>>5FLM:HELIX  131 131 SER K   82  GLN K  113  1                                  32    
SPQEAFTNAITDLISELSLLEERFRVAIKDKQ
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 131 131 SER K 82 GLN K 113 1 32 ATOM 30427 N SER K 82 99.703 183.040 113.394 1.00118.72 N ATOM 30428 CA SER K 82 99.711 182.032 114.441 1.00118.72 C ATOM 30429 C SER K 82 100.207 180.701 113.885 1.00118.72 C ATOM 30430 O SER K 82 99.801 180.294 112.792 1.00118.72 O ATOM 30431 CB SER K 82 98.313 181.864 115.036 1.00120.29 C ATOM 30432 OG SER K 82 98.297 180.860 116.036 1.00120.29 O ATOM 30433 N PRO K 83 101.088 180.002 114.606 1.00116.47 N ATOM 30434 CA PRO K 83 101.581 178.713 114.092 1.00116.47 C ATOM 30435 C PRO K 83 100.499 177.654 113.997 1.00116.47 C ATOM 30436 O PRO K 83 100.598 176.741 113.168 1.00116.47 O ATOM 30437 CB PRO K 83 102.672 178.336 115.104 1.00114.97 C ATOM 30438 CG PRO K 83 102.268 179.028 116.353 1.00114.97 C ATOM 30439 CD PRO K 83 101.650 180.325 115.927 1.00114.97 C ATOM 30440 N GLN K 84 99.461 177.755 114.831 1.00115.88 N ATOM 30441 CA GLN K 84 98.320 176.855 114.705 1.00115.88 C ATOM 30442 C GLN K 84 97.662 177.002 113.340 1.00115.88 C ATOM 30443 O GLN K 84 97.251 176.009 112.727 1.00115.88 O ATOM 30444 CB GLN K 84 97.316 177.135 115.821 1.00125.29 C ATOM 30445 CG GLN K 84 97.851 176.852 117.212 1.00125.29 C ATOM 30446 CD GLN K 84 96.882 177.260 118.303 1.00125.29 C ATOM 30447 OE1 GLN K 84 96.029 178.124 118.100 1.00125.29 O ATOM 30448 NE2 GLN K 84 97.012 176.643 119.470 1.00125.29 N ATOM 30449 N GLU K 85 97.561 178.237 112.845 1.00114.80 N ATOM 30450 CA GLU K 85 97.029 178.466 111.507 1.00114.80 C ATOM 30451 C GLU K 85 97.930 177.844 110.449 1.00114.80 C ATOM 30452 O GLU K 85 97.452 177.328 109.433 1.00114.80 O ATOM 30453 CB GLU K 85 96.868 179.966 111.259 1.00124.56 C ATOM 30454 CG GLU K 85 95.830 180.638 112.141 1.00124.56 C ATOM 30455 CD GLU K 85 95.764 182.138 111.924 1.00124.56 C ATOM 30456 OE1 GLU K 85 96.649 182.682 111.231 1.00124.56 O ATOM 30457 OE2 GLU K 85 94.825 182.774 112.448 1.00124.56 O ATOM 30458 N ALA K 86 99.246 177.890 110.670 1.00111.26 N ATOM 30459 CA ALA K 86 100.172 177.261 109.735 1.00111.26 C ATOM 30460 C ALA K 86 99.995 175.750 109.721 1.00111.26 C ATOM 30461 O ALA K 86 100.121 175.111 108.671 1.00111.26 O ATOM 30462 CB ALA K 86 101.612 177.624 110.096 1.00110.68 C ATOM 30463 N PHE K 87 99.697 175.165 110.880 1.00109.03 N ATOM 30464 CA PHE K 87 99.541 173.717 110.973 1.00109.03 C ATOM 30465 C PHE K 87 98.228 173.272 110.333 1.00109.03 C ATOM 30466 O PHE K 87 98.190 172.295 109.571 