>>5FLM:HELIX   30  30 THR A  832  GLU A  869  1                                  38    
TPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSME
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 30 30 THR A 832 GLU A 869 1 38 ATOM 6212 N THR A 832 147.161 129.770 106.415 1.00 97.33 N ATOM 6213 CA THR A 832 147.428 128.381 106.071 1.00 97.33 C ATOM 6214 C THR A 832 147.166 127.511 107.295 1.00 97.33 C ATOM 6215 O THR A 832 147.030 128.031 108.409 1.00 97.33 O ATOM 6216 CB THR A 832 148.864 128.221 105.566 1.00100.95 C ATOM 6217 OG1 THR A 832 149.793 128.649 106.562 1.00100.95 O ATOM 6218 CG2 THR A 832 149.072 129.053 104.300 1.00100.95 C ATOM 6219 N PRO A 833 147.093 126.182 107.137 1.00 95.24 N ATOM 6220 CA PRO A 833 146.777 125.334 108.301 1.00 95.24 C ATOM 6221 C PRO A 833 147.785 125.424 109.438 1.00 95.24 C ATOM 6222 O PRO A 833 147.385 125.570 110.600 1.00 95.24 O ATOM 6223 CB PRO A 833 146.719 123.927 107.697 1.00 92.42 C ATOM 6224 CG PRO A 833 146.353 124.140 106.273 1.00 92.42 C ATOM 6225 CD PRO A 833 147.064 125.405 105.880 1.00 92.42 C ATOM 6226 N THR A 834 149.084 125.340 109.142 1.00 93.93 N ATOM 6227 CA THR A 834 150.078 125.376 110.212 1.00 93.93 C ATOM 6228 C THR A 834 150.096 126.741 110.887 1.00 93.93 C ATOM 6229 O THR A 834 150.250 126.843 112.111 1.00 93.93 O ATOM 6230 CB THR A 834 151.464 125.022 109.670 1.00 95.09 C ATOM 6231 OG1 THR A 834 151.833 125.943 108.637 1.00 95.09 O ATOM 6232 CG2 THR A 834 151.472 123.612 109.108 1.00 95.09 C ATOM 6233 N GLU A 835 149.934 127.804 110.100 1.00 97.12 N ATOM 6234 CA GLU A 835 149.819 129.142 110.667 1.00 97.12 C ATOM 6235 C GLU A 835 148.537 129.283 111.477 1.00 97.12 C ATOM 6236 O GLU A 835 148.478 130.065 112.432 1.00 97.12 O ATOM 6237 CB GLU A 835 149.879 130.177 109.546 1.00102.98 C ATOM 6238 CG GLU A 835 151.222 130.227 108.830 1.00102.98 C ATOM 6239 CD GLU A 835 151.212 131.149 107.626 1.00102.98 C ATOM 6240 OE1 GLU A 835 150.119 131.611 107.238 1.00102.98 O ATOM 6241 OE2 GLU A 835 152.297 131.405 107.063 1.00102.98 O ATOM 6242 N PHE A 836 147.503 128.520 111.118 1.00 94.47 N ATOM 6243 CA PHE A 836 146.263 128.546 111.887 1.00 94.47 C ATOM 6244 C PHE A 836 146.445 127.873 113.242 1.00 94.47 C ATOM 6245 O PHE A 836 145.948 128.363 114.264 1.00 94.47 O ATOM 6246 CB PHE A 836 145.142 127.873 111.097 1.00 93.20 C ATOM 6247 CG PHE A 836 143.850 127.770 111.849 1.00 93.20 C ATOM 6248 CD1 PHE A 836 143.008 128.861 111.955 1.00 93.20 C ATOM 6249 CD2 PHE A 836 143.474 126.581 112.445 1.00 93.20 C ATOM 6250 CE1 PHE A 836 141.818 128.768 112.648 1.00 93.20 C ATOM 6251 CE2 PHE A 836 142.285 126.483 