM 9462 CG LEU A1268 -32.753 -4.312 -43.552 1.00106.15 C ATOM 9463 CD1 LEU A1268 -34.266 -4.222 -43.612 1.00115.07 C ATOM 9464 CD2 LEU A1268 -32.135 -2.927 -43.717 1.00104.69 C ATOM 9465 N GLY A1269 -32.359 -7.911 -42.041 1.00112.16 N ATOM 9466 CA GLY A1269 -32.812 -9.240 -42.457 1.00118.34 C ATOM 9467 C GLY A1269 -32.957 -10.077 -41.219 1.00123.72 C ATOM 9468 O GLY A1269 -34.059 -10.571 -40.913 1.00118.40 O ATOM 9469 N GLU A1270 -31.849 -10.209 -40.495 1.00119.39 N ATOM 9470 CA GLU A1270 -31.918 -10.858 -39.173 1.00121.96 C ATOM 9471 C GLU A1270 -32.228 -9.934 -38.015 1.00117.31 C ATOM 9472 O GLU A1270 -32.663 -10.430 -36.948 1.00101.67 O ATOM 9473 CB GLU A1270 -30.721 -11.768 -38.872 1.00121.83 C ATOM 9474 CG GLU A1270 -29.434 -11.443 -39.598 1.00121.97 C ATOM 9475 CD GLU A1270 -28.327 -12.379 -39.196 1.00118.58 C ATOM 9476 OE1 GLU A1270 -27.213 -12.262 -39.753 1.00120.07 O ATOM 9477 OE2 GLU A1270 -28.588 -13.226 -38.317 1.00110.47 O ATOM 9478 N LEU A1271 -32.078 -8.607 -38.225 1.00122.12 N ATOM 9479 CA LEU A1271 -32.126 -7.629 -37.068 1.00122.36 C ATOM 9480 C LEU A1271 -33.435 -7.762 -36.308 1.00115.73 C ATOM 9481 O LEU A1271 -33.486 -8.043 -35.085 1.00107.78 O ATOM 9482 CB LEU A1271 -32.099 -6.151 -37.440 1.00121.81 C ATOM 9483 CG LEU A1271 -31.883 -5.612 -38.830 1.00136.42 C ATOM 9484 CD1 LEU A1271 -32.587 -4.265 -38.889 1.00138.49 C ATOM 9485 CD2 LEU A1271 -30.388 -5.491 -39.064 1.00141.06 C ATOM 9486 N GLY A1272 -34.497 -7.502 -37.069 1.00110.30 N ATOM 9487 CA GLY A1272 -35.822 -7.314 -36.514 1.00104.28 C ATOM 9488 C GLY A1272 -36.240 -8.306 -35.462 1.00 92.29 C ATOM 9489 O GLY A1272 -37.217 -8.054 -34.792 1.00 98.16 O ATOM 9490 N VAL A1273 -35.591 -9.471 -35.388 1.00 89.17 N ATOM 9491 CA VAL A1273 -35.990 -10.529 -34.463 1.00 93.54 C ATOM 9492 C VAL A1273 -35.983 -10.095 -33.016 1.00105.61 C ATOM 9493 O VAL A1273 -36.988 -10.285 -32.331 1.00 88.24 O ATOM 9494 CB VAL A1273 -35.137 -11.806 -34.585 1.00 86.37 C ATOM 9495 CG1 VAL A1273 -35.464 -12.784 -33.469 1.00 79.74 C ATOM 9496 CG2 VAL A1273 -35.386 -12.468 -35.918 1.00 88.47 C ATOM 9497 N PHE A1274 -34.892 -9.490 -32.554 1.00117.19 N ATOM 9498 CA PHE A1274 -34.827 -9.009 -31.168 1.00103.10 C ATOM 9499 C PHE A1274 -35.913 -7.976 -30.816 1.00 95.73 C ATOM 9500 O PHE A1274 -36.359 -7.910 -29.671 1.00 88.24 O ATOM 9501 CB PHE A1274 -33.439 -8.461 -30.867 1.00101.91 C ATOM 9502 CG PHE A1274 -33.400 -7.592 -29.660 1.00102.38 C ATOM 9503 CD1 PHE A1274 -33.294 -8.148 -28.402 1.00105.25 C ATOM 9504 CD2 PHE A1274 -33.515 -6.215 -29.785 1.00107.85 C ATOM 9505 CE1 PHE A1274 -33.278 -7.343 -27.282 1.00108.50 C ATOM 9506 CE2 PHE A1274 -33.503 -5.400 -28.677 1.00109.63 C ATOM 9507 CZ PHE A1274 -33.383 -5.966 -27.421 1.00115.54 C ATOM 9508 N LEU A1275 -36.347 -7.179 -31.792 1.00 96.82 N ATOM 9509 CA LEU A1275 -37.410 -6.186 -31.553 1.00 91.58 C ATOM 9510 C LEU A1275 -38.755 -6.799 -31.141 1.00 91.24 C ATOM 9511 O LEU A1275 -39.597 -6.121 -30.545 1.00 88.08 O ATOM 9512 CB LEU A1275 -37.584 -5.276 -32.755 1.00 89.16 C ATOM 9513 CG LEU A1275 -36.222 -4.647 -33.075 1.00 88.57 C ATOM 9514 CD1 LEU A1275 -36.328 -3.829 -34.339 1.00 92.61 C ATOM 9515 CD2 LEU A1275 -35.687 -3.810 -31.921 1.00 84.41 C ATOM 9516 N GLY A1276 -38.950 -8.083 -31.448 1.00103.07 N ATOM 9517 CA GLY A1276 -40.056 -8.871 -30.904 1.00107.17 C ATOM 9518 C GLY A1276 -40.172 -8.879 -29.384 1.00 97.89 C ATOM 9519 O GLY A1276 -41.272 -9.052 -28.878 1.00104.81 O ATOM 9520 N CYS A1277 -39.063 -8.709 -28.659 1.00 92.61 N ATOM 9521 CA CYS A1277 -39.093 -8.662 -27.194 1.00 96.02 C ATOM 9522 C CYS A1277 -39.742 -7.374 -26.620 1.00 94.46 C ATOM 9523 O CYS A1277 -40.052 -7.323 -25.418 1.00 92.57 O ATOM 9524 CB CYS A1277 -37.703 -8.933 -26.578 1.00 93.62 C ATOM 9525 SG CYS A1277 -36.515 -7.571 -26.563 1.00 97.16 S ATOM 9526 N SER A1278 -39.959 -6.349 -27.458 1.00 79.06 N ATOM 9527 CA SER A1278 -40.820 -5.238 -27.050 1.00 78.23 C ATOM 9528 C SER A1278 -42.196 -5.776 -26.535 1.00 79.76 C ATOM 9529 O SER A1278 -42.723 -5.298 -25.529 1.00 87.75 O ATOM 9530 CB SER A1278 -40.926 -4.139 -28.118 1.00 72.41 C ATOM 9531 OG SER A1278 -41.784 -4.508 -29.164 1.00 76.23 O ATOM 9532 N VAL A1279 -42.718 -6.804 -27.198 1.00 80.26 N ATOM 9533 CA VAL A1279 -43.954 -7.463 -26.771 1.00 83.77 C ATOM 9534 C VAL A1279 -43.767 -8.200 -25.441 1.00 84.95 C ATOM 9535 O VAL A1279 -44.635 -8.131 -24.565 1.00 99.26 O ATOM 9536 CB VAL A1279 -44.447 -8.428 -27.850 1.00 84.56 C ATOM 9537 CG1 VAL A1279 -45.650 -9.217 -27.352 1.00 84.79 C ATOM 9538 CG2 VAL A1279 -44.779 -7.635 -29.108 1.00 89.78 C ATOM 9539 N PHE A1280 -42.653 -8.902 -25.293 1.00 84.33 N ATOM 9540 CA PHE A1280 -42.280 -9.608 -24.061 1.00 88.53 C ATOM 9541 C PHE A1280 -42.300 -8.670 -22.857 1.00 91.77 C ATOM 9542 O PHE A1280 -42.935 -8.960 -21.840 1.00 83.86 O ATOM 9543 CB PHE A1280 -40.870 -10.204 -24.245 1.00 87.06 C ATOM 9544 CG PHE A1280 -40.370 -10.977 -23.070 1.00 77.52 C ATOM 9545 CD1 PHE A1280 -40.694 -12.316 -22.917 1.00 79.49 C ATOM 9546 CD2 PHE A1280 -39.570 -10.379 -22.137 1.00 76.89 C ATOM 9547 CE1 PHE A1280 -40.241 -13.050 -21.833 1.00 77.87 C ATOM 9548 CE2 PHE A1280 -39.123 -11.097 -21.040 1.00 90.23 C ATOM 9549 CZ PHE A1280 -39.458 -12.438 -20.886 1.00 83.86 C ATOM 9550 N PHE A1281 -41.613 -7.536 -22.979 1.00 93.66 N ATOM 9551 CA PHE A1281 -41.517 -6.592 -21.863 1.00 88.77 C ATOM 9552 C PHE A1281 -42.777 -5.776 -21.645 1.00 81.07 C ATOM 9553 O PHE A1281 -43.015 -5.296 -20.536 1.00 75.20 O ATOM 9554 CB PHE A1281 -40.324 -5.654 -22.040 1.00 85.22 C ATOM 9555 CG PHE A1281 -39.049 -6.378 -21.983 1.00 79.63 C ATOM 9556 CD1 PHE A1281 -38.759 -7.145 -20.881 1.00 75.02 C ATOM 9557 CD2 PHE A1281 -38.207 -6.407 -23.058 1.00 83.03 C ATOM 9558 CE1 PHE A1281 -37.612 -7.884 -20.826 1.00 75.54 C ATOM 9559 CE2 PHE A1281 -37.047 -7.143 -23.009 1.00 83.54 C ATOM 9560 CZ PHE A1281 -36.752 -7.879 -21.889 1.00 80.38 C ATOM 9561 N ALA A1282 -43.592 -5.629 -22.688 1.00 83.33 N ATOM 9562 CA ALA A1282 -44.937 -5.060 -22.544 1.00 87.11 C ATOM 9563 C ALA A1282 -45.825 -5.969 -21.678 1.00 87.28 C ATOM 9564 O ALA A1282 -46.521 -5.488 -20.796 1.00 98.10 O ATOM 9565 CB ALA A1282 -45.589 -4.854 -23.905 1.00 87.24 C ATOM 9566 N ILE A1283 -45.770 -7.276 -21.920 1.00 88.38 N ATOM 9567 CA ILE A1283 -46.494 -8.264 -21.109 1.00 95.87 C ATOM 9568 C ILE A1283 -45.932 -8.321 -19.677 1.00106.34 C ATOM 9569 O ILE A1283 -46.688 -8.412 -18.701 1.00104.47 O ATOM 9570 CB ILE A1283 -46.428 -9.647 -21.787 1.00101.84 C ATOM 9571 CG1 ILE A1283 -47.140 -9.593 -23.146 1.00102.80 C ATOM 9572 CG2 ILE A1283 -47.064 -10.718 -20.909 1.00104.27 C ATOM 9573 CD1 ILE A1283 -46.893 -10.802 -24.014 1.00105.00 C ATOM 9574 N HIS A1284 -44.602 -8.287 -19.576 1.00114.27 N ATOM 9575 CA HIS A1284 -43.899 -8.229 -18.293 1.00110.60 C ATOM 9576 C HIS A1284 -44.382 -7.048 -17.456 1.00111.43 C ATOM 9577 O HIS A1284 -44.584 -7.183 -16.239 1.00135.36 O ATOM 9578 CB HIS A1284 -42.383 -8.104 -18.487 1.00110.65 C ATOM 9579 CG HIS A1284 -41.590 -8.325 -17.228 1.00108.67 C ATOM 9580 ND1 HIS A1284 -41.337 -7.321 -16.317 1.00109.62 N ATOM 9581 CD2 HIS A1284 -40.984 -9.434 -16.737 1.00105.26 C ATOM 9582 CE1 HIS A1284 -40.621 -7.802 -15.316 1.00103.44 C ATOM 9583 NE2 HIS A1284 -40.396 -9.083 -15.544 1.00103.80 N ATOM 9584 N ASP A1285 -44.566 -5.902 -18.118 1.00106.96 N ATOM 9585 CA ASP A1285 -45.093 -4.677 -17.489 1.00104.47 C ATOM 9586 C ASP A1285 -46.522 -4.877 -16.968 1.00 96.48 C ATOM 9587 O ASP A1285 -46.816 -4.547 -15.813 1.00 93.16 O ATOM 9588 CB ASP A1285 -45.046 -3.464 -18.434 1.00107.31 C ATOM 9589 CG ASP A1285 -45.657 -2.195 -17.817 1.00104.72 C ATOM 9590 OD1 ASP A1285 -45.637 -2.015 -16.573 1.00 94.49 O ATOM 9591 OD2 ASP A1285 -46.150 -1.359 -18.600 1.00109.62 O ATOM 9592 N ALA A1286 -47.389 -5.422 -17.829 1.00 99.02 N ATOM 9593 CA ALA A1286 -48.785 -5.728 -17.478 1.00100.67 C ATOM 9594 C ALA A1286 -48.921 -6.665 -16.294 1.00106.86 C ATOM 9595 O ALA A1286 -49.764 -6.433 -15.427 1.00123.78 O ATOM 9596 CB ALA A1286 -49.604 -6.189 -18.676 1.00 96.17 C ATOM 9597 N VAL A1287 -48.097 -7.713 -16.251 1.00 99.54 N ATOM 9598 CA VAL A1287 -48.092 -8.642 -15.116 1.00102.09 C ATOM 9599 C VAL A1287 -47.653 -7.942 -13.826 1.00114.64 C ATOM 9600 O VAL A1287 -48.241 -8.185 -12.771 1.00143.78 O ATOM 9601 CB VAL A1287 -47.302 -9.912 -15.378 1.00101.91 C ATOM 9602 CG1 VAL A1287 -47.241 -10.757 -14.126 1.00107.55 C ATOM 9603 CG2 VAL A1287 -48.001 -10.714 -16.454 1.00107.77 C ATOM 9604 N SER A1288 -46.645 -7.076 -13.908 1.00115.48 N ATOM 9605 CA SER A1288 -46.177 -6.331 -12.733 1.00126.46 C ATOM 9606 C SER A1288 -47.267 -5.414 -12.141 1.00120.36 C ATOM 9607 O SER A1288 -47.392 -5.301 -10.917 1.00114.04 O ATOM 9608 CB SER A1288 -44.886 -5.557 -13.032 1.00131.63 C ATOM 9609 OG SER A1288 -43.756 -6.389 -12.811 1.00132.18 O ATOM 9610 N ALA A1289 -48.055 -4.789 -13.018 1.00108.03 N ATOM 9611 CA ALA A1289 -49.159 -3.926 -12.599 1.00101.59 C ATOM 9612 C ALA A1289 -50.261 -4.685 -11.863 1.00102.16 C ATOM 9613 O ALA A1289 -50.903 -4.131 -10.975 1.00108.42 O ATOM 9614 CB ALA A1289 -49.711 -3.163 -13.798 1.00 99.64 C ATOM 9615 N ALA A1290 -50.487 -5.940 -12.244 1.00103.27 N ATOM 9616 CA ALA A1290 -51.392 -6.835 -11.514 1.00108.98 C ATOM 9617 C ALA A1290 -50.788 -7.293 -10.194 1.00110.78 C ATOM 9618 O ALA A1290 -51.516 -7.483 -9.225 1.00116.30 O ATOM 9619 CB ALA A1290 -51.747 -8.051 -12.361 1.00105.86 C ATOM 9620 N ARG A1291 -49.467 -7.487 -10.168 1.00112.35 N ATOM 9621 CA ARG A1291 -48.751 -7.902 -8.951 1.00118.69 C ATOM 9622 C ARG A1291 -48.539 -6.781 -7.935 1.00123.95 C ATOM 9623 O ARG A1291 -48.418 -7.063 -6.745 1.00118.05 O ATOM 9624 CB ARG A1291 -47.399 -8.555 -9.294 1.00112.14 C ATOM 9625 CG ARG A1291 -47.505 -9.967 -9.868 1.00 94.59 C ATOM 9626 CD ARG A1291 -46.136 -10.524 -10.169 1.00 81.86 C ATOM 9627 NE ARG A1291 -45.558 -11.192 -9.013 1.00 85.35 N ATOM 9628 CZ ARG A1291 -45.878 -12.424 -8.597 1.00 95.40 C ATOM 9629 NH1 ARG A1291 -46.802 -13.133 -9.229 1.00106.87 N ATOM 9630 NH2 ARG A1291 -45.283 -12.962 -7.529 1.00 89.07 N ATOM 9631 N GLN A1292 -48.474 -5.528 -8.393 1.00129.25 N ATOM 9632 CA GLN A1292 -48.356 -4.376 -7.488 1.00125.07 C ATOM 9633 C GLN A1292 -49.702 -4.072 -6.809 1.00120.33 C ATOM 9634 O GLN A1292 -49.749 -3.873 -5.596 1.00116.31 O ATOM 9635 CB GLN A1292 -47.802 -3.136 -8.236 1.00128.64 C ATOM 9636 CG GLN A1292 -48.832 -2.352 -9.068 1.00137.37 C ATOM 9637 CD GLN A1292 -48.239 -1.291 -10.004 1.00134.96 C ATOM 9638 OE1 GLN A1292 -47.067 -0.921 -9.913 1.00120.15 O ATOM 9639 NE2 GLN A1292 -49.069 -0.798 -10.917 1.00136.51 N ATOM 9640 N GLU A1293 -50.784 -4.076 -7.593 1.00116.85 N ATOM 9641 CA GLU