1.00109.03 O ATOM 30467 CB PHE K 87 99.631 173.307 112.446 1.00109.08 C ATOM 30468 CG PHE K 87 99.623 171.826 112.685 1.00109.08 C ATOM 30469 CD1 PHE K 87 100.760 171.070 112.462 1.00109.08 C ATOM 30470 CD2 PHE K 87 98.504 171.201 113.199 1.00109.08 C ATOM 30471 CE1 PHE K 87 100.763 169.711 112.709 1.00109.08 C ATOM 30472 CE2 PHE K 87 98.500 169.843 113.444 1.00109.08 C ATOM 30473 CZ PHE K 87 99.633 169.096 113.199 1.00109.08 C ATOM 30474 N THR K 88 97.143 174.006 110.606 1.00110.23 N ATOM 30475 CA THR K 88 95.872 173.754 109.929 1.00110.23 C ATOM 30476 C THR K 88 96.020 173.876 108.418 1.00110.23 C ATOM 30477 O THR K 88 95.611 172.984 107.665 1.00110.23 O ATOM 30478 CB THR K 88 94.799 174.727 110.426 1.00111.34 C ATOM 30479 OG1 THR K 88 95.216 176.073 110.168 1.00111.34 O ATOM 30480 CG2 THR K 88 94.553 174.555 111.912 1.00111.34 C ATOM 30481 N ASN K 89 96.596 174.991 107.956 1.00110.24 N ATOM 30482 CA ASN K 89 96.804 175.189 106.526 1.00110.24 C ATOM 30483 C ASN K 89 97.649 174.072 105.932 1.00110.24 C ATOM 30484 O ASN K 89 97.409 173.633 104.800 1.00110.24 O ATOM 30485 CB ASN K 89 97.466 176.544 106.275 1.00110.39 C ATOM 30486 CG ASN K 89 96.549 177.703 106.586 1.00110.39 C ATOM 30487 OD1 ASN K 89 95.328 177.565 106.563 1.00110.39 O ATOM 30488 ND2 ASN K 89 97.133 178.855 106.888 1.00110.39 N ATOM 30489 N ALA K 90 98.643 173.596 106.685 1.00108.55 N ATOM 30490 CA ALA K 90 99.446 172.471 106.224 1.00108.55 C ATOM 30491 C ALA K 90 98.578 171.242 105.992 1.00108.55 C ATOM 30492 O ALA K 90 98.624 170.631 104.918 1.00108.55 O ATOM 30493 CB ALA K 90 100.556 172.167 107.228 1.00104.62 C ATOM 30494 N ILE K 91 97.759 170.877 106.983 1.00107.22 N ATOM 30495 CA ILE K 91 96.908 169.695 106.841 1.00107.22 C ATOM 30496 C ILE K 91 95.966 169.844 105.648 1.00107.22 C ATOM 30497 O ILE K 91 95.833 168.932 104.820 1.00107.22 O ATOM 30498 CB ILE K 91 96.136 169.427 108.144 1.00110.98 C ATOM 30499 CG1 ILE K 91 97.101 168.989 109.247 1.00110.98 C ATOM 30500 CG2 ILE K 91 95.056 168.387 107.922 1.00110.98 C ATOM 30501 CD1 ILE K 91 96.466 168.908 110.607 1.00110.98 C ATOM 30502 N THR K 92 95.306 171.002 105.538 1.00109.55 N ATOM 30503 CA THR K 92 94.374 171.222 104.433 1.00109.55 C ATOM 30504 C THR K 92 95.069 171.090 103.083 1.00109.55 C ATOM 30505 O THR K 92 94.536 170.464 102.157 1.00109.55 O ATOM 30506 CB THR K 92 93.717 172.597 104.560 1.00112.22 C ATOM 30507 OG1 THR K 92 94.727 173.613 104.555 1.00112.22 O ATOM 30508 CG2 THR K 92 92.917 172.691 105.850 1.00112.22 C ATOM 30509 N ASP K 93 96.265 171.671 102.955 1.00109.41 N ATOM 