>>5FLZ:HELIX   43  43 PRO B  577  ASP B  609  1                                  33    
PFGRKEYLRIFNFLWRFKKNNYFYQKEMLKSND
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 43 43 PRO B 577 ASP B 609 1 33 ATOM 8007 N PRO B 577 -98.789 0.884 10.754 1.00 0.00 N ATOM 8008 CA PRO B 577 -98.455 0.880 12.175 1.00 0.00 C ATOM 8009 C PRO B 577 -99.147 -0.378 12.642 1.00 0.00 C ATOM 8010 O PRO B 577 -99.903 -0.325 13.608 1.00 0.00 O ATOM 8011 CB PRO B 577 -98.964 2.178 12.755 1.00 0.00 C ATOM 8012 CG PRO B 577 -100.178 2.448 11.914 1.00 0.00 C ATOM 8013 CD PRO B 577 -99.737 1.969 10.487 1.00 0.00 C ATOM 8014 N PHE B 578 -98.831 -1.561 12.087 1.00 0.00 N ATOM 8015 CA PHE B 578 -99.348 -2.881 12.374 1.00 0.00 C ATOM 8016 C PHE B 578 -99.109 -3.310 13.818 1.00 0.00 C ATOM 8017 O PHE B 578 -100.078 -3.779 14.433 1.00 0.00 O ATOM 8018 CB PHE B 578 -98.668 -3.992 11.508 1.00 0.00 C ATOM 8019 CG PHE B 578 -99.689 -5.005 11.309 1.00 0.00 C ATOM 8020 CD1 PHE B 578 -100.755 -4.916 10.385 1.00 0.00 C ATOM 8021 CD2 PHE B 578 -99.586 -6.261 11.980 1.00 0.00 C ATOM 8022 CE1 PHE B 578 -101.662 -6.001 10.122 1.00 0.00 C ATOM 8023 CE2 PHE B 578 -100.487 -7.265 11.765 1.00 0.00 C ATOM 8024 CZ PHE B 578 -101.453 -7.187 10.781 1.00 0.00 C ATOM 8025 N GLY B 579 -97.867 -3.170 14.349 1.00 0.00 N ATOM 8026 CA GLY B 579 -97.433 -3.675 15.703 1.00 0.00 C ATOM 8027 C GLY B 579 -98.255 -3.083 16.824 1.00 0.00 C ATOM 8028 O GLY B 579 -98.740 -3.849 17.647 1.00 0.00 O ATOM 8029 N ARG B 580 -98.456 -1.738 16.692 1.00 0.00 N ATOM 8030 CA ARG B 580 -99.324 -0.952 17.570 1.00 0.00 C ATOM 8031 C ARG B 580 -100.856 -1.314 17.486 1.00 0.00 C ATOM 8032 O ARG B 580 -101.377 -1.507 18.534 1.00 0.00 O ATOM 8033 CB ARG B 580 -99.348 0.457 17.075 1.00 0.00 C ATOM 8034 CG ARG B 580 -97.952 1.049 16.755 1.00 0.00 C ATOM 8035 CD ARG B 580 -96.934 0.840 17.859 1.00 0.00 C ATOM 8036 NE ARG B 580 -96.051 -0.231 17.389 1.00 0.00 N ATOM 8037 CZ ARG B 580 -95.657 -1.286 18.172 1.00 0.00 C ATOM 8038 NH1 ARG B 580 -96.159 -1.307 19.449 1.00 0.00 N ATOM 8039 NH2 ARG B 580 -94.720 -2.205 17.860 1.00 0.00 N ATOM 8040 N LYS B 581 -101.401 -1.609 16.310 1.00 0.00 N ATOM 8041 CA LYS B 581 -102.691 -2.172 16.184 1.00 0.00 C ATOM 8042 C LYS B 581 -102.861 -3.520 16.869 