113.139 1.00 93.20 C ATOM 6252 CZ PHE A 836 141.458 127.577 113.240 1.00 93.20 C ATOM 6253 N PHE A 837 147.158 126.746 113.271 1.00 94.22 N ATOM 6254 CA PHE A 837 147.402 126.062 114.537 1.00 94.22 C ATOM 6255 C PHE A 837 148.326 126.882 115.431 1.00 94.22 C ATOM 6256 O PHE A 837 148.065 127.045 116.630 1.00 94.22 O ATOM 6257 CB PHE A 837 147.987 124.675 114.281 1.00 92.59 C ATOM 6258 CG PHE A 837 148.287 123.907 115.530 1.00 92.59 C ATOM 6259 CD1 PHE A 837 147.270 123.289 116.233 1.00 92.59 C ATOM 6260 CD2 PHE A 837 149.584 123.788 115.996 1.00 92.59 C ATOM 6261 CE1 PHE A 837 147.536 122.581 117.384 1.00 92.59 C ATOM 6262 CE2 PHE A 837 149.856 123.076 117.147 1.00 92.59 C ATOM 6263 CZ PHE A 837 148.830 122.473 117.840 1.00 92.59 C ATOM 6264 N PHE A 838 149.418 127.401 114.863 1.00 94.79 N ATOM 6265 CA PHE A 838 150.288 128.306 115.610 1.00 94.79 C ATOM 6266 C PHE A 838 149.506 129.503 116.132 1.00 94.79 C ATOM 6267 O PHE A 838 149.746 129.988 117.244 1.00 94.79 O ATOM 6268 CB PHE A 838 151.444 128.774 114.726 1.00 96.80 C ATOM 6269 CG PHE A 838 152.370 127.676 114.311 1.00 96.80 C ATOM 6270 CD1 PHE A 838 152.453 126.511 115.046 1.00 96.80 C ATOM 6271 CD2 PHE A 838 153.145 127.800 113.174 1.00 96.80 C ATOM 6272 CE1 PHE A 838 153.300 125.500 114.666 1.00 96.80 C ATOM 6273 CE2 PHE A 838 153.995 126.787 112.788 1.00 96.80 C ATOM 6274 CZ PHE A 838 154.073 125.637 113.535 1.00 96.80 C ATOM 6275 N HIS A 839 148.559 129.991 115.331 1.00 94.79 N ATOM 6276 CA HIS A 839 147.722 131.106 115.755 1.00 94.79 C ATOM 6277 C HIS A 839 146.852 130.722 116.945 1.00 94.79 C ATOM 6278 O HIS A 839 146.687 131.509 117.887 1.00 94.79 O ATOM 6279 CB HIS A 839 146.865 131.570 114.578 1.00 98.10 C ATOM 6280 CG HIS A 839 146.010 132.758 114.882 1.00 98.10 C ATOM 6281 ND1 HIS A 839 146.535 133.974 115.257 1.00 98.10 N ATOM 6282 CD2 HIS A 839 144.667 132.920 114.852 1.00 98.10 C ATOM 6283 CE1 HIS A 839 145.551 134.833 115.454 1.00 98.10 C ATOM 6284 NE2 HIS A 839 144.407 134.219 115.214 1.00 98.10 N ATOM 6285 N ALA A 840 146.288 129.511 116.920 1.00 94.57 N ATOM 6286 CA ALA A 840 145.505 129.032 118.056 1.00 94.57 C ATOM 6287 C ALA A 840 146.365 128.935 119.309 1.00 94.57 C ATOM 6288 O ALA A 840 145.931 129.306 120.407 1.00 94.57 O ATOM 6289 CB ALA A 840 144.876 127.679 117.724 1.00 93.57 C ATOM 6290 N MET A 841 147.596 128.434 119.162 1.00 96.49 N ATOM 6291 CA MET A 841 148.541 128.451 120.275 1.00 96.49 C ATOM 6292 C MET A 841 148.759 129.869 120.785 1.00 96.49 C ATOM 6293 O MET A 841 148.861 130.095 121.997 1.00 96.49 O ATOM 6294 CB MET A 841 149.873 127.834 119.848 1.00101.00 C ATOM 