30510 CA ASP K 93 97.034 171.506 101.726 1.00109.41 C ATOM 30511 C ASP K 93 97.328 170.036 101.452 1.00109.41 C ATOM 30512 O ASP K 93 97.187 169.571 100.314 1.00109.41 O ATOM 30513 CB ASP K 93 98.334 172.305 101.811 1.00122.59 C ATOM 30514 CG ASP K 93 98.100 173.803 101.791 1.00122.59 C ATOM 30515 OD1 ASP K 93 96.992 174.232 101.405 1.00122.59 O ATOM 30516 OD2 ASP K 93 99.026 174.554 102.166 1.00122.59 O ATOM 30517 N LEU K 94 97.721 169.288 102.486 1.00105.87 N ATOM 30518 CA LEU K 94 98.031 167.871 102.314 1.00105.87 C ATOM 30519 C LEU K 94 96.836 167.107 101.757 1.00105.87 C ATOM 30520 O LEU K 94 96.976 166.301 100.827 1.00105.87 O ATOM 30521 CB LEU K 94 98.475 167.277 103.649 1.00105.46 C ATOM 30522 CG LEU K 94 99.773 167.864 104.195 1.00105.46 C ATOM 30523 CD1 LEU K 94 100.022 167.395 105.619 1.00105.46 C ATOM 30524 CD2 LEU K 94 100.933 167.514 103.279 1.00105.46 C ATOM 30525 N ILE K 95 95.648 167.345 102.318 1.00106.34 N ATOM 30526 CA ILE K 95 94.443 166.707 101.789 1.00106.34 C ATOM 30527 C ILE K 95 94.220 167.118 100.339 1.00106.34 C ATOM 30528 O ILE K 95 93.918 166.285 99.472 1.00106.34 O ATOM 30529 CB ILE K 95 93.227 167.046 102.668 1.00106.42 C ATOM 30530 CG1 ILE K 95 93.370 166.398 104.045 1.00106.42 C ATOM 30531 CG2 ILE K 95 91.939 166.604 101.998 1.00106.42 C ATOM 30532 CD1 ILE K 95 92.327 166.851 105.035 1.00106.42 C ATOM 30533 N SER K 96 94.387 168.415 100.051 1.00107.36 N ATOM 30534 CA SER K 96 94.205 168.906 98.689 1.00107.36 C ATOM 30535 C SER K 96 95.150 168.223 97.709 1.00107.36 C ATOM 30536 O SER K 96 94.826 168.090 96.523 1.00107.36 O ATOM 30537 CB SER K 96 94.405 170.422 98.645 1.00110.58 C ATOM 30538 OG SER K 96 93.423 171.089 99.419 1.00110.58 O ATOM 30539 N GLU K 97 96.323 167.794 98.175 1.00106.92 N ATOM 30540 CA GLU K 97 97.235 167.042 97.318 1.00106.92 C ATOM 30541 C GLU K 97 96.793 165.592 97.163 1.00106.92 C ATOM 30542 O GLU K 97 96.752 165.062 96.044 1.00106.92 O ATOM 30543 CB GLU K 97 98.655 167.102 97.881 1.00114.66 C ATOM 30544 CG GLU K 97 99.669 166.295 97.092 1.00114.66 C ATOM 30545 CD GLU K 97 101.067 166.392 97.671 1.00114.66 C ATOM 30546 OE1 GLU K 97 101.248 167.105 98.680 1.00114.66 O ATOM 30547 OE2 GLU K 97 101.984 165.743 97.126 1.00114.66 O ATOM 30548 N LEU K 98 96.454 164.934 98.329 1.00106.92 N ATOM 30549 CA LEU K 98 96.199 163.497 98.285 1.00106.92 C ATOM 30550 C LEU K 98 94.948 163.170 97.482 1.00106.92 C ATOM 30551 O LEU K 98 94.907 162.153 96.782 1.00106.92 O ATOM 30552 CB LEU K 98 96.098 162.922 99.695 1.00107.03 C ATOM 30553 CG LEU K 98 97.403 162.892 100.488 