1.00 0.00 C ATOM 8043 O LYS B 581 -103.895 -3.795 17.482 1.00 0.00 O ATOM 8044 CB LYS B 581 -103.184 -2.482 14.828 1.00 0.00 C ATOM 8045 CG LYS B 581 -103.445 -1.215 14.049 1.00 0.00 C ATOM 8046 CD LYS B 581 -104.034 -1.416 12.590 1.00 0.00 C ATOM 8047 CE LYS B 581 -103.041 -1.821 11.561 1.00 0.00 C ATOM 8048 NZ LYS B 581 -102.210 -0.694 11.216 1.00 0.00 N ATOM 8049 N GLU B 582 -101.868 -4.460 16.792 1.00 0.00 N ATOM 8050 CA GLU B 582 -102.067 -5.768 17.429 1.00 0.00 C ATOM 8051 C GLU B 582 -102.228 -5.718 18.895 1.00 0.00 C ATOM 8052 O GLU B 582 -103.124 -6.326 19.512 1.00 0.00 O ATOM 8053 CB GLU B 582 -100.986 -6.779 16.969 1.00 0.00 C ATOM 8054 CG GLU B 582 -100.771 -6.924 15.445 1.00 0.00 C ATOM 8055 CD GLU B 582 -102.112 -7.083 14.709 1.00 0.00 C ATOM 8056 OE1 GLU B 582 -102.822 -8.097 14.918 1.00 0.00 O ATOM 8057 OE2 GLU B 582 -102.450 -6.132 13.935 1.00 0.00 O ATOM 8058 N TYR B 583 -101.295 -4.945 19.496 1.00 0.00 N ATOM 8059 CA TYR B 583 -101.166 -4.782 20.936 1.00 0.00 C ATOM 8060 C TYR B 583 -102.437 -4.199 21.453 1.00 0.00 C ATOM 8061 O TYR B 583 -103.022 -4.598 22.484 1.00 0.00 O ATOM 8062 CB TYR B 583 -100.009 -3.761 21.302 1.00 0.00 C ATOM 8063 CG TYR B 583 -98.576 -4.382 21.307 1.00 0.00 C ATOM 8064 CD1 TYR B 583 -98.284 -5.485 20.513 1.00 0.00 C ATOM 8065 CD2 TYR B 583 -97.522 -3.683 21.920 1.00 0.00 C ATOM 8066 CE1 TYR B 583 -96.971 -5.840 20.329 1.00 0.00 C ATOM 8067 CE2 TYR B 583 -96.240 -4.264 21.929 1.00 0.00 C ATOM 8068 CZ TYR B 583 -95.896 -5.214 21.038 1.00 0.00 C ATOM 8069 OH TYR B 583 -94.553 -5.510 20.764 1.00 0.00 O ATOM 8070 N LEU B 584 -103.020 -3.261 20.688 1.00 0.00 N ATOM 8071 CA LEU B 584 -104.252 -2.632 20.942 1.00 0.00 C ATOM 8072 C LEU B 584 -105.411 -3.536 20.987 1.00 0.00 C ATOM 8073 O LEU B 584 -106.288 -3.372 21.782 1.00 0.00 O ATOM 8074 CB LEU B 584 -104.507 -1.578 19.795 1.00 0.00 C ATOM 8075 CG LEU B 584 -104.902 -0.138 20.282 1.00 0.00 C ATOM 8076 CD1 LEU B 584 -104.047 0.425 21.423 1.00 0.00 C ATOM 8077 CD2 LEU B 584 -104.857 0.803 19.063 1.00 0.00 C ATOM 8078 N ARG B 585 -105.344 -4.535 20.102 1.00 0.00 N ATOM 8079 CA ARG B 585 -106.423 -5.490 20.111 1.00 0.00 C ATOM 8080 C ARG B 585 -106.504 -6.224 21.326 1.00 0.00 C ATOM 8081 O ARG B 585 -107.597 -6.333 