A1293 -52.129 -3.763 -7.105 1.00116.27 C ATOM 9642 C GLU A1293 -52.572 -4.770 -6.050 1.00104.45 C ATOM 9643 O GLU A1293 -53.231 -4.404 -5.076 1.00112.91 O ATOM 9644 CB GLU A1293 -53.160 -3.731 -8.248 1.00128.58 C ATOM 9645 CG GLU A1293 -54.578 -3.287 -7.845 1.00131.89 C ATOM 9646 CD GLU A1293 -55.598 -3.375 -8.987 1.00133.62 C ATOM 9647 OE1 GLU A1293 -55.433 -4.228 -9.881 1.00142.37 O ATOM 9648 OE2 GLU A1293 -56.581 -2.602 -9.007 1.00130.62 O ATOM 9649 N ARG A1294 -52.204 -6.030 -6.252 1.00102.04 N ATOM 9650 CA ARG A1294 -52.575 -7.130 -5.359 1.00116.35 C ATOM 9651 C ARG A1294 -51.561 -7.361 -4.237 1.00117.36 C ATOM 9652 O ARG A1294 -51.837 -8.132 -3.320 1.00117.91 O ATOM 9653 CB ARG A1294 -52.715 -8.447 -6.130 1.00117.17 C ATOM 9654 CG ARG A1294 -53.705 -8.396 -7.277 1.00122.55 C ATOM 9655 CD ARG A1294 -53.571 -9.596 -8.200 1.00115.90 C ATOM 9656 NE ARG A1294 -54.329 -9.399 -9.429 1.00102.13 N ATOM 9657 CZ ARG A1294 -54.683 -10.369 -10.259 1.00104.80 C ATOM 9658 NH1 ARG A1294 -54.346 -11.631 -10.025 1.00103.17 N ATOM 9659 NH2 ARG A1294 -55.391 -10.076 -11.336 1.00113.02 N ATOM 9660 N GLY A1295 -50.383 -6.744 -4.349 1.00118.86 N ATOM 9661 CA GLY A1295 -49.441 -6.623 -3.238 1.00124.92 C ATOM 9662 C GLY A1295 -48.411 -7.726 -3.118 1.00123.92 C ATOM 9663 O GLY A1295 -48.011 -8.070 -2.010 1.00107.42 O ATOM 9664 N LEU A1296 -47.943 -8.243 -4.257 1.00133.24 N ATOM 9665 CA LEU A1296 -46.886 -9.276 -4.286 1.00134.82 C ATOM 9666 C LEU A1296 -45.586 -8.707 -4.813 1.00130.10 C ATOM 9667 O LEU A1296 -45.269 -8.887 -5.983 1.00128.63 O ATOM 9668 CB LEU A1296 -47.350 -10.498 -5.088 1.00145.98 C ATOM 9669 CG LEU A1296 -48.852 -10.822 -5.001 1.00152.60 C ATOM 9670 CD1 LEU A1296 -49.604 -10.329 -6.242 1.00148.15 C ATOM 9671 CD2 LEU A1296 -49.073 -12.315 -4.796 1.00151.33 C ATOM 9672 N HIS A1297 -44.830 -8.020 -3.950 1.00142.17 N ATOM 9673 CA HIS A1297 -43.600 -7.328 -4.367 1.00144.27 C ATOM 9674 C HIS A1297 -42.440 -8.349 -4.446 1.00145.43 C ATOM 9675 O HIS A1297 -42.665 -9.576 -4.358 1.00134.26 O ATOM 9676 CB HIS A1297 -43.325 -6.097 -3.448 1.00145.43 C ATOM 9677 CG HIS A1297 -44.496 -5.138 -3.304 1.00148.01 C ATOM 9678 ND1 HIS A1297 -45.242 -5.031 -2.143 1.00138.66 N ATOM 9679 CD2 HIS A1297 -45.024 -4.228 -4.166 1.00137.06 C ATOM 9680 CE1 HIS A1297 -46.182 -4.113 -2.303 1.00125.40 C ATOM 9681 NE2 HIS A1297 -46.074 -3.612 -3.521 1.00120.27 N ATOM 9682 N GLY A1298 -41.234 -7.855 -4.709 1.00145.24 N ATOM 9683 CA GLY A1298 -40.028 -8.676 -4.697 1.00156.72 C ATOM 9684 C GLY A1298 -39.721 -9.351 -6.036 1.00154.52 C ATOM 9685 O GLY A1298 -39.758 -8.666 -7.047 1.00136.07 O ATOM 9686 N PRO A1299 -39.388 -10.654 -6.032 1.00162.23 N ATOM 9687 CA PRO A1299 -38.790 -11.268 -7.234 1.00159.00 C ATOM 9688 C PRO A1299 -39.808 -11.716 -8.291 1.00150.13 C ATOM 9689 O PRO A1299 -40.517 -12.687 -8.061 1.00132.06 O ATOM 9690 CB PRO A1299 -38.084 -12.500 -6.650 1.00161.04 C ATOM 9691 CG PRO A1299 -38.954 -12.917 -5.495 1.00152.87 C ATOM 9692 CD PRO A1299 -39.744 -11.701 -5.048 1.00159.74 C ATOM 9693 N LEU A1300 -39.880 -11.006 -9.423 1.00142.80 N ATOM 9694 CA LEU A1300 -40.608 -11.442 -10.603 1.00131.67 C ATOM 9695 C LEU A1300 -39.610 -11.521 -11.741 1.00143.29 C ATOM 9696 O LEU A1300 -39.267 -10.513 -12.376 1.00141.99 O ATOM 9697 CB LEU A1300 -41.730 -10.486 -11.001 1.00123.46 C ATOM 9698 CG LEU A1300 -42.506 -10.946 -12.242 1.00109.48 C ATOM 9699 CD1 LEU A1300 -43.252 -12.238 -11.926 1.00102.51 C ATOM 9700 CD2 LEU A1300 -43.440 -9.850 -12.760 1.00104.81 C ATOM 9701 N THR A1301 -39.160 -12.751 -12.032 1.00148.35 N ATOM 9702 CA THR A1301 -38.478 -13.005 -13.314 1.00143.97 C ATOM 9703 C THR A1301 -39.391 -13.948 -14.112 1.00134.42 C ATOM 9704 O THR A1301 -39.681 -15.096 -13.719 1.00102.53 O ATOM 9705 CB THR A1301 -37.023 -13.507 -13.188 1.00143.17 C ATOM 9706 OG1 THR A1301 -36.556 -13.348 -11.845 1.00132.20 O ATOM 9707 CG2 THR A1301 -36.112 -12.707 -14.138 1.00140.74 C ATOM 9708 N LEU A1302 -39.886 -13.404 -15.224 1.00134.09 N ATOM 9709 CA LEU A1302 -40.644 -14.174 -16.192 1.00124.08 C ATOM 9710 C LEU A1302 -39.656 -14.600 -17.277 1.00116.34 C ATOM 9711 O LEU A1302 -38.857 -13.790 -17.774 1.00125.19 O ATOM 9712 CB LEU A1302 -41.760 -13.346 -16.824 1.00115.98 C ATOM 9713 CG LEU A1302 -42.859 -12.970 -15.838 1.00115.18 C ATOM 9714 CD1 LEU A1302 -43.807 -11.958 -16.456 1.00116.98 C ATOM 9715 CD2 LEU A1302 -43.600 -14.210 -15.371 1.00120.73 C ATOM 9716 N ASN A1303 -39.711 -15.882 -17.620 1.00 94.87 N ATOM 9717 CA ASN A1303 -38.872 -16.469 -18.627 1.00 90.41 C ATOM 9718 C ASN A1303 -39.506 -16.484 -19.995 1.00103.34 C ATOM 9719 O ASN A1303 -40.711 -16.437 -20.108 1.00121.97 O ATOM 9720 CB ASN A1303 -38.683 -17.905 -18.254 1.00 85.66 C ATOM 9721 CG ASN A1303 -37.754 -18.063 -17.113 1.00 81.92 C ATOM 9722 OD1 ASN A1303 -36.674 -17.477 -17.107 1.00 75.95 O ATOM 9723 ND2 ASN A1303 -38.149 -18.869 -16.141 1.00 85.65 N ATOM 9724 N SER A1304 -38.658 -16.586 -21.022 1.00105.57 N ATOM 9725 CA SER A1304 -39.098 -16.722 -22.383 1.00 99.12 C ATOM 9726 C SER A1304 -39.164 -18.213 -22.749 1.00101.40 C ATOM 9727 O SER A1304 -38.295 -18.980 -22.338 1.00 99.38 O ATOM 9728 CB SER A1304 -38.189 -16.013 -23.371 1.00 94.16 C ATOM 9729 OG SER A1304 -38.624 -16.287 -24.697 1.00 92.60 O ATOM 9730 N PRO A1305 -40.190 -18.643 -23.509 1.00 95.57 