1.00107.03 C ATOM 30554 CD1 LEU K 98 97.158 162.349 101.874 1.00107.03 C ATOM 30555 CD2 LEU K 98 98.446 162.058 99.769 1.00107.03 C ATOM 30556 N SER K 99 93.913 164.008 97.570 1.00108.20 N ATOM 30557 CA SER K 99 92.719 163.754 96.767 1.00108.20 C ATOM 30558 C SER K 99 93.050 163.792 95.279 1.00108.20 C ATOM 30559 O SER K 99 92.660 162.897 94.514 1.00108.20 O ATOM 30560 CB SER K 99 91.629 164.770 97.104 1.00111.08 C ATOM 30561 OG SER K 99 92.018 166.081 96.741 1.00111.08 O ATOM 30562 N LEU K 100 93.789 164.820 94.855 1.00107.16 N ATOM 30563 CA LEU K 100 94.201 164.933 93.461 1.00107.16 C ATOM 30564 C LEU K 100 95.025 163.727 93.037 1.00107.16 C ATOM 30565 O LEU K 100 94.866 163.205 91.926 1.00107.16 O ATOM 30566 CB LEU K 100 94.992 166.226 93.265 1.00106.11 C ATOM 30567 CG LEU K 100 95.545 166.519 91.872 1.00106.11 C ATOM 30568 CD1 LEU K 100 94.407 166.688 90.883 1.00106.11 C ATOM 30569 CD2 LEU K 100 96.409 167.761 91.904 1.00106.11 C ATOM 30570 N LEU K 101 95.909 163.260 93.921 1.00106.57 N ATOM 30571 CA LEU K 101 96.722 162.095 93.589 1.00106.57 C ATOM 30572 C LEU K 101 95.861 160.847 93.429 1.00106.57 C ATOM 30573 O LEU K 101 96.101 160.032 92.529 1.00106.57 O ATOM 30574 CB LEU K 101 97.795 161.889 94.655 1.00100.85 C ATOM 30575 CG LEU K 101 98.707 160.684 94.459 1.00100.85 C ATOM 30576 CD1 LEU K 101 99.467 160.824 93.167 1.00100.85 C ATOM 30577 CD2 LEU K 101 99.669 160.578 95.616 1.00100.85 C ATOM 30578 N GLU K 102 94.849 160.681 94.288 1.00109.09 N ATOM 30579 CA GLU K 102 93.908 159.577 94.117 1.00109.09 C ATOM 30580 C GLU K 102 93.244 159.637 92.751 1.00109.09 C ATOM 30581 O GLU K 102 93.235 158.651 92.006 1.00109.09 O ATOM 30582 CB GLU K 102 92.834 159.600 95.204 1.00115.26 C ATOM 30583 CG GLU K 102 93.300 159.286 96.603 1.00115.26 C ATOM 30584 CD GLU K 102 92.158 159.331 97.604 1.00115.26 C ATOM 30585 OE1 GLU K 102 91.052 159.770 97.223 1.00115.26 O ATOM 30586 OE2 GLU K 102 92.363 158.925 98.767 1.00115.26 O ATOM 30587 N GLU K 103 92.682 160.804 92.395 1.00110.60 N ATOM 30588 CA GLU K 103 91.910 160.909 91.160 1.00110.60 C ATOM 30589 C GLU K 103 92.778 160.635 89.936 1.00110.60 C ATOM 30590 O GLU K 103 92.387 159.877 89.038 1.00110.60 O ATOM 30591 CB GLU K 103 91.260 162.289 91.075 1.00119.95 C ATOM 30592 CG GLU K 103 90.216 162.529 92.155 1.00119.95 C ATOM 30593 CD GLU K 103 89.652 163.934 92.123 1.00119.95 C ATOM 30594 OE1 GLU K 103 90.192 164.775 91.374 1.00119.95 O ATOM 30595 OE2 GLU K 103 88.672 164.198 92.851 1.00119.95 O ATOM 30596 N ARG K 104 93.969 161.238 89.886 1.00109.20 N ATOM 30597 CA