21.859 1.00 0.00 O ATOM 8082 CB ARG B 585 -106.375 -6.581 19.044 1.00 0.00 C ATOM 8083 CG ARG B 585 -106.081 -6.190 17.580 1.00 0.00 C ATOM 8084 CD ARG B 585 -106.986 -5.218 16.894 1.00 0.00 C ATOM 8085 NE ARG B 585 -107.046 -3.890 17.664 1.00 0.00 N ATOM 8086 CZ ARG B 585 -108.055 -2.996 17.528 1.00 0.00 C ATOM 8087 NH1 ARG B 585 -109.412 -3.433 17.303 1.00 0.00 N ATOM 8088 NH2 ARG B 585 -107.856 -1.676 17.740 1.00 0.00 N ATOM 8089 N ILE B 586 -105.388 -6.719 21.862 1.00 0.00 N ATOM 8090 CA ILE B 586 -105.320 -7.441 23.119 1.00 0.00 C ATOM 8091 C ILE B 586 -105.734 -6.604 24.281 1.00 0.00 C ATOM 8092 O ILE B 586 -106.430 -7.044 25.167 1.00 0.00 O ATOM 8093 CB ILE B 586 -103.949 -7.957 23.359 1.00 0.00 C ATOM 8094 CG1 ILE B 586 -103.440 -8.951 22.261 1.00 0.00 C ATOM 8095 CG2 ILE B 586 -103.818 -8.552 24.788 1.00 0.00 C ATOM 8096 CD1 ILE B 586 -102.019 -9.486 22.509 1.00 0.00 C ATOM 8097 N PHE B 587 -105.307 -5.339 24.192 1.00 0.00 N ATOM 8098 CA PHE B 587 -105.523 -4.281 25.226 1.00 0.00 C ATOM 8099 C PHE B 587 -106.967 -4.085 25.484 1.00 0.00 C ATOM 8100 O PHE B 587 -107.420 -4.108 26.629 1.00 0.00 O ATOM 8101 CB PHE B 587 -105.039 -2.905 24.869 1.00 0.00 C ATOM 8102 CG PHE B 587 -105.188 -1.919 26.009 1.00 0.00 C ATOM 8103 CD1 PHE B 587 -104.451 -1.878 27.168 1.00 0.00 C ATOM 8104 CD2 PHE B 587 -106.330 -1.113 25.880 1.00 0.00 C ATOM 8105 CE1 PHE B 587 -104.905 -1.194 28.311 1.00 0.00 C ATOM 8106 CE2 PHE B 587 -106.853 -0.435 27.032 1.00 0.00 C ATOM 8107 CZ PHE B 587 -106.107 -0.487 28.215 1.00 0.00 C ATOM 8108 N ASN B 588 -107.803 -4.056 24.398 1.00 0.00 N ATOM 8109 CA ASN B 588 -109.254 -3.939 24.438 1.00 0.00 C ATOM 8110 C ASN B 588 -109.974 -5.031 25.066 1.00 0.00 C ATOM 8111 O ASN B 588 -110.995 -4.893 25.736 1.00 0.00 O ATOM 8112 CB ASN B 588 -109.824 -3.657 23.025 1.00 0.00 C ATOM 8113 CG ASN B 588 -109.626 -2.162 22.485 1.00 0.00 C ATOM 8114 OD1 ASN B 588 -108.668 -1.923 21.680 1.00 0.00 O ATOM 8115 ND2 ASN B 588 -110.448 -1.245 22.998 1.00 0.00 N ATOM 8116 N PHE B 589 -109.525 -6.264 24.751 1.00 0.00 N ATOM 8117 CA PHE B 589 -110.187 -7.481 25.240 1.00 0.00 C ATOM 8118 C PHE B 589 -110.010 -7.511 26.740 1.00 0.00 C ATOM 8119 O PHE B 589 -110.943 -7.761 27.529 1.00 0.00 O ATOM 8120 CB PHE B 