6295 CG MET A 841 149.823 126.345 119.570 1.00101.00 C ATOM 6296 SD MET A 841 151.386 125.702 118.944 1.00101.00 S ATOM 6297 CE MET A 841 152.415 125.828 120.403 1.00101.00 C ATOM 6298 N GLY A 842 148.827 130.839 119.873 1.00 99.86 N ATOM 6299 CA GLY A 842 149.056 132.213 120.286 1.00 99.86 C ATOM 6300 C GLY A 842 147.879 132.801 121.040 1.00 99.86 C ATOM 6301 O GLY A 842 148.050 133.643 121.925 1.00 99.86 O ATOM 6302 N GLY A 843 146.664 132.367 120.698 1.00100.73 N ATOM 6303 CA GLY A 843 145.492 132.867 121.400 1.00100.73 C ATOM 6304 C GLY A 843 145.252 132.184 122.733 1.00100.73 C ATOM 6305 O GLY A 843 144.720 132.799 123.666 1.00100.73 O ATOM 6306 N ARG A 844 145.638 130.909 122.843 1.00106.94 N ATOM 6307 CA ARG A 844 145.435 130.175 124.088 1.00106.94 C ATOM 6308 C ARG A 844 146.127 130.865 125.258 1.00106.94 C ATOM 6309 O ARG A 844 145.585 130.914 126.368 1.00106.94 O ATOM 6310 CB ARG A 844 145.936 128.740 123.935 1.00104.63 C ATOM 6311 CG ARG A 844 145.737 127.874 125.163 1.00104.63 C ATOM 6312 CD ARG A 844 144.276 127.805 125.563 1.00104.63 C ATOM 6313 NE ARG A 844 143.439 127.279 124.489 1.00104.63 N ATOM 6314 CZ ARG A 844 143.232 125.985 124.274 1.00104.63 C ATOM 6315 NH1 ARG A 844 143.803 125.082 125.059 1.00104.63 N ATOM 6316 NH2 ARG A 844 142.455 125.592 123.275 1.00104.63 N ATOM 6317 N GLU A 845 147.323 131.410 125.026 1.00112.31 N ATOM 6318 CA GLU A 845 148.021 132.136 126.081 1.00112.31 C ATOM 6319 C GLU A 845 147.228 133.361 126.521 1.00112.31 C ATOM 6320 O GLU A 845 147.193 133.695 127.711 1.00112.31 O ATOM 6321 CB GLU A 845 149.417 132.537 125.604 1.00121.74 C ATOM 6322 CG GLU A 845 150.254 133.254 126.653 1.00121.74 C ATOM 6323 CD GLU A 845 151.641 133.610 126.152 1.00121.74 C ATOM 6324 OE1 GLU A 845 151.939 133.333 124.972 1.00121.74 O ATOM 6325 OE2 GLU A 845 152.433 134.168 126.939 1.00121.74 O ATOM 6326 N GLY A 846 146.577 134.037 125.573 1.00111.56 N ATOM 6327 CA GLY A 846 145.758 135.184 125.930 1.00111.56 C ATOM 6328 C GLY A 846 144.558 134.797 126.770 1.00111.56 C ATOM 6329 O GLY A 846 144.265 135.430 127.790 1.00111.56 O ATOM 6330 N LEU A 847 143.845 133.747 126.354 1.00110.90 N ATOM 6331 CA LEU A 847 142.704 133.276 127.138 1.00110.90 C ATOM 6332 C LEU A 847 143.137 132.860 128.539 1.00110.90 C ATOM 6333 O LEU A 847 142.466 133.173 129.531 1.00110.90 O ATOM 6334 CB LEU A 847 142.013 132.111 126.427 1.00104.79 C ATOM 6335 CG LEU A 847 140.958 132.392 125.358 1.00104.79 C ATOM 6336 CD1 LEU A 847 141.568 133.050 124.136 1.00104.79 C ATOM 6337 CD2 LEU A 847 140.263 131.100 124.974 1.00104.79 C ATOM 6338 N ILE A 848 144.265 132.155 128.638 