N ATOM 9731 CA PRO A1305 -41.296 -17.849 -24.031 1.00 85.75 C ATOM 9732 C PRO A1305 -42.362 -17.540 -22.995 1.00 87.60 C ATOM 9733 O PRO A1305 -42.668 -18.383 -22.149 1.00101.12 O ATOM 9734 CB PRO A1305 -41.882 -18.728 -25.127 1.00 86.44 C ATOM 9735 CG PRO A1305 -41.512 -20.114 -24.755 1.00 88.13 C ATOM 9736 CD PRO A1305 -40.419 -20.079 -23.727 1.00 92.70 C ATOM 9737 N LEU A1306 -42.925 -16.330 -23.055 1.00 86.26 N ATOM 9738 CA LEU A1306 -43.947 -15.871 -22.118 1.00 81.99 C ATOM 9739 C LEU A1306 -45.303 -16.426 -22.586 1.00 86.89 C ATOM 9740 O LEU A1306 -46.086 -15.744 -23.254 1.00 86.66 O ATOM 9741 CB LEU A1306 -43.919 -14.342 -22.071 1.00 80.16 C ATOM 9742 CG LEU A1306 -43.942 -13.659 -20.720 1.00 80.89 C ATOM 9743 CD1 LEU A1306 -44.117 -12.152 -20.889 1.00 80.01 C ATOM 9744 CD2 LEU A1306 -45.057 -14.257 -19.890 1.00 89.64 C ATOM 9745 N THR A1307 -45.558 -17.692 -22.247 1.00 84.91 N ATOM 9746 CA THR A1307 -46.717 -18.425 -22.738 1.00 87.25 C ATOM 9747 C THR A1307 -47.926 -18.061 -21.880 1.00 93.83 C ATOM 9748 O THR A1307 -47.760 -17.421 -20.850 1.00 92.63 O ATOM 9749 CB THR A1307 -46.452 -19.954 -22.720 1.00 83.39 C ATOM 9750 OG1 THR A1307 -46.306 -20.429 -21.376 1.00 80.60 O ATOM 9751 CG2 THR A1307 -45.187 -20.272 -23.503 1.00 80.12 C ATOM 9752 N PRO A1308 -49.152 -18.438 -22.305 1.00 98.98 N ATOM 9753 CA PRO A1308 -50.316 -18.174 -21.464 1.00107.75 C ATOM 9754 C PRO A1308 -50.266 -18.810 -20.064 1.00107.96 C ATOM 9755 O PRO A1308 -50.804 -18.246 -19.105 1.00106.34 O ATOM 9756 CB PRO A1308 -51.464 -18.724 -22.300 1.00117.00 C ATOM 9757 CG PRO A1308 -51.023 -18.437 -23.686 1.00113.44 C ATOM 9758 CD PRO A1308 -49.568 -18.808 -23.663 1.00111.17 C ATOM 9759 N GLU A1309 -49.639 -19.981 -19.973 1.00111.62 N ATOM 9760 CA GLU A1309 -49.376 -20.635 -18.699 1.00111.99 C ATOM 9761 C GLU A1309 -48.605 -19.711 -17.769 1.00110.45 C ATOM 9762 O GLU A1309 -49.044 -19.438 -16.648 1.00133.36 O ATOM 9763 CB GLU A1309 -48.566 -21.901 -18.930 1.00109.81 C ATOM 9764 CG GLU A1309 -48.055 -22.539 -17.653 1.00106.51 C ATOM 9765 CD GLU A1309 -47.457 -23.900 -17.911 1.00112.56 C ATOM 9766 OE1 GLU A1309 -46.873 -24.069 -19.016 1.00106.93 O ATOM 9767 OE2 GLU A1309 -47.578 -24.784 -17.017 1.00110.62 O ATOM 9768 N LYS A1310 -47.458 -19.235 -18.254 1.00 99.83 N ATOM 9769 CA LYS A1310 -46.586 -18.350 -17.461 1.00 98.38 C ATOM 9770 C LYS A1310 -47.250 -17.028 -17.089 1.00 95.04 C ATOM 9771 O LYS A1310 -47.036 -16.537 -15.988 1.00 97.65 O ATOM 9772 CB LYS A1310 -45.243 -18.070 -18.158 1.00102.73 C ATOM 9773 CG LYS A1310 -44.230 -19.206 -18.128 1.00103.56 C ATOM 9774 CD LYS A1310 -42.914 -18.758 -18.752 1.00112.67 C ATOM 9775 CE LYS A1310 -42.006 -19.926 -19.133 1.00120.26 C ATOM 9776 NZ LYS A1310 -42.238 -20.457 -20.511 1.00118.54 N ATOM 9777 N ILE A1311 -48.055 -16.460 -17.993 1.00 96.72 N ATOM 9778 CA ILE A1311 -48.779 -15.207 -17.696 1.00 94.46 C ATOM 9779 C ILE A1311 -49.742 -15.418 -16.523 1.00 94.18 C ATOM 9780 O ILE A1311 -49.652 -14.718 -15.512 1.00 88.96 O ATOM 9781 CB ILE A1311 -49.512 -14.643 -18.932 1.00 95.00 C ATOM 9782 CG1 ILE A1311 -48.501 -14.249 -20.009 1.00100.64 C ATOM 9783 CG2 ILE A1311 -50.349 -13.423 -18.573 1.00 91.23 C ATOM 9784 CD1 ILE A1311 -49.078 -14.194 -21.411 1.00108.51 C ATOM 9785 N ARG A1312 -50.639 -16.392 -16.662 1.00 96.67 N ATOM 9786 CA ARG A1312 -51.696 -16.657 -15.678 1.00 98.96 C ATOM 9787 C ARG A1312 -51.169 -16.873 -14.271 1.00104.79 C ATOM 9788 O ARG A1312 -51.659 -16.262 -13.322 1.00133.27 O ATOM 9789 CB ARG A1312 -52.502 -17.888 -16.103 1.00 98.32 C ATOM 9790 CG ARG A1312 -53.574 -18.312 -15.104 1.00104.68 C ATOM 9791 CD ARG A1312 -54.784 -17.405 -15.189 1.00102.29 C ATOM 9792 NE ARG A1312 -55.747 -17.600 -14.108 1.00 90.79 N ATOM 9793 CZ ARG A1312 -55.577 -17.190 -12.859 1.00 92.64 C ATOM 9794 NH1 ARG A1312 -54.459 -16.590 -12.474 1.00 88.67 N ATOM 9795 NH2 ARG A1312 -56.530 -17.409 -11.975 1.00106.30 N ATOM 9796 N MET A1313 -50.180 -17.751 -14.154 1.00 93.86 N ATOM 9797 CA MET A1313 -49.645 -18.167 -12.861 1.00 90.82 C ATOM 9798 C MET A1313 -48.838 -17.061 -12.184 1.00 82.08 C ATOM 9799 O MET A1313 -48.646 -17.092 -10.964 1.00 90.70 O ATOM 9800 CB MET A1313 -48.890 -19.477 -13.061 1.00 96.81 C ATOM 9801 CG MET A1313 -49.730 -20.547 -13.775 1.00 92.66 C ATOM 9802 SD MET A1313 -50.825 -21.568 -12.749 1.00 98.63 S ATOM 9803 CE MET A1313 -51.722 -20.412 -11.716 1.00 99.96 C ATOM 9804 N ALA A1314 -48.388 -16.091 -12.969 1.00 77.46 N ATOM 9805 CA ALA A1314 -47.780 -14.874 -12.448 1.00 86.22 C ATOM 9806 C ALA A1314 -48.802 -13.886 -11.898 1.00 93.40 C ATOM 9807 O ALA A1314 -48.500 -13.167 -10.940 1.00106.27 O ATOM 9808 CB ALA A1314 -46.935 -14.212 -13.507 1.00 95.00 C ATOM 9809 N CYS A1315 -50.003 -13.824 -12.486 1.00 99.26 N ATOM 9810 CA CYS A1315 -51.119 -13.041 -11.899 1.00108.42 C ATOM 9811 C CYS A1315 -51.794 -13.824 -10.781 1.00109.60 C ATOM 9812 O CYS A1315 -52.877 -14.385 -10.974 1.00115.37 O ATOM 9813 CB CYS A1315 -52.128 -12.668 -12.998 1.00106.33 C ATOM 9814 SG CYS A1315 -51.391 -11.681 -14.322 1.00108.41 S ATOM 9815 N GLU A1316 -51.147 -13.885 -9.613 1.00108.91 N ATOM 9816 CA GLU A1316 -51.673 -14.627 -8.486 1.00106.26 C ATOM 9817 C GLU A1316 -52.889 -13.884 -7.914 1.00111.62 C ATOM 9818 O GLU A1316 -52.975 -12.651 -7.956 1.00124.19 O ATOM 9819 CB GLU A1316 -50.600 -14.855 -7.387 1.00105.54 C ATOM 9820 CG GLU A1316 -49.223 -15.404 -7.823 1.00106.86 C ATOM 9821 CD GLU A1316 -48.392 -16.070 -6.682 1.00109.01 C ATOM 9822 OE1 GLU A1316 -48.984 -16.757 -5.821 1.00111.77 O ATOM 9823 OE2 GLU A1316 -47.134 -15.950 -6.638 1.00 94.36 O ATOM 9824 N ASP A1317 -53.837 -14.683 -7.427 1.00107.82 N ATOM 9825 CA ASP A1317 -55.091 -14.223 -6.841 1.00111.67 C ATOM 9826 C ASP A1317 -55.604 -15.354 -5.961 1.00103.38 C ATOM 9827 O ASP A1317 -54.831 -16.260 -5.686 1.00 86.59 O ATOM 9828 CB ASP A1317 -56.110 -13.848 -7.930 1.00118.30 C ATOM 9829 CG ASP A1317 -56.256 -14.921 -8.999 1.00115.78 C ATOM 9830 OD1 ASP A1317 -56.394 -16.101 -8.608 1.00102.35 O ATOM 9831 OD2 ASP A1317 -56.235 -14.575 -10.218 1.00117.23 O ATOM 9832 N LYS A1318 -56.857 -15.323 -5.505 1.00104.96 N ATOM 9833 CA LYS A1318 -57.379 -16.420 -4.671 1.00114.06 C ATOM 9834 C LYS A1318 -57.345 -17.780 -5.384 1.00110.69 C ATOM 9835 O LYS A1318 -57.161 -18.821 -4.750 1.00116.04 O ATOM 9836 CB LYS A1318 -58.798 -16.111 -4.158 1.00121.12 C ATOM 9837 CG LYS A1318 -59.898 -16.030 -5.212 1.00128.74 C ATOM 9838 CD LYS A1318 -61.229 -15.559 -4.612 1.00134.37 C ATOM 9839 CE LYS A1318 -62.203 -15.018 -5.665 1.00133.02 C ATOM 9840 NZ LYS A1318 -63.377 -14.261 -5.119 1.00125.68 N ATOM 9841 N PHE A1319 -57.499 -17.750 -6.706 1.00107.86 N ATOM 9842 CA PHE A1319 -57.556 -18.983 -7.507 1.00101.40 C ATOM 9843 C PHE A1319 -56.183 -19.652 -7.629 1.00105.28 C ATOM 9844 O PHE A1319 -56.100 -20.875 -7.591 1.00102.99 O ATOM 9845 CB PHE A1319 -58.152 -18.722 -8.896 1.00104.16 C ATOM 9846 CG PHE A1319 -59.482 -18.015 -8.865 1.00101.60 C ATOM 9847 CD1 PHE A1319 -60.597 -18.635 -8.293 1.00 94.86 C ATOM 9848 CD2 PHE A1319 -59.621 -16.723 -9.399 1.00 93.50 C ATOM 9849 CE1 PHE A1319 -61.822 -17.987 -8.257 1.00 89.68 C ATOM 9850 CE2 PHE A1319 -60.841 -16.073 -9.357 1.00 89.75 C ATOM 9851 CZ PHE A1319 -61.939 -16.710 -8.788 1.00 91.64 C ATOM 9852 N THR A1320 -55.114 -18.867 -7.744 1.00107.85 N ATOM 9853 CA THR A1320 -53.758 -19.414 -7.734 1.00108.33 C ATOM 9854 C THR A1320 -53.407 -20.066 -6.385 1.00114.32 C ATOM 9855 O THR A1320 -52.772 -21.112 -6.364 1.00111.40 O ATOM 9856 CB THR A1320 -52.737 -18.350 -8.099 1.00110.83 C ATOM 9857 OG1 THR A1320 -53.000 -17.936 -9.440 1.00117.98 O ATOM 9858 CG2 THR A1320 -51.317 -18.903 -8.016 1.00116.25 C ATOM 9859 N LYS A1321 -53.839 -19.453 -5.276 1.00120.24 N ATOM 9860 CA LYS A1321 -53.607 -19.997 -3.925 1.00128.70 C ATOM 9861 C LYS A1321 -54.414 -21.290 -3.699 1.00133.73 C ATOM 9862 O LYS A1321 -53.944 -22.217 -3.028 1.00137.87 O ATOM 9863 CB LYS A1321 -53.964 -18.980 -2.815 1.00133.18 C ATOM 9864 CG LYS A1321 -53.690 -17.505 -3.086 1.00137.65 C ATOM 9865 CD LYS A1321 -52.209 -17.168 -3.160 1.00143.39 C ATOM 9866 CE LYS A1321 -51.970 -15.914 -3.999 1.00145.71 C ATOM 9867 NZ LYS A1321 -52.718 -14.697 -3.562 1.00138.76 N ATOM 9868 N MET A1322 -55.620 -21.327 -4.270 1.00127.08 N ATOM 9869 CA MET A1322 -56.596 -22.384 -4.018 1.00122.66 C ATOM 9870 C MET A1322 -56.241 -23.758 -4.598 1.00122.46 C ATOM 9871 O MET A1322 -56.540 -24.775 -3.992 1.00124.87 O ATOM 9872 CB MET A1322 -58.020 -21.967 -4.430 1.00128.93 C ATOM 9873 CG MET A1322 -59.132 -22.676 -3.647 1.00130.04 C ATOM 9874 SD MET A1322 -60.823 -22.484 -4.295 1.00128.23 S ATOM 9875 CE MET A1322 -61.052 -20.694 -4.310 1.00120.19 C ATOM 9876 N ILE A1323 -55.618 -23.783 -5.767 1.00121.81 N ATOM 9877 CA ILE A1323 -55.390 -25.022 -6.522 1.00117.85 C ATOM 9878 C ILE A1323 -54.535 -26.047 -5.769 1.00103.96 C ATOM 9879 O ILE A1323 -53.594 -25.645 -5.082 1.00118.11 O ATOM 9880 CB ILE A1323 -54.709 -24.761 -7.912 1.00127.01 C ATOM 9881 CG1 ILE A1323 -53.266 -24.261 -7.774 1.00126.75 C ATOM 9882 CG2 ILE A1323 -55.510 -23.796 -8.788 1.00130.33 C ATOM 9883 CD1 ILE A1323 -52.246 -25.330 -8.091 1.00128.26 C ATOM 9884 N PRO A1324 -54.862 -27.355 -5.879 1.00 94.79 N ATOM 9885 CA PRO A1324 -54.079 -28.392 -5.200 1.00100.43 C ATOM 9886 C PRO A1324 -52.773 -28.674 -5.929 1.00104.28 C ATOM 9887 O PRO A1324 -52.757 -28.712 -7.141 1.00116.24 O ATOM 9888 CB PRO A1324 -55.012 -29.611 -5.203 1.00 97.20 C ATOM 9889 CG PRO A1324 -56.004 -29.346 -6.282 1.00100.41 C ATOM 9890 CD PRO A1324 -56.136 -27.865 -6.410 1.00 95.94 C ATOM 9891 N ARG A1325 -51.688 -28.883 -5.179 1.00101.61 N ATOM 9892 CA ARG A1325 -50.347 -29.004 -5.750 1.00106.95 C ATOM 9893 C ARG A1325 -49.659 -30.290 -5.316 1.00128.49 C ATOM 9894 O ARG A1325 -50.105 -31.008 -4.387 1.00154.86 O ATOM 9895 CB ARG A1325 -49.480 -27.807 -5.367 1.00101.64 C ATOM 9896 CG ARG A1325 -50.195 -26.476 -5.441 1.00 95.45 C ATOM 9897 CD ARG A1325 -49.294 -25.405 -6.010 1.00 94.03 C ATOM 9898 NE ARG A1325 -49.941 -24.096 -5.964 1.00 99.89 N ATOM 9899 CZ ARG A1325 -49.568 -23.024 -6.672 1.00103.88 C ATOM 9900 NH1 ARG A1325 -48.542 -23.088 -7.518 1.00104.58 N ATOM 9901 NH2 ARG A1325 -50.231 -21.872 -6.540 1.00102.43 N ATOM 9902 N ASP A1326 -48.528 -30.576 -5.953 1.00136.84 N ATOM 9903 CA ASP A1326 -47.753 -31.793 -5.700 1.00137.31 C ATOM 9904 C ASP A1326 -46.383 -31.451 -5.134 1.00146.71 C ATOM 9905 O ASP A1326 -45.855 -30.340 -5.331 1.00152.42 O ATOM 9906 CB ASP A1326 -47.712 -32.579 -7.008 1.00130.84 C ATOM 9907 CG ASP A1326 -49.112 -32.723 -7.636 1.00119.41 C ATOM 9908 OD1 ASP A1326 -49.883 -33.577 -7.151 1.00105.74 O ATOM 