589 -109.675 -8.811 24.703 1.00 0.00 C ATOM 8121 CG PHE B 589 -109.768 -8.821 23.200 1.00 0.00 C ATOM 8122 CD1 PHE B 589 -110.980 -8.529 22.564 1.00 0.00 C ATOM 8123 CD2 PHE B 589 -108.713 -9.254 22.363 1.00 0.00 C ATOM 8124 CE1 PHE B 589 -111.026 -8.606 21.151 1.00 0.00 C ATOM 8125 CE2 PHE B 589 -108.730 -9.310 20.999 1.00 0.00 C ATOM 8126 CZ PHE B 589 -109.937 -8.968 20.295 1.00 0.00 C ATOM 8127 N LEU B 590 -108.772 -7.174 27.175 1.00 0.00 N ATOM 8128 CA LEU B 590 -108.519 -7.065 28.584 1.00 0.00 C ATOM 8129 C LEU B 590 -109.340 -5.984 29.227 1.00 0.00 C ATOM 8130 O LEU B 590 -109.921 -6.271 30.212 1.00 0.00 O ATOM 8131 CB LEU B 590 -107.054 -6.848 28.826 1.00 0.00 C ATOM 8132 CG LEU B 590 -106.142 -8.032 28.398 1.00 0.00 C ATOM 8133 CD1 LEU B 590 -104.674 -7.558 28.298 1.00 0.00 C ATOM 8134 CD2 LEU B 590 -106.268 -9.288 29.275 1.00 0.00 C ATOM 8135 N TRP B 591 -109.432 -4.763 28.632 1.00 0.00 N ATOM 8136 CA TRP B 591 -110.060 -3.635 29.144 1.00 0.00 C ATOM 8137 C TRP B 591 -111.508 -3.821 29.329 1.00 0.00 C ATOM 8138 O TRP B 591 -111.992 -3.410 30.385 1.00 0.00 O ATOM 8139 CB TRP B 591 -109.864 -2.360 28.237 1.00 0.00 C ATOM 8140 CG TRP B 591 -110.688 -1.145 28.537 1.00 0.00 C ATOM 8141 CD1 TRP B 591 -110.494 0.012 29.310 1.00 0.00 C ATOM 8142 CD2 TRP B 591 -112.024 -0.919 27.967 1.00 0.00 C ATOM 8143 NE1 TRP B 591 -111.606 0.788 29.299 1.00 0.00 N ATOM 8144 CE2 TRP B 591 -112.510 0.315 28.452 1.00 0.00 C ATOM 8145 CE3 TRP B 591 -112.806 -1.589 26.960 1.00 0.00 C ATOM 8146 CZ2 TRP B 591 -113.726 0.842 28.145 1.00 0.00 C ATOM 8147 CZ3 TRP B 591 -114.136 -1.102 26.777 1.00 0.00 C ATOM 8148 CH2 TRP B 591 -114.588 0.118 27.343 1.00 0.00 C ATOM 8149 N ARG B 592 -112.275 -4.537 28.430 1.00 0.00 N ATOM 8150 CA ARG B 592 -113.680 -4.802 28.610 1.00 0.00 C ATOM 8151 C ARG B 592 -114.036 -5.716 29.802 1.00 0.00 C ATOM 8152 O ARG B 592 -115.003 -5.491 30.506 1.00 0.00 O ATOM 8153 CB ARG B 592 -114.365 -5.269 27.310 1.00 0.00 C ATOM 8154 CG ARG B 592 -114.199 -6.778 26.927 1.00 0.00 C ATOM 8155 CD ARG B 592 -114.666 -7.040 25.455 1.00 0.00 C ATOM 8156 NE ARG B 592 -113.806 -6.175 24.561 1.00 0.00 N ATOM 8157 CZ ARG B 592 -113.777 -6.220 23.196 1.00 0.00 C ATOM 8158 NH1 ARG B 592 -114.462 -7.213 22.477 1.00 0.00 