ARG K 104 94.858 161.007 88.752 1.00109.20 C ATOM 30598 C ARG K 104 95.322 159.557 88.703 1.00109.20 C ATOM 30599 O ARG K 104 95.541 159.001 87.619 1.00109.20 O ATOM 30600 CB ARG K 104 96.054 161.957 88.818 1.00110.38 C ATOM 30601 CG ARG K 104 95.672 163.415 88.638 1.00110.38 C ATOM 30602 CD ARG K 104 96.881 164.335 88.632 1.00110.38 C ATOM 30603 NE ARG K 104 96.474 165.731 88.502 1.00110.38 N ATOM 30604 CZ ARG K 104 97.307 166.765 88.538 1.00110.38 C ATOM 30605 NH1 ARG K 104 98.608 166.571 88.696 1.00110.38 N ATOM 30606 NH2 ARG K 104 96.837 167.998 88.411 1.00110.38 N ATOM 30607 N PHE K 105 95.463 158.921 89.868 1.00107.37 N ATOM 30608 CA PHE K 105 95.833 157.510 89.888 1.00107.37 C ATOM 30609 C PHE K 105 94.701 156.638 89.354 1.00107.37 C ATOM 30610 O PHE K 105 94.951 155.619 88.699 1.00107.37 O ATOM 30611 CB PHE K 105 96.231 157.101 91.306 1.00104.35 C ATOM 30612 CG PHE K 105 96.626 155.661 91.436 1.00104.35 C ATOM 30613 CD1 PHE K 105 97.855 155.224 90.970 1.00104.35 C ATOM 30614 CD2 PHE K 105 95.791 154.754 92.061 1.00104.35 C ATOM 30615 CE1 PHE K 105 98.229 153.902 91.096 1.00104.35 C ATOM 30616 CE2 PHE K 105 96.161 153.433 92.194 1.00104.35 C ATOM 30617 CZ PHE K 105 97.381 153.006 91.712 1.00104.35 C ATOM 30618 N ARG K 106 93.449 157.032 89.606 1.00108.75 N ATOM 30619 CA ARG K 106 92.317 156.293 89.052 1.00108.75 C ATOM 30620 C ARG K 106 92.238 156.464 87.541 1.00108.75 C ATOM 30621 O ARG K 106 91.988 155.498 86.807 1.00108.75 O ATOM 30622 CB ARG K 106 91.017 156.743 89.717 1.00108.99 C ATOM 30623 CG ARG K 106 90.919 156.358 91.177 1.00108.99 C ATOM 30624 CD ARG K 106 89.590 156.765 91.782 1.00108.99 C ATOM 30625 NE ARG K 106 89.517 156.398 93.192 1.00108.99 N ATOM 30626 CZ ARG K 106 88.514 156.722 93.999 1.00108.99 C ATOM 30627 NH1 ARG K 106 87.490 157.425 93.537 1.00108.99 N ATOM 30628 NH2 ARG K 106 88.535 156.343 95.269 1.00108.99 N ATOM 30629 N VAL K 107 92.445 157.691 87.056 1.00110.97 N ATOM 30630 CA VAL K 107 92.496 157.916 85.612 1.00110.97 C ATOM 30631 C VAL K 107 93.587 157.058 84.986 1.00110.97 C ATOM 30632 O VAL K 107 93.395 156.443 83.929 1.00110.97 O ATOM 30633 CB VAL K 107 92.708 159.410 85.306 1.00109.81 C ATOM 30634 CG1 VAL K 107 92.878 159.627 83.810 1.00109.81 C ATOM 30635 CG2 VAL K 107 91.545 160.231 85.839 1.00109.81 C ATOM 30636 N ALA K 108 94.748 156.993 85.641 1.00111.18 N ATOM 30637 CA ALA K 108 95.845 156.184 85.119 1.00111.18 C ATOM 30638 C ALA K 108 95.485 154.702 85.098 1.00111.18 C ATOM 30639 O ALA K 108 95.827 153.989 84.147 1.00111.18 O ATOM 30640 CB ALA K 108 97.110 156.424 