9909 OD2 ASP A1326 -49.452 -31.976 -8.589 1.00106.04 O ATOM 9910 N GLU A1327 -45.740 -32.442 -4.500 1.00142.51 N ATOM 9911 CA GLU A1327 -44.298 -32.345 -4.151 1.00139.45 C ATOM 9912 C GLU A1327 -43.507 -32.599 -5.426 1.00133.80 C ATOM 9913 O GLU A1327 -43.905 -33.416 -6.248 1.00149.64 O ATOM 9914 CB GLU A1327 -43.816 -33.300 -3.067 1.00146.14 C ATOM 9915 CG GLU A1327 -44.704 -33.389 -1.852 1.00152.78 C ATOM 9916 CD GLU A1327 -45.715 -34.492 -2.013 1.00158.19 C ATOM 9917 OE1 GLU A1327 -46.374 -34.525 -3.086 1.00151.76 O ATOM 9918 OE2 GLU A1327 -45.821 -35.326 -1.085 1.00154.48 O ATOM 9919 N PRO A1328 -42.392 -31.878 -5.610 1.00128.07 N ATOM 9920 CA PRO A1328 -41.457 -32.081 -6.740 1.00126.15 C ATOM 9921 C PRO A1328 -41.186 -33.526 -7.226 1.00122.52 C ATOM 9922 O PRO A1328 -41.534 -33.855 -8.373 1.00111.76 O ATOM 9923 CB PRO A1328 -40.165 -31.421 -6.225 1.00118.83 C ATOM 9924 CG PRO A1328 -40.662 -30.275 -5.389 1.00115.92 C ATOM 9925 CD PRO A1328 -42.012 -30.680 -4.826 1.00118.79 C ATOM 9926 N GLY A1329 -40.608 -34.371 -6.369 1.00123.82 N ATOM 9927 CA GLY A1329 -40.205 -35.722 -6.756 1.00135.18 C ATOM 9928 C GLY A1329 -41.223 -36.826 -6.536 1.00138.97 C ATOM 9929 O GLY A1329 -40.882 -38.009 -6.670 1.00147.03 O ATOM 9930 N SER A1330 -42.463 -36.469 -6.194 1.00136.69 N ATOM 9931 CA SER A1330 -43.529 -37.457 -5.943 1.00135.28 C ATOM 9932 C SER A1330 -44.106 -38.095 -7.210 1.00136.48 C ATOM 9933 O SER A1330 -44.620 -39.210 -7.150 1.00136.04 O ATOM 9934 CB SER A1330 -44.662 -36.855 -5.087 1.00128.97 C ATOM 9935 OG SER A1330 -44.722 -35.441 -5.187 1.00121.22 O ATOM 9936 N TYR A1331 -44.010 -37.389 -8.344 1.00137.71 N ATOM 9937 CA TYR A1331 -44.533 -37.849 -9.647 1.00126.64 C ATOM 9938 C TYR A1331 -43.527 -37.580 -10.746 1.00116.24 C ATOM 9939 O TYR A1331 -42.639 -36.733 -10.583 1.00106.42 O ATOM 9940 CB TYR A1331 -45.820 -37.095 -10.000 1.00123.35 C ATOM 9941 CG TYR A1331 -45.600 -35.611 -10.214 1.00120.15 C ATOM 9942 CD1 TYR A1331 -45.418 -34.749 -9.138 1.00121.21 C ATOM 9943 CD2 TYR A1331 -45.552 -35.072 -11.490 1.00125.06 C ATOM 9944 CE1 TYR A1331 -45.203 -33.390 -9.330 1.00128.29 C ATOM 9945 CE2 TYR A1331 -45.343 -33.713 -11.691 1.00127.25 C ATOM 9946 CZ TYR A1331 -45.170 -32.878 -10.611 1.00129.26 C ATOM 9947 OH TYR A1331 -44.963 -31.537 -10.814 1.00131.49 O ATOM 9948 N VAL A1332 -43.687 -38.273 -11.873 1.00113.12 N ATOM 9949 CA VAL A1332 -42.902 -37.998 -13.098 1.00112.04 C ATOM 9950 C VAL A1332 -43.747 -37.102 -14.042 1.00116.85 C ATOM 9951 O VAL A1332 -44.821 -37.518 -14.462 1.00123.91 O ATOM 9952 CB VAL A1332 -42.410 -39.310 -13.807 1.00101.14 C ATOM 9953 CG1 VAL A1332 -43.527 -40.074 -14.510 1.00 96.43 C ATOM 9954 CG2 VAL A1332 -41.314 -39.010 -14.822 1.00107.60 C ATOM 9955 N PRO A1333 -43.281 -35.875 -14.348 1.00109.31 N ATOM 9956 CA PRO A1333 -44.130 -34.948 -15.094 1.00102.99 C ATOM 9957 C PRO A1333 -44.219 -35.307 -16.565 1.00107.19 C ATOM 9958 O PRO A1333 -43.348 -35.985 -17.090 1.00107.69 O ATOM 9959 CB PRO A1333 -43.415 -33.610 -14.913 1.00110.53 C ATOM 9960 CG PRO A1333 -41.980 -33.970 -14.721 1.00112.70 C ATOM 9961 CD PRO A1333 -41.979 -35.280 -13.990 1.00109.69 C ATOM 9962 N TRP A1334 -45.259 -34.833 -17.235 1.00110.64 N ATOM 9963 CA TRP A1334 -45.340 -34.914 -18.702 1.00108.28 C ATOM 9964 C TRP A1334 -44.242 -34.096 -19.399 1.00104.52 C ATOM 9965 O TRP A1334 -43.840 -34.488 -20.488 1.00 98.67 O ATOM 9966 CB TRP A1334 -46.684 -34.399 -19.227 1.00108.84 C ATOM 9967 CG TRP A1334 -46.979 -34.664 -20.737 1.00108.87 C ATOM 9968 CD1 TRP A1334 -47.117 -33.724 -21.738 1.00102.34 C ATOM 9969 CD2 TRP A1334 -47.214 -35.934 -21.363 1.00 95.60 C ATOM 9970 NE1 TRP A1334 -47.416 -34.336 -22.931 1.00 90.92 N ATOM 9971 CE2 TRP A1334 -47.483 -35.689 -22.728 1.00 94.63 C ATOM 9972 CE3 TRP A1334 -47.226 -37.252 -20.902 1.00 95.81 C ATOM 9973 CZ2 TRP A1334 -47.751 -36.718 -23.634 1.00101.56 C ATOM 9974 CZ3 TRP A1334 -47.494 -38.279 -21.809 1.00 99.96 C ATOM 9975 CH2 TRP A1334 -47.750 -38.004 -23.156 1.00 99.79 C ATOM 9976 N ASN A1335 -43.778 -33.001 -18.784 1.00106.94 N ATOM 9977 CA ASN A1335 -42.762 -32.098 -19.420 1.00114.44 C ATOM 9978 C ASN A1335 -41.583 -31.685 -18.521 1.00112.38 C ATOM 9979 O ASN A1335 -41.528 -32.075 -17.369 1.00111.21 O ATOM 9980 CB ASN A1335 -43.481 -30.916 -20.092 1.00114.06 C ATOM 9981 CG ASN A1335 -44.331 -31.359 -21.289 1.00122.20 C ATOM 9982 OD1 ASN A1335 -43.841 -32.007 -22.224 1.00125.25 O ATOM 9983 ND2 ASN A1335 -45.610 -31.017 -21.259 1.00122.46 N ATOM 9984 N VAL A1336 -40.644 -30.923 -19.081 1.00112.68 N ATOM 9985 CA VAL A1336 -39.450 -30.339 -18.387 1.00114.99 C ATOM 9986 C VAL A1336 -38.460 -31.424 -17.974 1.00112.98 C ATOM 9987 O VAL A1336 -37.998 -32.181 -18.821 1.00 99.32 O ATOM 9988 CB VAL A1336 -39.735 -29.281 -17.258 1.00113.50 C ATOM 9989 CG1 VAL A1336 -39.517 -29.855 -15.860 1.00112.10 C ATOM 9990 CG2 VAL A1336 -38.829 -28.053 -17.428 1.00101.37 C TER 9991 VAL A1336 HETATM 9992 FE1 FES A3001 -42.174 -17.479 -46.802 1.00 82.37 FE HETATM 9993 FE2 FES A3001 -45.232 -17.110 -46.693 1.00 86.65 FE HETATM 9994 S1 FES A3001 -43.591 -16.265 -48.003 1.00 70.16 S HETATM 9995 S2 FES A3001 -43.837 -18.685 -45.963 1.00 63.46 S HETATM 9996 FE1 FES A3002 -52.114 -29.505 -45.703 1.00134.82 FE HETATM 9997 FE2 FES A3002 -50.405 -28.095 -43.683 1.00146.05 FE