N ATOM 8159 NH2 ARG B 592 -112.970 -5.332 22.547 1.00 0.00 N ATOM 8160 N PHE B 593 -113.162 -6.740 29.987 1.00 0.00 N ATOM 8161 CA PHE B 593 -113.202 -7.665 31.096 1.00 0.00 C ATOM 8162 C PHE B 593 -113.024 -6.953 32.406 1.00 0.00 C ATOM 8163 O PHE B 593 -113.906 -7.080 33.309 1.00 0.00 O ATOM 8164 CB PHE B 593 -112.100 -8.765 31.070 1.00 0.00 C ATOM 8165 CG PHE B 593 -112.156 -9.567 29.830 1.00 0.00 C ATOM 8166 CD1 PHE B 593 -113.284 -9.762 29.047 1.00 0.00 C ATOM 8167 CD2 PHE B 593 -111.007 -10.219 29.426 1.00 0.00 C ATOM 8168 CE1 PHE B 593 -113.237 -10.546 27.859 1.00 0.00 C ATOM 8169 CE2 PHE B 593 -110.946 -11.110 28.277 1.00 0.00 C ATOM 8170 CZ PHE B 593 -112.102 -11.267 27.515 1.00 0.00 C ATOM 8171 N LYS B 594 -111.965 -6.000 32.538 1.00 0.00 N ATOM 8172 CA LYS B 594 -111.778 -5.144 33.676 1.00 0.00 C ATOM 8173 C LYS B 594 -112.855 -4.182 33.923 1.00 0.00 C ATOM 8174 O LYS B 594 -113.227 -3.978 35.092 1.00 0.00 O ATOM 8175 CB LYS B 594 -110.524 -4.249 33.484 1.00 0.00 C ATOM 8176 CG LYS B 594 -109.151 -5.010 33.317 1.00 0.00 C ATOM 8177 CD LYS B 594 -108.763 -5.761 34.651 1.00 0.00 C ATOM 8178 CE LYS B 594 -107.339 -6.294 34.506 1.00 0.00 C ATOM 8179 NZ LYS B 594 -106.806 -6.994 35.708 1.00 0.00 N ATOM 8180 N LYS B 595 -113.438 -3.596 32.935 1.00 0.00 N ATOM 8181 CA LYS B 595 -114.528 -2.687 33.097 1.00 0.00 C ATOM 8182 C LYS B 595 -115.735 -3.330 33.656 1.00 0.00 C ATOM 8183 O LYS B 595 -116.293 -2.830 34.687 1.00 0.00 O ATOM 8184 CB LYS B 595 -114.811 -2.097 31.675 1.00 0.00 C ATOM 8185 CG LYS B 595 -116.038 -1.242 31.666 1.00 0.00 C ATOM 8186 CD LYS B 595 -116.470 -0.640 30.291 1.00 0.00 C ATOM 8187 CE LYS B 595 -117.510 -1.502 29.660 1.00 0.00 C ATOM 8188 NZ LYS B 595 -116.960 -2.851 29.422 1.00 0.00 N ATOM 8189 N ASN B 596 -116.117 -4.487 33.138 1.00 0.00 N ATOM 8190 CA ASN B 596 -117.202 -5.296 33.690 1.00 0.00 C ATOM 8191 C ASN B 596 -116.845 -5.753 35.102 1.00 0.00 C ATOM 8192 O ASN B 596 -117.734 -5.758 35.938 1.00 0.00 O ATOM 8193 CB ASN B 596 -117.488 -6.437 32.686 1.00 0.00 C ATOM 8194 CG ASN B 596 -117.996 -5.790 31.336 1.00 0.00 C ATOM 8195 OD1 ASN B 596 -118.442 -4.634 31.343 1.00 0.00 O ATOM 8196 ND2 ASN B 596 -117.822 -6.589 30.285 1.00 0.00 N ATOM 8197 N ASN B 597 -115.596 -6.134 