1.00114.96 N ATOM 6339 CA ILE A 848 144.738 131.677 129.935 1.00114.96 C ATOM 6340 C ILE A 848 145.112 132.849 130.833 1.00114.96 C ATOM 6341 O ILE A 848 144.770 132.873 132.020 1.00114.96 O ATOM 6342 CB ILE A 848 145.912 130.701 129.751 1.00111.15 C ATOM 6343 CG1 ILE A 848 145.417 129.410 129.105 1.00111.15 C ATOM 6344 CG2 ILE A 848 146.586 130.414 131.082 1.00111.15 C ATOM 6345 CD1 ILE A 848 146.518 128.497 128.655 1.00111.15 C ATOM 6346 N ASP A 849 145.818 133.840 130.284 1.00121.69 N ATOM 6347 CA ASP A 849 146.135 135.031 131.067 1.00121.69 C ATOM 6348 C ASP A 849 144.864 135.715 131.556 1.00121.69 C ATOM 6349 O ASP A 849 144.758 136.094 132.730 1.00121.69 O ATOM 6350 CB ASP A 849 146.987 135.997 130.243 1.00128.75 C ATOM 6351 CG ASP A 849 148.400 135.493 130.037 1.00128.75 C ATOM 6352 OD1 ASP A 849 148.817 134.575 130.772 1.00128.75 O ATOM 6353 OD2 ASP A 849 149.095 136.018 129.141 1.00128.75 O ATOM 6354 N THR A 850 143.879 135.863 130.665 1.00122.21 N ATOM 6355 CA THR A 850 142.610 136.481 131.042 1.00122.21 C ATOM 6356 C THR A 850 141.949 135.738 132.197 1.00122.21 C ATOM 6357 O THR A 850 141.447 136.356 133.143 1.00122.21 O ATOM 6358 CB THR A 850 141.674 136.531 129.833 1.00122.46 C ATOM 6359 OG1 THR A 850 142.256 137.344 128.807 1.00122.46 O ATOM 6360 CG2 THR A 850 140.316 137.100 130.226 1.00122.46 C ATOM 6361 N ALA A 851 141.947 134.404 132.143 1.00123.05 N ATOM 6362 CA ALA A 851 141.271 133.634 133.183 1.00123.05 C ATOM 6363 C ALA A 851 142.045 133.662 134.497 1.00123.05 C ATOM 6364 O ALA A 851 141.443 133.731 135.575 1.00123.05 O ATOM 6365 CB ALA A 851 141.063 132.193 132.718 1.00120.77 C ATOM 6366 N VAL A 852 143.375 133.611 134.431 1.00127.02 N ATOM 6367 CA VAL A 852 144.181 133.440 135.636 1.00127.02 C ATOM 6368 C VAL A 852 144.343 134.757 136.385 1.00127.02 C ATOM 6369 O VAL A 852 144.308 134.788 137.621 1.00127.02 O ATOM 6370 CB VAL A 852 145.544 132.818 135.279 1.00127.08 C ATOM 6371 CG1 VAL A 852 146.455 132.783 136.495 1.00127.08 C ATOM 6372 CG2 VAL A 852 145.353 131.412 134.736 1.00127.08 C ATOM 6373 N LYS A 853 144.517 135.868 135.659 1.00133.36 N ATOM 6374 CA LYS A 853 144.871 137.118 136.329 1.00133.36 C ATOM 6375 C LYS A 853 143.761 137.613 137.249 1.00133.36 C ATOM 6376 O LYS A 853 144.045 138.232 138.282 1.00133.36 O ATOM 6377 CB LYS A 853 145.214 138.199 135.301 1.00136.53 C ATOM 6378 CG LYS A 853 144.050 138.641 134.429 1.00136.53 C ATOM 6379 CD LYS A 853 144.486 139.702 133.438 1.00136.53 C ATOM 6380 CE LYS A 853 143.342 140.123 132.532 1.00136.53 C ATOM 6381 NZ LYS A 853 143.773 141.143 131.536 1.00136.53 N ATOM 6382 N THR A 