HETATM 9998 S1 FES A3002 -52.286 -27.490 -44.713 1.00135.93 S HETATM 9999 S2 FES A3002 -49.921 -29.266 -45.536 1.00119.53 S HETATM10000 N1 MTE A3003 -36.078 -14.142 -45.239 1.00 98.85 N HETATM10001 C2 MTE A3003 -36.802 -15.182 -45.793 1.00106.47 C HETATM10002 N2 MTE A3003 -37.983 -14.953 -46.435 1.00 96.99 N HETATM10003 N3 MTE A3003 -36.372 -16.470 -45.729 1.00108.17 N HETATM10004 C4 MTE A3003 -35.207 -16.825 -45.118 1.00106.08 C HETATM10005 O4 MTE A3003 -34.817 -18.017 -45.065 1.00 98.02 O HETATM10006 N5 MTE A3003 -33.218 -16.051 -43.824 1.00 95.32 N HETATM10007 C6 MTE A3003 -32.680 -15.063 -42.894 1.00 94.31 C HETATM10008 C7 MTE A3003 -32.772 -13.671 -43.516 1.00 96.74 C HETATM10009 N8 MTE A3003 -34.113 -13.400 -44.055 1.00104.64 N HETATM10010 C9 MTE A3003 -34.359 -15.768 -44.509 1.00100.96 C HETATM10011 C10 MTE A3003 -34.884 -14.379 -44.595 1.00100.82 C HETATM10012 C1' MTE A3003 -31.262 -15.316 -42.443 1.00 93.90 C HETATM10013 S1' MTE A3003 -30.782 -16.481 -41.312 1.00100.75 S HETATM10014 C2' MTE A3003 -30.257 -14.606 -42.900 1.00 94.00 C HETATM10015 S2' MTE A3003 -28.785 -15.016 -42.175 1.00 87.03 S HETATM10016 C3' MTE A3003 -30.439 -13.529 -43.951 1.00 98.54 C HETATM10017 O3' MTE A3003 -31.760 -13.603 -44.524 1.00 91.38 O HETATM10018 C4' MTE A3003 -29.331 -13.617 -45.023 1.00105.85 C HETATM10019 O4' MTE A3003 -29.681 -12.923 -46.235 1.00121.44 O HETATM10020 P MTE A3003 -29.360 -11.355 -46.465 1.00131.71 P HETATM10021 O1P MTE A3003 -29.633 -11.064 -47.937 1.00110.29 O HETATM10022 O2P MTE A3003 -30.271 -10.596 -45.521 1.00138.14 O HETATM10023 O3P MTE A3003 -27.922 -11.319 -46.027 1.00123.43 O HETATM10024 PA FAD A3004 -64.118 -37.836 -39.658 1.00 81.31 P HETATM10025 O1A FAD A3004 -64.749 -37.902 -41.046 1.00 75.11 O HETATM10026 O2A FAD A3004 -62.628 -37.750 -39.501 1.00 80.14 O HETATM10027 O5B FAD A3004 -64.629 -39.110 -38.813 1.00 90.89 O HETATM10028 C5B FAD A3004 -64.211 -39.379 -37.472 1.00 89.76 C HETATM10029 C4B FAD A3004 -65.051 -40.488 -36.841 1.00 84.65 C HETATM10030 O4B FAD A3004 -66.421 -40.121 -36.965 1.00 84.34 O HETATM10031 C3B FAD A3004 -64.894 -41.821 -37.560 1.00 82.82 C HETATM10032 O3B FAD A3004 -64.747 -42.884 -36.623 1.00 79.39 O HETATM10033 C2B FAD A3004 -66.152 -41.959 -38.399 1.00 82.16 C HETATM10034 O2B FAD A3004 -66.542 -43.308 -38.622 1.00 77.51 O HETATM10035 C1B FAD A3004 -67.138 -41.223 -37.531 1.00 82.90 C HETATM10036 N9A FAD A3004 -68.332 -40.624 -38.142 1.00 80.40 N HETATM10037 C8A FAD A3004 -68.415 -39.488 -38.857 1.00 78.66 C HETATM10038 N7A FAD A3004 -69.710 -39.204 -39.175 1.00 82.76 N HETATM10039 C5A FAD A3004 -70.446 -40.170 -38.606 1.00 84.38 C HETATM10040 C6A FAD A3004 -71.877 -40.480 -38.517 1.00 81.38 C HETATM10041 N6A FAD A3004 -72.735 -39.661 -39.149 1.00 81.79 N HETATM10042 N1A FAD A3004 -72.250 -41.594 -37.824 1.00 81.07 N HETATM10043 C2A FAD A3004 -71.361 -42.408 -37.198 1.00 80.09 C HETATM10044 N3A FAD A3004 -70.033 -42.179 -37.225 1.00 83.92 N HETATM10045 C4A FAD A3004 -69.542 -41.100 -37.910 1.00 85.16 C HETATM10046 N1 FAD A3004 -61.672 -29.506 -32.653 1.00100.11 N HETATM10047 C2 FAD A3004 -61.990 -28.590 -31.725 1.00101.62 C HETATM10048 O2 FAD A3004 -62.924 -28.878 -30.959 1.00101.27 O HETATM10049 N3 FAD A3004 -61.351 -27.410 -31.601 1.00108.74 N HETATM10050 C4 FAD A3004 -60.348 -27.036 -32.410 1.00106.85 C HETATM10051 O4 FAD A3004 -59.780 -25.914 -32.274 1.00116.97 O HETATM10052 C4X FAD A3004 -59.952 -27.999 -33.469 1.00 90.98 C HETATM10053 N5 FAD A3004 -58.948 -27.748 -34.324 1.00 91.55 N HETATM10054 C5X FAD A3004 -58.590 -28.645 -35.271 1.00 87.14 C HETATM10055 C6 FAD A3004 -57.537 -28.339 -36.140 1.00 83.34 C HETATM10056 C7 FAD A3004 -57.150 -29.244 -37.117 1.00 79.99 C HETATM10057 C7M FAD A3004 -56.031 -28.911 -38.063 1.00 78.74 C HETATM10058 C8 FAD A3004 -57.868 -30.546 -37.221 1.00 85.59 C HETATM10059 C8M FAD A3004 -57.497 -31.561 -38.264 1.00 83.79 C HETATM10060 C9 FAD A3004 -58.917 -30.855 -36.363 1.00 88.54 C HETATM10061 C9A FAD A3004 -59.316 -29.947 -35.384 1.00 84.59 C HETATM10062 N10 FAD A3004 -60.374 -30.228 -34.499 1.00 79.10 N HETATM10063 C10 FAD A3004 -60.690 -29.274 -33.534 1.00 87.96 C HETATM10064 C1' FAD A3004 -61.122 -31.490 -34.524 1.00 76.91 C HETATM10065 C2' FAD A3004 -62.146 -31.525 -35.654 1.00 71.46 C HETATM10066 O2' FAD A3004 -63.115 -30.543 -35.302 1.00 69.25 O HETATM10067 C3' FAD A3004 -62.748 -32.940 -35.838 1.00 70.61 C HETATM10068 O3' FAD A3004 -61.821 -33.839 -36.440 1.00 68.62 O HETATM10069 C4' FAD A3004 -63.897 -33.032 -36.809 1.00 74.22 C HETATM10070 O4' FAD A3004 -65.046 -32.415 -36.244 1.00 84.32 O HETATM10071 C5' FAD A3004 -64.238 -34.477 -37.148 1.00 73.18 C HETATM10072 O5' FAD A3004 -65.202 -34.430 -38.197 1.00 74.43 O HETATM10073 P FAD A3004 -64.946 -35.280 -39.529 1.00 70.79 P HETATM10074 O1P FAD A3004 -63.681 -34.795 -40.153 1.00 76.93 O HETATM10075 O2P FAD A3004 -66.127 -35.285 -40.470 1.00 71.05 O HETATM10076 O3P FAD A3004 -64.749 -36.670 -38.778 1.00 67.52 O HETATM10077 MO MOS A3005 -27.997 -17.004 -40.102 1.00150.11 MO HETATM10078 S MOS A3005 -26.081 -18.423 -40.217 0.63113.74 S HETATM10079 O1 MOS A3005 -28.380 -17.334 -41.897 1.00145.89 O HETATM10080 O2 MOS A3005 -26.841 -15.622 -40.569 1.00160.25 O HETATM10081 O HOH A3101 -33.087 -19.400 -27.299 1.00101.43 O HETATM10082 O HOH