35.427 1.00 0.00 N ATOM 8198 CA ASN B 597 -115.169 -6.615 36.695 1.00 0.00 C ATOM 8199 C ASN B 597 -115.336 -5.649 37.792 1.00 0.00 C ATOM 8200 O ASN B 597 -115.865 -5.975 38.859 1.00 0.00 O ATOM 8201 CB ASN B 597 -113.665 -7.081 36.616 1.00 0.00 C ATOM 8202 CG ASN B 597 -113.192 -7.837 37.856 1.00 0.00 C ATOM 8203 OD1 ASN B 597 -112.472 -7.309 38.721 1.00 0.00 O ATOM 8204 ND2 ASN B 597 -113.400 -9.163 37.900 1.00 0.00 N ATOM 8205 N TYR B 598 -114.972 -4.347 37.512 1.00 0.00 N ATOM 8206 CA TYR B 598 -115.160 -3.257 38.465 1.00 0.00 C ATOM 8207 C TYR B 598 -116.631 -3.086 38.689 1.00 0.00 C ATOM 8208 O TYR B 598 -117.082 -2.883 39.793 1.00 0.00 O ATOM 8209 CB TYR B 598 -114.564 -1.907 37.982 1.00 0.00 C ATOM 8210 CG TYR B 598 -114.634 -0.874 39.101 1.00 0.00 C ATOM 8211 CD1 TYR B 598 -113.817 -0.982 40.178 1.00 0.00 C ATOM 8212 CD2 TYR B 598 -115.671 0.092 39.198 1.00 0.00 C ATOM 8213 CE1 TYR B 598 -113.982 -0.287 41.322 1.00 0.00 C ATOM 8214 CE2 TYR B 598 -115.936 0.828 40.364 1.00 0.00 C ATOM 8215 CZ TYR B 598 -115.106 0.589 41.469 1.00 0.00 C ATOM 8216 OH TYR B 598 -115.455 1.220 42.660 1.00 0.00 O ATOM 8217 N PHE B 599 -117.497 -3.138 37.562 1.00 0.00 N ATOM 8218 CA PHE B 599 -118.917 -2.930 37.741 1.00 0.00 C ATOM 8219 C PHE B 599 -119.582 -3.993 38.623 1.00 0.00 C ATOM 8220 O PHE B 599 -120.279 -3.646 39.519 1.00 0.00 O ATOM 8221 CB PHE B 599 -119.658 -3.061 36.393 1.00 0.00 C ATOM 8222 CG PHE B 599 -119.308 -2.010 35.285 1.00 0.00 C ATOM 8223 CD1 PHE B 599 -118.748 -0.750 35.552 1.00 0.00 C ATOM 8224 CD2 PHE B 599 -119.774 -2.365 34.029 1.00 0.00 C ATOM 8225 CE1 PHE B 599 -118.640 0.209 34.531 1.00 0.00 C ATOM 8226 CE2 PHE B 599 -119.803 -1.386 33.010 1.00 0.00 C ATOM 8227 CZ PHE B 599 -119.265 -0.065 33.260 1.00 0.00 C ATOM 8228 N TYR B 600 -119.158 -5.307 38.385 1.00 0.00 N ATOM 8229 CA TYR B 600 -119.605 -6.425 39.169 1.00 0.00 C ATOM 8230 C TYR B 600 -119.170 -6.228 40.637 1.00 0.00 C ATOM 8231 O TYR B 600 -120.027 -6.278 41.492 1.00 0.00 O ATOM 8232 CB TYR B 600 -118.919 -7.598 38.502 1.00 0.00 C ATOM 8233 CG TYR B 600 -119.945 -8.538 37.931 1.00 0.00 C ATOM 8234 CD1 TYR B 600 -120.639 -9.481 38.797 1.00 0.00 C ATOM 8235 CD2 TYR B 600 -120.120 -8.642 36.561 1.00 0.00 C ATOM 8236 CE1 TYR B 