854 142.499 137.331 136.908 1.00135.07 N ATOM 6383 CA THR A 854 141.377 137.954 137.606 1.00135.07 C ATOM 6384 C THR A 854 141.369 137.609 139.091 1.00135.07 C ATOM 6385 O THR A 854 141.097 138.474 139.934 1.00135.07 O ATOM 6386 CB THR A 854 140.059 137.536 136.954 1.00133.19 C ATOM 6387 OG1 THR A 854 139.952 136.107 136.958 1.00133.19 O ATOM 6388 CG2 THR A 854 139.985 138.045 135.523 1.00133.19 C ATOM 6389 N ALA A 855 141.668 136.355 139.433 1.00134.18 N ATOM 6390 CA ALA A 855 141.623 135.934 140.830 1.00134.18 C ATOM 6391 C ALA A 855 142.692 136.643 141.653 1.00134.18 C ATOM 6392 O ALA A 855 142.420 137.153 142.747 1.00134.18 O ATOM 6393 CB ALA A 855 141.783 134.417 140.923 1.00133.94 C ATOM 6394 N GLU A 856 143.923 136.684 141.136 1.00134.69 N ATOM 6395 CA GLU A 856 145.000 137.355 141.856 1.00134.69 C ATOM 6396 C GLU A 856 144.730 138.849 141.987 1.00134.69 C ATOM 6397 O GLU A 856 144.987 139.442 143.042 1.00134.69 O ATOM 6398 CB GLU A 856 146.336 137.110 141.155 1.00141.04 C ATOM 6399 CG GLU A 856 146.806 135.664 141.195 1.00141.04 C ATOM 6400 CD GLU A 856 148.117 135.458 140.462 1.00141.04 C ATOM 6401 OE1 GLU A 856 148.570 136.395 139.771 1.00141.04 O ATOM 6402 OE2 GLU A 856 148.696 134.358 140.579 1.00141.04 O ATOM 6403 N THR A 857 144.205 139.473 140.931 1.00134.13 N ATOM 6404 CA THR A 857 143.899 140.900 140.992 1.00134.13 C ATOM 6405 C THR A 857 142.823 141.187 142.034 1.00134.13 C ATOM 6406 O THR A 857 142.941 142.130 142.825 1.00134.13 O ATOM 6407 CB THR A 857 143.466 141.408 139.618 1.00137.53 C ATOM 6408 OG1 THR A 857 142.319 140.672 139.173 1.00137.53 O ATOM 6409 CG2 THR A 857 144.592 141.248 138.613 1.00137.53 C ATOM 6410 N GLY A 858 141.760 140.380 142.047 1.00131.38 N ATOM 6411 CA GLY A 858 140.704 140.588 143.027 1.00131.38 C ATOM 6412 C GLY A 858 141.167 140.339 144.450 1.00131.38 C ATOM 6413 O GLY A 858 140.748 141.032 145.382 1.00131.38 O ATOM 6414 N TYR A 859 142.041 139.350 144.638 1.00128.92 N ATOM 6415 CA TYR A 859 142.542 139.045 145.974 1.00128.92 C ATOM 6416 C TYR A 859 143.462 140.155 146.480 1.00128.92 C ATOM 6417 O TYR A 859 143.386 140.558 147.648 1.00128.92 O ATOM 6418 CB TYR A 859 143.244 137.686 145.950 1.00135.38 C ATOM 6419 CG TYR A 859 143.889 137.255 147.245 1.00135.38 C ATOM 6420 CD1 TYR A 859 143.117 136.910 148.347 1.00135.38 C ATOM 6421 CD2 TYR A 859 145.266 137.120 147.344 1.00135.38 C ATOM 6422 CE1 TYR A 859 143.702 136.496 149.527 1.00135.38 C ATOM 6423 CE2 TYR A 859 145.861 136.695 148.515 1.00135.38 C ATOM 6424 CZ TYR A 859 145.075 136.390 149.605 1.00135.38 C ATOM 6425 OH TYR A 859 145.665 135.973 150.776 1.00135.38 