A3102 -55.176 -6.797 -11.004 1.00 88.36 O HETATM10083 O HOH A3103 -33.475 -36.223 -26.823 1.00 74.32 O HETATM10084 O HOH A3104 -37.695 -55.527 -52.581 1.00 65.11 O HETATM10085 O HOH A3105 -49.343 -22.114 -50.415 1.00 82.86 O HETATM10086 O HOH A3106 -32.708 -19.201 -69.296 1.00 63.72 O HETATM10087 O HOH A3107 -47.967 -5.415 -30.175 1.00 88.89 O HETATM10088 O HOH A3108 -36.351 -25.408 -53.144 1.00 75.05 O HETATM10089 O HOH A3109 -38.433 -18.716 -26.148 1.00 70.21 O HETATM10090 O HOH A3110 -59.230 -41.469 -52.081 1.00 84.61 O HETATM10091 O HOH A3111 -47.787 -34.124 -16.357 1.00 83.12 O HETATM10092 O HOH A3112 -25.404 -25.758 -30.212 1.00 98.59 O HETATM10093 O HOH A3113 -46.767 0.212 -29.772 1.00 98.11 O HETATM10094 O HOH A3114 -60.966 -12.438 -63.783 1.00 52.34 O HETATM10095 O HOH A3115 -38.154 -18.734 -52.539 1.00 43.04 O HETATM10096 O HOH A3116 -37.092 -55.612 -39.964 1.00 65.54 O HETATM10097 O HOH A3117 -71.642 -25.476 -66.908 1.00 81.04 O HETATM10098 O HOH A3118 -46.883 -34.997 -27.889 1.00 87.63 O HETATM10099 O HOH A3119 -62.915 -18.598 -24.611 1.00 57.10 O HETATM10100 O HOH A3120 -60.337 -11.054 -17.231 1.00 76.06 O HETATM10101 O HOH A3121 -26.463 -52.828 -48.448 1.00 81.41 O HETATM10102 O HOH A3122 -32.631 -22.214 -20.742 1.00 84.41 O HETATM10103 O HOH A3123 -15.794 -34.431 -36.436 1.00 58.25 O HETATM10104 O HOH A3124 -22.819 -11.493 -38.897 1.00 80.61 O HETATM10105 O HOH A3125 -34.493 -28.264 -47.588 1.00110.82 O HETATM10106 O HOH A3126 -77.372 -25.903 -2.065 1.00 94.90 O HETATM10107 O HOH A3127 -30.573 6.377 -42.471 1.00 88.29 O HETATM10108 O HOH A3128 -40.142 -28.339 -52.135 1.00 54.66 O HETATM10109 O HOH A3129 -18.516 -21.165 -24.793 1.00108.79 O HETATM10110 O HOH A3130 -63.040 0.222 -11.676 1.00 97.27 O HETATM10111 O HOH A3131 -43.731 -38.142 -22.002 1.00 68.12 O HETATM10112 O HOH A3132 -63.372 -4.102 -8.414 1.00 84.78 O HETATM10113 O HOH A3133 -32.744 -27.086 -55.589 1.00 57.35 O HETATM10114 O HOH A3134 -64.724 -31.548 -49.653 1.00 54.32 O HETATM10115 O HOH A3135 -27.920 -40.578 -14.533 1.00 93.72 O HETATM10116 O HOH A3136 -34.380 -25.321 -55.754 1.00 52.17 O HETATM10117 O HOH A3137 -29.171 -18.635 -32.531 1.00 45.89 O HETATM10118 O HOH A3138 -37.165 -12.951 -64.755 1.00 48.48 O HETATM10119 O HOH A3139 -11.667 -8.330 -84.440 1.00 65.81 O HETATM10120 O HOH A3140 -42.815 4.497 -17.538 1.00 86.77 O HETATM10121 O HOH A3141 -56.801 -31.271 -25.248 1.00 75.56 O HETATM10122 O HOH A3142 -42.330 -29.693 -15.283 1.00 75.48 O HETATM10123 O HOH A3143 -38.380 -43.584 -36.294 1.00 45.84 O HETATM10124 O HOH A3144 -48.439 0.684 -48.884 1.00 80.69 O HETATM10125 O HOH A3145 -42.790 -34.622 -57.652 1.00 53.52 O HETATM10126 O HOH A3146 -14.651 -48.360 -41.720 1.00 48.19 O HETATM10127 O HOH A3147 -19.044 4.565 -70.926 1.00 72.33 O HETATM10128 O HOH A3148 -26.493 4.936 -72.018 1.00 98.98 O HETATM10129 O HOH A3149 -27.977 -43.252 -65.305 1.00 54.02 O HETATM10130 O HOH A3150 -88.115 -45.121 -30.642 1.00 69.79 O HETATM10131 O HOH A3151 -44.595 -23.327 -4.632 1.00 64.51 O HETATM10132 O HOH A3152 -85.174 -24.135 -59.187 1.00 68.89 O CONECT 355 9997 CONECT 370 9996 CONECT 549 9996 CONECT 845 9992 CONECT 866 9993 CONECT 1106 9993 CONECT 1123 9992 CONECT 9992 845 1123 9994 9995 CONECT 9993 866 1106 9994 9995 CONECT 9994 9992 9993 CONECT 9995 9992 9993 CONECT 9996 370 549 9998 9999 CONECT 9997 355 9998 9999 CONECT 9998 9996 9997 CONECT 9999 9996 9997 CONECT100001000110011 CONECT10001100001000210003 CONECT1000210001 CONECT100031000110004 CONECT10004100031000510010 CONECT1000510004 CONECT100061000710010 CONECT10007100061000810012 CONECT10008100071000910017 CONECT100091000810011 CONECT10010100041000610011 CONECT10011100001000910010 CONECT10012100071001310014 CONECT1001310012 CONECT10014100121001510016 CONECT1001510014 CONECT10016100141001710018 CONECT100171000810016 CONECT100181001610019 CONECT100191001810020 CONECT1002010019100211002210023 CONECT1002110020 CONECT1002210020 CONECT1002310020 CONECT1002410025100261002710076 CONECT1002510024 CONECT1002610024 CONECT100271002410028 CONECT100281002710029 CONECT10029100281003010031 CONECT100301002910035 CONECT10031100291003210033 CONECT1003210031 CONECT10033100311003410035 CONECT1003410033 CONECT10035100301003310036 CONECT10036100351003710045 CONECT100371003610038 CONECT100381003710039 CONECT10039100381004010045 CONECT10040100391004110042 CONECT1004110040 CONECT100421004010043 CONECT100431004210044 CONECT100441004310045 CONECT10045100361003910044 CONECT100461004710063 CONECT10047100461004810049 CONECT1004810047 CONECT100491004710050 CONECT10050100491005110052 CONECT1005110050 CONECT10052100501005310063 CONECT100531005210054 CONECT10054100531005510061 CONECT100551005410056 CONECT10056100551005710058 CONECT1005710056 CONECT10058100561005910060 CONECT1005910058 CONECT100601005810061 CONECT10061100541006010062 CONECT10062100611006310064 CONECT10063100461005210062 CONECT100641006210065 CONECT10065100641006610067 CONECT1006610065 CONECT10067100651006810069 CONECT1006810067 CONECT10069100671007010071 CONECT1007010069 CONECT100711006910072 CONECT100721007110073 CONECT1007310072100741007510076 CONECT1007410073 CONECT1007510073 CONECT100761002410073 CONECT10077100781007910080 CONECT1007810077 CONECT1007910077 CONECT1008010077 MASTER 394 0 5 54 48 0 17 610131 1 96 103 END