600 -121.410 -10.556 38.244 1.00 0.00 C ATOM 8237 CE2 TYR B 600 -120.989 -9.693 36.070 1.00 0.00 C ATOM 8238 CZ TYR B 600 -121.661 -10.644 36.857 1.00 0.00 C ATOM 8239 OH TYR B 600 -122.478 -11.654 36.371 1.00 0.00 O ATOM 8240 N GLN B 601 -117.918 -5.853 41.020 1.00 0.00 N ATOM 8241 CA GLN B 601 -117.657 -5.569 42.394 1.00 0.00 C ATOM 8242 C GLN B 601 -118.463 -4.436 42.907 1.00 0.00 C ATOM 8243 O GLN B 601 -118.850 -4.523 44.107 1.00 0.00 O ATOM 8244 CB GLN B 601 -116.223 -5.093 42.758 1.00 0.00 C ATOM 8245 CG GLN B 601 -115.128 -6.046 42.304 1.00 0.00 C ATOM 8246 CD GLN B 601 -115.325 -7.450 42.748 1.00 0.00 C ATOM 8247 OE1 GLN B 601 -116.046 -7.715 43.716 1.00 0.00 O ATOM 8248 NE2 GLN B 601 -114.519 -8.394 42.137 1.00 0.00 N ATOM 8249 N LYS B 602 -118.645 -3.388 42.135 1.00 0.00 N ATOM 8250 CA LYS B 602 -119.353 -2.202 42.640 1.00 0.00 C ATOM 8251 C LYS B 602 -120.773 -2.522 42.982 1.00 0.00 C ATOM 8252 O LYS B 602 -121.342 -2.152 43.995 1.00 0.00 O ATOM 8253 CB LYS B 602 -119.256 -1.128 41.568 1.00 0.00 C ATOM 8254 CG LYS B 602 -120.141 0.114 41.798 1.00 0.00 C ATOM 8255 CD LYS B 602 -120.244 0.966 40.514 1.00 0.00 C ATOM 8256 CE LYS B 602 -121.390 2.030 40.477 1.00 0.00 C ATOM 8257 NZ LYS B 602 -121.443 2.724 39.167 1.00 0.00 N ATOM 8258 N GLU B 603 -121.419 -3.295 42.100 1.00 0.00 N ATOM 8259 CA GLU B 603 -122.815 -3.649 42.172 1.00 0.00 C ATOM 8260 C GLU B 603 -123.097 -4.430 43.440 1.00 0.00 C ATOM 8261 O GLU B 603 -124.089 -4.241 44.139 1.00 0.00 O ATOM 8262 CB GLU B 603 -123.326 -4.436 40.885 1.00 0.00 C ATOM 8263 CG GLU B 603 -123.511 -3.419 39.697 1.00 0.00 C ATOM 8264 CD GLU B 603 -123.976 -4.216 38.448 1.00 0.00 C ATOM 8265 OE1 GLU B 603 -125.006 -4.930 38.521 1.00 0.00 O ATOM 8266 OE2 GLU B 603 -123.207 -4.170 37.457 1.00 0.00 O ATOM 8267 N MET B 604 -122.196 -5.437 43.678 1.00 0.00 N ATOM 8268 CA MET B 604 -122.315 -6.352 44.758 1.00 0.00 C ATOM 8269 C MET B 604 -122.171 -5.611 46.116 1.00 0.00 C ATOM 8270 O MET B 604 -122.886 -5.769 47.073 1.00 0.00 O ATOM 8271 CB MET B 604 -121.384 -7.601 44.634 1.00 0.00 C ATOM 8272 CG MET B 604 -121.864 -8.779 43.805 1.00 0.00 C ATOM 8273 SD MET B 604 -122.043 -8.371 42.046 1.00 0.00 S ATOM 8274 CE MET B 604 -123.749 -7.967 41.666 1.00 0.00 C ATOM 