O ATOM 6426 N ILE A 860 144.324 140.679 145.603 1.00124.89 N ATOM 6427 CA ILE A 860 145.157 141.825 145.967 1.00124.89 C ATOM 6428 C ILE A 860 144.284 143.030 146.297 1.00124.89 C ATOM 6429 O ILE A 860 144.524 143.746 147.277 1.00124.89 O ATOM 6430 CB ILE A 860 146.155 142.145 144.840 1.00124.75 C ATOM 6431 CG1 ILE A 860 147.179 141.021 144.691 1.00124.75 C ATOM 6432 CG2 ILE A 860 146.854 143.470 145.095 1.00124.75 C ATOM 6433 CD1 ILE A 860 148.044 141.164 143.461 1.00124.75 C ATOM 6434 N GLN A 861 143.260 143.274 145.474 1.00123.31 N ATOM 6435 CA GLN A 861 142.293 144.330 145.758 1.00123.31 C ATOM 6436 C GLN A 861 141.713 144.183 147.158 1.00123.31 C ATOM 6437 O GLN A 861 141.689 145.142 147.942 1.00123.31 O ATOM 6438 CB GLN A 861 141.176 144.298 144.713 1.00124.74 C ATOM 6439 CG GLN A 861 140.083 145.343 144.908 1.00124.74 C ATOM 6440 CD GLN A 861 140.542 146.757 144.620 1.00124.74 C ATOM 6441 OE1 GLN A 861 140.877 147.514 145.531 1.00124.74 O ATOM 6442 NE2 GLN A 861 140.535 147.130 143.346 1.00124.74 N ATOM 6443 N ARG A 862 141.250 142.976 147.493 1.00124.19 N ATOM 6444 CA ARG A 862 140.659 142.751 148.807 1.00124.19 C ATOM 6445 C ARG A 862 141.661 143.034 149.917 1.00124.19 C ATOM 6446 O ARG A 862 141.333 143.694 150.906 1.00124.19 O ATOM 6447 CB ARG A 862 140.134 141.321 148.923 1.00128.25 C ATOM 6448 CG ARG A 862 139.500 141.040 150.271 1.00128.25 C ATOM 6449 CD ARG A 862 139.025 139.606 150.383 1.00128.25 C ATOM 6450 NE ARG A 862 138.375 139.361 151.665 1.00128.25 N ATOM 6451 CZ ARG A 862 139.022 139.049 152.782 1.00128.25 C ATOM 6452 NH1 ARG A 862 140.344 138.948 152.779 1.00128.25 N ATOM 6453 NH2 ARG A 862 138.347 138.847 153.905 1.00128.25 N ATOM 6454 N ARG A 863 142.892 142.543 149.768 1.00121.90 N ATOM 6455 CA ARG A 863 143.902 142.754 150.802 1.00121.90 C ATOM 6456 C ARG A 863 144.179 144.240 151.010 1.00121.90 C ATOM 6457 O ARG A 863 144.267 144.714 152.151 1.00121.90 O ATOM 6458 CB ARG A 863 145.177 142.000 150.431 1.00131.85 C ATOM 6459 CG ARG A 863 144.977 140.498 150.411 1.00131.85 C ATOM 6460 CD ARG A 863 146.151 139.759 149.792 1.00131.85 C ATOM 6461 NE ARG A 863 147.394 139.857 150.546 1.00131.85 N ATOM 6462 CZ ARG A 863 148.545 139.332 150.138 1.00131.85 C ATOM 6463 NH1 ARG A 863 148.601 138.671 148.988 1.00131.85 N ATOM 6464 NH2 ARG A 863 149.637 139.458 150.878 1.00131.85 N ATOM 6465 N LEU A 864 144.306 144.993 149.915 1.00119.65 N ATOM 6466 CA LEU A 864 144.516 146.435 150.023 1.00119.65 C ATOM 6467 C LEU A 864 143.362 147.104 150.759 1.00119.65 C ATOM 6468 O LEU A 864 143.576 147.920 151.666 1.00119.65 O ATOM 6469 CB LEU A 864 