85.940 1.00107.71 C ATOM 30641 N ILE K 109 94.792 154.219 86.135 1.00113.10 N ATOM 30642 CA ILE K 109 94.337 152.827 86.139 1.00113.10 C ATOM 30643 C ILE K 109 93.420 152.566 84.954 1.00113.10 C ATOM 30644 O ILE K 109 93.642 151.643 84.161 1.00113.10 O ATOM 30645 CB ILE K 109 93.632 152.482 87.461 1.00112.87 C ATOM 30646 CG1 ILE K 109 94.627 152.415 88.609 1.00112.87 C ATOM 30647 CG2 ILE K 109 92.887 151.161 87.343 1.00112.87 C ATOM 30648 CD1 ILE K 109 93.951 152.267 89.939 1.00112.87 C ATOM 30649 N LYS K 110 92.365 153.374 84.824 1.00115.88 N ATOM 30650 CA LYS K 110 91.387 153.143 83.766 1.00115.88 C ATOM 30651 C LYS K 110 92.003 153.301 82.383 1.00115.88 C ATOM 30652 O LYS K 110 91.486 152.746 81.407 1.00115.88 O ATOM 30653 CB LYS K 110 90.203 154.092 83.934 1.00116.96 C ATOM 30654 CG LYS K 110 89.387 153.840 85.190 1.00116.96 C ATOM 30655 CD LYS K 110 88.288 154.876 85.353 1.00116.96 C ATOM 30656 CE LYS K 110 87.472 154.609 86.605 1.00116.96 C ATOM 30657 NZ LYS K 110 86.434 155.652 86.821 1.00116.96 N ATOM 30658 N ASP K 111 93.103 154.051 82.276 1.00119.55 N ATOM 30659 CA ASP K 111 93.779 154.189 80.990 1.00119.55 C ATOM 30660 C ASP K 111 94.652 152.976 80.691 1.00119.55 C ATOM 30661 O ASP K 111 94.699 152.502 79.551 1.00119.55 O ATOM 30662 CB ASP K 111 94.607 155.474 80.964 1.00125.21 C ATOM 30663 CG ASP K 111 93.745 156.717 80.892 1.00125.21 C ATOM 30664 OD1 ASP K 111 92.547 156.584 80.567 1.00125.21 O ATOM 30665 OD2 ASP K 111 94.261 157.824 81.154 1.00125.21 O ATOM 30666 N LYS K 112 95.358 152.461 81.700 1.00119.49 N ATOM 30667 CA LYS K 112 96.238 151.321 81.462 1.00119.49 C ATOM 30668 C LYS K 112 95.461 150.072 81.060 1.00119.49 C ATOM 30669 O LYS K 112 96.032 149.167 80.443 1.00119.49 O ATOM 30670 CB LYS K 112 97.094 151.052 82.703 1.00113.14 C ATOM 30671 CG LYS K 112 98.068 149.895 82.554 1.00113.14 C ATOM 30672 CD LYS K 112 99.040 150.146 81.414 1.00113.14 C ATOM 30673 CE LYS K 112 100.083 149.046 81.323 1.00113.14 C ATOM 30674 NZ LYS K 112 100.916 149.168 80.095 1.00113.14 N ATOM 30675 N GLN K 113 94.170 150.008 81.375 1.00124.05 N ATOM 30676 CA GLN K 113 93.321 148.886 80.993 1.00124.05 C ATOM 30677 C GLN K 113 92.472 149.307 79.798 1.00124.05 C ATOM 30678 O GLN K 113 91.553 150.118 79.939 1.00124.05 O ATOM 30679 CB GLN K 113 92.447 148.452 82.168 1.00121.71 C ATOM 30680 CG GLN K 113 93.229 147.884 83.341 1.00121.71 C ATOM 30681 CD GLN K 113 92.345 147.552 84.526 1.00121.71 C ATOM 30682 OE1 GLN K 113 91.266 148.123 84.690 1.00121.71 O ATOM 30683 NE2 GLN K 113 92.799 146.626 85.362 1.00121.71 N