8275 N LEU B 605 -121.133 -4.701 46.192 1.00 0.00 N ATOM 8276 CA LEU B 605 -120.736 -4.019 47.376 1.00 0.00 C ATOM 8277 C LEU B 605 -121.886 -3.158 47.881 1.00 0.00 C ATOM 8278 O LEU B 605 -122.154 -3.070 49.088 1.00 0.00 O ATOM 8279 CB LEU B 605 -119.426 -3.111 47.245 1.00 0.00 C ATOM 8280 CG LEU B 605 -118.124 -3.929 47.475 1.00 0.00 C ATOM 8281 CD1 LEU B 605 -116.851 -3.210 46.791 1.00 0.00 C ATOM 8282 CD2 LEU B 605 -117.746 -3.958 48.971 1.00 0.00 C ATOM 8283 N LYS B 606 -122.577 -2.465 46.876 1.00 0.00 N ATOM 8284 CA LYS B 606 -123.644 -1.482 47.106 1.00 0.00 C ATOM 8285 C LYS B 606 -124.767 -2.218 47.855 1.00 0.00 C ATOM 8286 O LYS B 606 -125.432 -1.752 48.776 1.00 0.00 O ATOM 8287 CB LYS B 606 -124.210 -0.817 45.916 1.00 0.00 C ATOM 8288 CG LYS B 606 -125.258 0.287 46.060 1.00 0.00 C ATOM 8289 CD LYS B 606 -124.673 1.608 46.608 1.00 0.00 C ATOM 8290 CE LYS B 606 -125.749 2.695 46.671 1.00 0.00 C ATOM 8291 NZ LYS B 606 -125.141 3.952 46.540 1.00 0.00 N ATOM 8292 N SER B 607 -125.044 -3.528 47.405 1.00 0.00 N ATOM 8293 CA SER B 607 -126.092 -4.390 47.872 1.00 0.00 C ATOM 8294 C SER B 607 -125.956 -4.933 49.289 1.00 0.00 C ATOM 8295 O SER B 607 -126.919 -5.249 50.006 1.00 0.00 O ATOM 8296 CB SER B 607 -126.182 -5.659 47.045 1.00 0.00 C ATOM 8297 OG SER B 607 -126.414 -5.260 45.682 1.00 0.00 O ATOM 8298 N ASN B 608 -124.661 -5.019 49.698 1.00 0.00 N ATOM 8299 CA ASN B 608 -124.298 -5.509 51.027 1.00 0.00 C ATOM 8300 C ASN B 608 -124.800 -4.480 52.003 1.00 0.00 C ATOM 8301 O ASN B 608 -125.159 -4.933 53.098 1.00 0.00 O ATOM 8302 CB ASN B 608 -122.819 -5.751 51.148 1.00 0.00 C ATOM 8303 CG ASN B 608 -122.518 -6.967 50.234 1.00 0.00 C ATOM 8304 OD1 ASN B 608 -123.443 -7.724 49.925 1.00 0.00 O ATOM 8305 ND2 ASN B 608 -121.228 -7.104 49.768 1.00 0.00 N ATOM 8306 N ASP B 609 -124.936 -3.183 51.591 1.00 0.00 N ATOM 8307 CA ASP B 609 -125.472 -2.107 52.307 1.00 0.00 C ATOM 8308 C ASP B 609 -126.905 -2.425 52.829 1.00 0.00 C ATOM 8309 O ASP B 609 -127.155 -2.230 54.056 1.00 0.00 O ATOM 8310 CB ASP B 609 -125.491 -0.738 51.633 1.00 0.00 C ATOM 8311 CG ASP B 609 -124.209 -0.084 51.170 1.00 0.00 C ATOM 8312 OD1 ASP B 609 -123.222 -0.172 51.956 1.00 0.00 O ATOM 8313 OD2 ASP B 609 -124.176 0.523 50.117 1.00 0.00 O