144.687 147.050 148.634 1.00121.35 C ATOM 6470 CG LEU A 864 145.924 146.657 147.827 1.00121.35 C ATOM 6471 CD1 LEU A 864 145.851 147.244 146.428 1.00121.35 C ATOM 6472 CD2 LEU A 864 147.193 147.109 148.528 1.00121.35 C ATOM 6473 N ILE A 865 142.125 146.768 150.382 1.00118.46 N ATOM 6474 CA ILE A 865 140.968 147.400 151.011 1.00118.46 C ATOM 6475 C ILE A 865 140.910 147.061 152.496 1.00118.46 C ATOM 6476 O ILE A 865 140.629 147.926 153.333 1.00118.46 O ATOM 6477 CB ILE A 865 139.673 146.991 150.287 1.00119.45 C ATOM 6478 CG1 ILE A 865 139.669 147.535 148.858 1.00119.45 C ATOM 6479 CG2 ILE A 865 138.461 147.500 151.043 1.00119.45 C ATOM 6480 CD1 ILE A 865 138.543 147.001 148.005 1.00119.45 C ATOM 6481 N LYS A 866 141.183 145.802 152.848 1.00119.21 N ATOM 6482 CA LYS A 866 141.153 145.403 154.250 1.00119.21 C ATOM 6483 C LYS A 866 142.229 146.108 155.060 1.00119.21 C ATOM 6484 O LYS A 866 142.005 146.441 156.229 1.00119.21 O ATOM 6485 CB LYS A 866 141.316 143.889 154.379 1.00126.16 C ATOM 6486 CG LYS A 866 140.233 143.078 153.695 1.00126.16 C ATOM 6487 CD LYS A 866 138.864 143.436 154.228 1.00126.16 C ATOM 6488 CE LYS A 866 138.676 142.891 155.628 1.00126.16 C ATOM 6489 NZ LYS A 866 137.300 143.127 156.134 1.00126.16 N ATOM 6490 N SER A 867 143.401 146.344 154.466 1.00117.86 N ATOM 6491 CA SER A 867 144.465 147.010 155.212 1.00117.86 C ATOM 6492 C SER A 867 144.193 148.504 155.363 1.00117.86 C ATOM 6493 O SER A 867 144.500 149.090 156.408 1.00117.86 O ATOM 6494 CB SER A 867 145.812 146.775 154.534 1.00123.57 C ATOM 6495 OG SER A 867 145.843 147.351 153.243 1.00123.57 O ATOM 6496 N MET A 868 143.614 149.136 154.343 1.00117.80 N ATOM 6497 CA MET A 868 143.405 150.579 154.350 1.00117.80 C ATOM 6498 C MET A 868 142.051 151.014 154.894 1.00117.80 C ATOM 6499 O MET A 868 141.837 152.217 155.060 1.00117.80 O ATOM 6500 CB MET A 868 143.551 151.145 152.936 1.00123.29 C ATOM 6501 CG MET A 868 144.943 151.161 152.351 1.00123.29 C ATOM 6502 SD MET A 868 144.823 151.884 150.705 1.00123.29 S ATOM 6503 CE MET A 868 146.522 151.850 150.165 1.00123.29 C ATOM 6504 N GLU A 869 141.147 150.079 155.198 1.00116.23 N ATOM 6505 CA GLU A 869 139.727 150.417 155.283 1.00116.23 C ATOM 6506 C GLU A 869 139.428 151.539 156.271 1.00116.23 C ATOM 6507 O GLU A 869 138.485 152.309 156.062 1.00116.23 O ATOM 6508 CB GLU A 869 138.906 149.177 155.647 1.00129.55 C ATOM 6509 CG GLU A 869 139.207 148.593 157.013 1.00129.55 C ATOM 6510 CD GLU A 869 138.395 147.345 157.290 1.00129.55 C ATOM 6511 OE1 GLU A 869 137.392 147.123 156.581 1.00129.55 O ATOM 6512 OE2 GLU A 869 138.754 146.592 158.217 1.00129.55 O